F289796

General Info

Members Datasets Scaffolds Average Seq Length
188 122 376 179

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0004141|Ga0466959_0004141_3761_4387
Length 208
Sequence VFESEKLLTRKATPSAARARARKVKLILFDVDGVLTDGTIWFVPIPDGEGTSSNPPEAGHDISRVETKGFHAQDGIGISLARLGQLKTGIVTKRMSEAVALRARDLKLDFVFQGITRKPEVLNKILSEGNIRPEEICYVGDDIIDIPIMRLCGLAIAVANARPQVREIAHYTTPSRGGEGAARDVVEYILKAQNKLEKVVDAYLNARS

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 97.34
Stem 0
Stem Tuber 0
Unclassified 20.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0004141 3300045049 Bacteria 9660
2 rootH2_10150013 3300003320 Bacteria 1959
3 Ga0065715_10179729 3300005293 Bacteria 1473
4 Ga0065707_10112753 3300005295 Bacteria 2350
5 Ga0070683_100066909 3300005329 Bacteria 3346
6 Ga0070690_100067763 3300005330 Unclassified 2313
7 Ga0068869_100199050 3300005334 Bacteria 1579
8 Ga0068869_100799669 3300005334 Bacteria 810
9 Ga0068869_100978618 3300005334 Bacteria 736
10 Ga0070680_100649947 3300005336 Bacteria 906
11 Ga0068868_100680851 3300005338 Bacteria 918
12 Ga0068868_100751422 3300005338 Unclassified 876
13 Ga0070660_100175235 3300005339 Bacteria 1734
14 Ga0070689_100094411 3300005340 Archaea 2362
15 Ga0070692_10039590 3300005345 Bacteria 2407
16 Ga0070669_100033386 3300005353 Bacteria 3722
17 Ga0070703_10000221 3300005406 Bacteria 27478
18 Ga0070703_10234931 3300005406 Unclassified 736
19 Ga0070705_100000012 3300005440 Bacteria 101160
20 Ga0070694_100087991 3300005444 Unclassified 2174
21 Ga0070694_100301258 3300005444 Unclassified 1228
22 Ga0070694_100392785 3300005444 Unclassified 1084
23 Ga0070694_100399391 3300005444 Bacteria 1076
24 Ga0070708_100323913 3300005445 Bacteria 1452
25 Ga0068867_101201767 3300005459 Bacteria 696
26 Ga0070706_100002126 3300005467 Bacteria 20184
27 Ga0070706_100437821 3300005467 Unclassified 1217
28 Ga0070707_100337143 3300005468 Bacteria 1465
29 Ga0070707_100592368 3300005468 Bacteria 1071
30 Ga0070698_101738244 3300005471 Unclassified 576
31 Ga0070699_100000103 3300005518 Bacteria 80532
32 Ga0068853_100703258 3300005539 Bacteria 964
33 Ga0068853_101302653 3300005539 Bacteria 702
34 Ga0070686_100003271 3300005544 Bacteria 8871
35 Ga0070695_100403932 3300005545 Bacteria 1036
36 Ga0070695_101075207 3300005545 Unclassified 657
37 Ga0070696_100176805 3300005546 Bacteria 1581
38 Ga0070696_100472423 3300005546 Bacteria 993
39 Ga0070704_100004045 3300005549 Bacteria 8472
40 Ga0070704_100114440 3300005549 Bacteria 2059
41 Ga0070704_100161175 3300005549 Bacteria 1774
42 Ga0070704_100295381 3300005549 Unclassified 1348
43 Ga0070704_100365356 3300005549 Bacteria 1222
44 Ga0068855_100251451 3300005563 Bacteria 1971
45 Ga0068856_100055398 3300005614 Bacteria 3913
46 Ga0068852_100585371 3300005616 Bacteria 1119
47 Ga0068859_100014186 3300005617 Bacteria 7991
48 Ga0068859_100021728 3300005617 Bacteria 6437
49 Ga0068859_100026126 3300005617 Bacteria 5857
50 Ga0068859_100802232 3300005617 Bacteria 1029
51 Ga0068861_100024102 3300005719 Bacteria 4397
52 Ga0068861_100259016 3300005719 Bacteria 1488
53 Ga0068860_100620020 3300005843 Unclassified 1088
54 Ga0068862_100186946 3300005844 Bacteria 1862
55 Ga0097621_100232066 3300006237 Bacteria 1611
56 Ga0075428_100000013 3300006844 Bacteria 167653
57 Ga0075428_100062654 3300006844 Bacteria 4071
58 Ga0075433_10177188 3300006852 Bacteria 1897
59 Ga0075433_11006199 3300006852 Unclassified 726
60 Ga0075434_100104140 3300006871 Bacteria 2847
61 Ga0075434_100106969 3300006871 Bacteria 2807
62 Ga0075429_101398890 3300006880 Bacteria 609
63 Ga0097620_100014186 3300006931 Bacteria 7991
64 Ga0097620_100021728 3300006931 Bacteria 6437
65 Ga0097620_100026126 3300006931 Bacteria 5857
66 Ga0097620_100802256 3300006931 Bacteria 1029
67 Ga0075435_100119397 3300007076 Bacteria 2199
68 Ga0075435_100222121 3300007076 Unclassified 1604
69 Ga0075435_100223219 3300007076 Bacteria 1600
70 Ga0105240_10156241 3300009093 Bacteria 2712
71 Ga0105240_10804831 3300009093 Unclassified 1018
72 Ga0111539_10014130 3300009094 Bacteria 9973
73 Ga0111539_10221977 3300009094 Unclassified 2201
74 Ga0111539_11473351 3300009094 Unclassified 789
75 Ga0114129_10038549 3300009147 Bacteria 6739
76 Ga0114129_10172358 3300009147 Bacteria 2949
77 Ga0114129_10932362 3300009147 Unclassified 1098
78 Ga0105238_10168902 3300009551 Bacteria 2163
79 Ga0105249_10325263 3300009553 Bacteria 1550
80 Ga0157370_10071502 3300013104 Bacteria 3273
81 Ga0157370_10098179 3300013104 Bacteria 2747
82 Ga0157374_10655185 3300013296 Unclassified 1062
83 Ga0157378_10130848 3300013297 Bacteria 2323
84 Ga0157378_11107685 3300013297 Unclassified 829
85 Ga0163162_10525972 3300013306 Unclassified 1312
86 Ga0157372_10321274 3300013307 Bacteria 1802
87 Ga0157372_10719687 3300013307 Unclassified 1161
88 Ga0157375_10007408 3300013308 Bacteria 9607
89 Ga0157380_10158423 3300014326 Archaea 1965
90 Ga0207653_10000226 3300025885 Bacteria 37617
91 Ga0207645_10400142 3300025907 Bacteria 923
92 Ga0207705_10556644 3300025909 Bacteria 891
93 Ga0207684_10000752 3300025910 Bacteria 37804
94 Ga0207707_10644531 3300025912 Bacteria 893
95 Ga0207695_10055544 3300025913 Bacteria 4126
96 Ga0207695_10263943 3300025913 Bacteria 1619
97 Ga0207646_10612070 3300025922 Bacteria 977
98 Ga0207681_10018848 3300025923 Bacteria 4352
99 Ga0207694_10154821 3300025924 Bacteria 1848
100 Ga0207664_10036665 3300025929 Bacteria 3790
101 Ga0207670_10494982 3300025936 Unclassified 992
102 Ga0207704_10077527 3300025938 Bacteria 2134
103 Ga0207689_10214336 3300025942 Bacteria 1591
104 Ga0207661_10065010 3300025944 Bacteria 2960
105 Ga0207667_10029486 3300025949 Bacteria 5950
106 Ga0207667_10465795 3300025949 Bacteria 1283
107 Ga0207703_10217446 3300026035 Unclassified 1707
108 Ga0207639_10590911 3300026041 Bacteria 1023
109 Ga0207639_10789641 3300026041 Unclassified 884
110 Ga0207708_10095603 3300026075 Bacteria 2294
111 Ga0207708_10101796 3300026075 Bacteria 2224
112 Ga0207702_10466348 3300026078 Bacteria 1227
113 Ga0207675_100038127 3300026118 Bacteria 4485
114 Ga0207428_10091547 3300027907 Bacteria 2361
115 Ga0207428_10663683 3300027907 Unclassified 748
116 Ga0268265_11098622 3300028380 Bacteria 789
117 Ga0268264_11445935 3300028381 Unclassified 698
118 Ga0265334_10031213 3300028573 Bacteria 2130
119 Ga0265338_10007583 3300028800 Bacteria 13406
120 Ga0265338_10042421 3300028800 Bacteria 4236
121 Ga0265338_10060232 3300028800 Bacteria 3338
122 Ga0265338_10219125 3300028800 Bacteria 1422
123 Ga0265342_10222592 3300031712 Unclassified 1016
124 Ga0373953_0069521 3300035117 Bacteria 1451
125 Ga0373956_0237365 3300035119 Bacteria 866
126 Ga0373924_0069459 3300035410 Bacteria 1484
127 Ga0373933_0474989 3300035724 Bacteria 818
128 Ga0373937_0159718 3300036401 Bacteria 2113
129 Ga0373937_0176057 3300036401 Bacteria 2008
130 Ga0373937_0894629 3300036401 Unclassified 837
131 Ga0436365_0340536 3300039437 Bacteria 779
132 Ga0436363_0839991 3300039450 Bacteria 3046
133 Ga0453683_0008968 3300044673 Bacteria 6687
134 Ga0466963_0061095 3300044694 Bacteria 2518
135 Ga0466957_0418670 3300044842 Bacteria 919
136 Ga0466959_0093565 3300045049 Bacteria 2157
137 Ga0451576_0430169 3300045051 Bacteria 1385
138 Ga0495592_0126951 3300046454 Bacteria 1788
139 Ga0495629_0000035 3300046459 Bacteria 118597
140 Ga0495629_0025099 3300046459 Bacteria 4239
141 Ga0495641_0066151 3300046461 Bacteria 1627
142 Ga0495639_0001920 3300046475 Bacteria 9225
143 Ga0495639_0009688 3300046475 Bacteria 4134
144 Ga0495594_0071087 3300046499 Bacteria 1935
145 Ga0495594_0194719 3300046499 Unclassified 1155
146 Ga0495594_0436568 3300046499 Bacteria 744
147 Ga0495666_0122696 3300046526 Bacteria 1216
148 Ga0495640_0254409 3300046533 Bacteria 1099
149 Ga0495640_0277196 3300046533 Bacteria 1045
150 Ga0495622_0008970 3300046557 Bacteria 4635
151 Ga0495634_0026453 3300046642 Bacteria 4048
152 Ga0495647_0000842 3300046681 Bacteria 9171
153 Ga0495647_0025299 3300046681 Bacteria 2168
154 Ga0495658_0000110 3300046683 Bacteria 43595
155 Ga0495658_0030083 3300046683 Unclassified 2946
156 Ga0495613_0044794 3300046689 Bacteria 3272
157 Ga0495581_0000400 3300047315 Bacteria 21772
158 Ga0495581_0004997 3300047315 Bacteria 7681
159 Ga0495676_0008166 3300047321 Bacteria 9602
160 Ga0495676_0118342 3300047321 Bacteria 1932
161 Ga0495680_0217434 3300047322 Bacteria 1365
162 Ga0495614_0001927 3300048089 Bacteria 9104
163 Ga0495614_0073406 3300048089 Unclassified 1477
164 Ga0496114_0833413 3300048917 Bacteria 802
165 Ga0496115_0093242 3300048918 Bacteria 2462
166 Ga0501033_0029242 3300049570 Bacteria 4141
167 Ga0501036_1008168 3300049572 Bacteria 681
168 Ga0501068_0150164 3300049584 Bacteria 1464
169 Ga0501068_0514794 3300049584 Bacteria 777
170 Ga0501071_0365298 3300049587 Bacteria 1099
171 Ga0501073_0724581 3300049589 Unclassified 686
172 Ga0501079_0518684 3300049741 Unclassified 937
173 nmdc:mga05p37_657_c1 3300050507 Bacteria 38229
174 nmdc:mga05p37_833383_c1 3300050507 Unclassified 1004
175 nmdc:mga08y16_1153432_c1 3300050511 Unclassified 748
176 nmdc:mga08y16_59790_c1 3300050511 Bacteria 3980
177 nmdc:mga08y16_82204_c1 3300050511 Bacteria 3358
178 nmdc:mga0n895_51341_c1 3300050512 Bacteria 4045
179 nmdc:mga0rr50_292192_c1 3300050513 Bacteria 1362
180 nmdc:mga0rr50_90350_c1 3300050513 Unclassified 2383
181 nmdc:mga0a205_284535_c1 3300050515 Unclassified 1528
182 nmdc:mga0a205_356363_c1 3300050515 Unclassified 1330
183 nmdc:mga0a205_373830_c1 3300050515 Unclassified 1291
184 nmdc:mga0a205_80094_c1 3300050515 Bacteria 3156
185 nmdc:mga0a205_811927_c1 3300050515 Bacteria 783
186 Ga0495595_0341456 3300053084 Bacteria 755
187 Ga0495619_0006223 3300053085 Bacteria 7568
188 Ga0530510_0400376 3300061734 Bacteria 1035
189 Ga0466959_0004141
190 rootH2_10150013
191 Ga0065715_10179729
192 Ga0065707_10112753
193 Ga0070683_100066909
194 Ga0070690_100067763
195 Ga0068869_100199050
196 Ga0068869_100799669
197 Ga0068869_100978618
198 Ga0070680_100649947
199 Ga0068868_100680851
200 Ga0068868_100751422
201 Ga0070660_100175235
202 Ga0070689_100094411
203 Ga0070692_10039590
204 Ga0070669_100033386
205 Ga0070703_10000221
206 Ga0070703_10234931
207 Ga0070705_100000012
208 Ga0070694_100087991
209 Ga0070694_100301258
210 Ga0070694_100392785
211 Ga0070694_100399391
212 Ga0070708_100323913
213 Ga0068867_101201767
214 Ga0070706_100002126
215 Ga0070706_100437821
216 Ga0070707_100337143
217 Ga0070707_100592368
218 Ga0070698_101738244
219 Ga0070699_100000103
220 Ga0068853_100703258
221 Ga0068853_101302653
222 Ga0070686_100003271
223 Ga0070695_100403932
224 Ga0070695_101075207
225 Ga0070696_100176805
226 Ga0070696_100472423
227 Ga0070704_100004045
228 Ga0070704_100114440
229 Ga0070704_100161175
230 Ga0070704_100295381
231 Ga0070704_100365356
232 Ga0068855_100251451
233 Ga0068856_100055398
234 Ga0068852_100585371
235 Ga0068859_100014186
236 Ga0068859_100021728
237 Ga0068859_100026126
238 Ga0068859_100802232
239 Ga0068861_100024102
240 Ga0068861_100259016
241 Ga0068860_100620020
242 Ga0068862_100186946
243 Ga0097621_100232066
244 Ga0075428_100000013
245 Ga0075428_100062654
246 Ga0075433_10177188
247 Ga0075433_11006199
248 Ga0075434_100104140
249 Ga0075434_100106969
250 Ga0075429_101398890
251 Ga0097620_100014186
252 Ga0097620_100021728
253 Ga0097620_100026126
254 Ga0097620_100802256
255 Ga0075435_100119397
256 Ga0075435_100222121
257 Ga0075435_100223219
258 Ga0105240_10156241
259 Ga0105240_10804831
260 Ga0111539_10014130
261 Ga0111539_10221977
262 Ga0111539_11473351
263 Ga0114129_10038549
264 Ga0114129_10172358
265 Ga0114129_10932362
266 Ga0105238_10168902
267 Ga0105249_10325263
268 Ga0157370_10071502
269 Ga0157370_10098179
270 Ga0157374_10655185
271 Ga0157378_10130848
272 Ga0157378_11107685
273 Ga0163162_10525972
274 Ga0157372_10321274
275 Ga0157372_10719687
276 Ga0157375_10007408
277 Ga0157380_10158423
278 Ga0207653_10000226
279 Ga0207645_10400142
280 Ga0207705_10556644
281 Ga0207684_10000752
282 Ga0207707_10644531
283 Ga0207695_10055544
284 Ga0207695_10263943
285 Ga0207646_10612070
286 Ga0207681_10018848
287 Ga0207694_10154821
288 Ga0207664_10036665
289 Ga0207670_10494982
290 Ga0207704_10077527
291 Ga0207689_10214336
292 Ga0207661_10065010
293 Ga0207667_10029486
294 Ga0207667_10465795
295 Ga0207703_10217446
296 Ga0207639_10590911
297 Ga0207639_10789641
298 Ga0207708_10095603
299 Ga0207708_10101796
300 Ga0207702_10466348
301 Ga0207675_100038127
302 Ga0207428_10091547
303 Ga0207428_10663683
304 Ga0268265_11098622
305 Ga0268264_11445935
306 Ga0265334_10031213
307 Ga0265338_10007583
308 Ga0265338_10042421
309 Ga0265338_10060232
310 Ga0265338_10219125
311 Ga0265342_10222592
312 Ga0373953_0069521
313 Ga0373956_0237365
314 Ga0373924_0069459
315 Ga0373933_0474989
316 Ga0373937_0159718
317 Ga0373937_0176057
318 Ga0373937_0894629
319 Ga0436365_0340536
320 Ga0436363_0839991
321 Ga0453683_0008968
322 Ga0466963_0061095
323 Ga0466957_0418670
324 Ga0466959_0093565
325 Ga0451576_0430169
326 Ga0495592_0126951
327 Ga0495629_0000035
328 Ga0495629_0025099
329 Ga0495641_0066151
330 Ga0495639_0001920
331 Ga0495639_0009688
332 Ga0495594_0071087
333 Ga0495594_0194719
334 Ga0495594_0436568
335 Ga0495666_0122696
336 Ga0495640_0254409
337 Ga0495640_0277196
338 Ga0495622_0008970
339 Ga0495634_0026453
340 Ga0495647_0000842
341 Ga0495647_0025299
342 Ga0495658_0000110
343 Ga0495658_0030083
344 Ga0495613_0044794
345 Ga0495581_0000400
346 Ga0495581_0004997
347 Ga0495676_0008166
348 Ga0495676_0118342
349 Ga0495680_0217434
350 Ga0495614_0001927
351 Ga0495614_0073406
352 Ga0496114_0833413
353 Ga0496115_0093242
354 Ga0501033_0029242
355 Ga0501036_1008168
356 Ga0501068_0150164
357 Ga0501068_0514794
358 Ga0501071_0365298
359 Ga0501073_0724581
360 Ga0501079_0518684
361 nmdc:mga05p37_657_c1
362 nmdc:mga05p37_833383_c1
363 nmdc:mga08y16_1153432_c1
364 nmdc:mga08y16_59790_c1
365 nmdc:mga08y16_82204_c1
366 nmdc:mga0n895_51341_c1
367 nmdc:mga0rr50_292192_c1
368 nmdc:mga0rr50_90350_c1
369 nmdc:mga0a205_284535_c1
370 nmdc:mga0a205_356363_c1
371 nmdc:mga0a205_373830_c1
372 nmdc:mga0a205_80094_c1
373 nmdc:mga0a205_811927_c1
374 Ga0495595_0341456
375 Ga0495619_0006223
376 Ga0530510_0400376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

85

184

0.88

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

57

159

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9747 5 169
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.968 6 169
3n07-assembly1.cif.gz_A-1 structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae 0.9663 5 167
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.9649 8 175
1k1e-assembly1.cif.gz_A structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.963 12 166
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9734 6 167 3.40.50.1000
af_P06685_706_1023_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.9652 108 144 1.20.1110.10
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9624 9 175 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9584 2 177 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9538 12 162 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A383DZ46-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9905 7 126 GO:0008781
GO:0009103
GO:0016788
AF-A0A4P5YR73-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9896 9 177 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-E7C248-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9878 9 175 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A1G1NEM2-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.986 9 169 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A3M1IDM5-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.985 1 177 GO:0008781
GO:0009103
GO:0016788
GO:0046872

Map