F289348

General Info

Members Datasets Scaffolds Average Seq Length
188 134 376 291

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10166724|Ga0105246_101667243
Length 336
Sequence VAAGHIECDTSIQKEIGKKEIRMIRVLHVSVALAVLTGHALAQVAPPTANPPGIGQGPGRGGLAPVVIGPPAPVPPQVAIPRPTPAELTLVNDELKALIASDKSQVKPLLEKFQPLMLLQPPRVNNAATYTQTQQRIGPRHVGFAEIASKGDIDLLLHGDSITDWWVQGDANKAVFDKYFGNIKTANFAIAGDTTQGVLWGLKNGEGQGFQPKAVMLMVGTNNTGGFTGPEIAEGVGAVVLEMRNDFPNAKILLLAIFPRSIPGDPVRDKIAEVNRIISKLDDQQHVFYLDIGAKFLDEKGYFLPDAFRPDNLHPQAKGYDIWGAAVKDKLVELMK

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 0.53
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 29.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10166724 3300011119 Bacteria 1683
2 Ga0065707_10089747 3300005295 Bacteria 4290
3 Ga0070658_10035943 3300005327 Unclassified 3992
4 Ga0070683_100019409 3300005329 Bacteria 6037
5 Ga0070683_100029060 3300005329 Bacteria 5002
6 Ga0070666_10088293 3300005335 Bacteria 2127
7 Ga0068868_100239162 3300005338 Bacteria 1525
8 Ga0070689_100144339 3300005340 Bacteria 1916
9 Ga0070668_100038905 3300005347 Unclassified 3638
10 Ga0070671_100009002 3300005355 Bacteria 8011
11 Ga0070673_100030871 3300005364 Bacteria 4016
12 Ga0070688_100100041 3300005365 Bacteria 1910
13 Ga0070688_100108263 3300005365 Unclassified 1844
14 Ga0070713_100000949 3300005436 Bacteria 18538
15 Ga0070705_100114247 3300005440 Bacteria 1731
16 Ga0070678_100090285 3300005456 Bacteria 2348
17 Ga0068867_100125837 3300005459 Bacteria 1986
18 Ga0068867_100218094 3300005459 Bacteria 1536
19 Ga0070685_10375579 3300005466 Unclassified 978
20 Ga0070684_100068747 3300005535 Bacteria 3114
21 Ga0070684_100153835 3300005535 Bacteria 2085
22 Ga0070672_100052478 3300005543 Bacteria 3183
23 Ga0070693_100033475 3300005547 Bacteria 2837
24 Ga0070704_100235405 3300005549 Bacteria 1496
25 Ga0068855_100085231 3300005563 Bacteria 3656
26 Ga0068857_100288378 3300005577 Bacteria 1511
27 Ga0068859_100023346 3300005617 Bacteria 6208
28 Ga0068859_100032589 3300005617 Bacteria 5234
29 Ga0068870_10164103 3300005840 Bacteria 1320
30 Ga0068860_100018714 3300005843 Bacteria 6733
31 Ga0068860_100036851 3300005843 Unclassified 4683
32 Ga0068860_100557977 3300005843 Bacteria 1148
33 Ga0075367_10112752 3300006178 Bacteria 1670
34 Ga0075366_10025368 3300006195 Unclassified 3462
35 Ga0097621_100046740 3300006237 Bacteria 3504
36 Ga0097621_100330364 3300006237 Unclassified 1352
37 Ga0075428_100055242 3300006844 Bacteria 4350
38 Ga0075428_100212411 3300006844 Bacteria 2091
39 Ga0075430_100233574 3300006846 Bacteria 1525
40 Ga0075431_100186076 3300006847 Unclassified 2130
41 Ga0075431_100273794 3300006847 Unclassified 1710
42 Ga0075433_10122368 3300006852 Bacteria 2311
43 Ga0075434_100276324 3300006871 Bacteria 1699
44 Ga0075434_100558192 3300006871 Bacteria 1165
45 Ga0097620_100023345 3300006931 Bacteria 6208
46 Ga0097620_100032589 3300006931 Bacteria 5234
47 Ga0075435_100087870 3300007076 Bacteria 2562
48 Ga0105240_10219212 3300009093 Bacteria 2218
49 Ga0111539_10001690 3300009094 Bacteria 29436
50 Ga0111539_10052759 3300009094 Bacteria 4840
51 Ga0111539_10099300 3300009094 Bacteria 3419
52 Ga0114129_10042769 3300009147 Bacteria 6376
53 Ga0114129_10297510 3300009147 Bacteria 2152
54 Ga0114129_10683934 3300009147 Bacteria 1320
55 Ga0105241_10054146 3300009174 Bacteria 3070
56 Ga0105242_10026981 3300009176 Unclassified 4555
57 Ga0105242_10041382 3300009176 Bacteria 3716
58 Ga0105242_10326241 3300009176 Bacteria 1410
59 Ga0105248_10012915 3300009177 Bacteria 9209
60 Ga0105248_10032091 3300009177 Bacteria 5869
61 Ga0105248_10069022 3300009177 Bacteria 3968
62 Ga0105248_10212010 3300009177 Bacteria 2182
63 Ga0105238_10010557 3300009551 Bacteria 9276
64 Ga0105238_10103447 3300009551 Bacteria 2829
65 Ga0105238_10168765 3300009551 Unclassified 2164
66 Ga0105249_10621422 3300009553 Bacteria 1136
67 Ga0105249_10752412 3300009553 Unclassified 1037
68 Ga0105239_10047901 3300010375 Bacteria 4684
69 Ga0105246_10032289 3300011119 Unclassified 3471
70 Ga0157369_10270899 3300013105 Unclassified 1769
71 Ga0157374_10002252 3300013296 Bacteria 16248
72 Ga0157374_10053674 3300013296 Unclassified 3758
73 Ga0157378_10002681 3300013297 Bacteria 15862
74 Ga0157378_10120973 3300013297 Bacteria 2413
75 Ga0163162_10265286 3300013306 Bacteria 1849
76 Ga0157372_10102762 3300013307 Bacteria 3265
77 Ga0157375_10005404 3300013308 Bacteria 11105
78 Ga0163163_10000102 3300014325 Bacteria 90323
79 Ga0163163_10027913 3300014325 Bacteria 5412
80 Ga0163163_10122684 3300014325 Unclassified 2633
81 Ga0163163_10225386 3300014325 Unclassified 1923
82 Ga0163163_10397705 3300014325 Unclassified 1436
83 Ga0157380_10493782 3300014326 Bacteria 1187
84 Ga0157379_10044035 3300014968 Unclassified 3986
85 Ga0157376_10022115 3300014969 Bacteria 4950
86 Ga0157376_10347444 3300014969 Unclassified 1418
87 Ga0213876_10072483 3300021384 Bacteria 1819
88 Ga0213875_10007778 3300021388 Bacteria 5509
89 Ga0213875_10037103 3300021388 Unclassified 2297
90 Ga0207643_10090754 3300025908 Unclassified 1781
91 Ga0207654_10049752 3300025911 Bacteria 2406
92 Ga0207695_10021371 3300025913 Bacteria 7384
93 Ga0207695_10153802 3300025913 Bacteria 2237
94 Ga0207694_10011162 3300025924 Bacteria 6781
95 Ga0207694_10037239 3300025924 Unclassified 3735
96 Ga0207650_10116164 3300025925 Bacteria 2078
97 Ga0207687_10000469 3300025927 Bacteria 27498
98 Ga0207700_10008375 3300025928 Bacteria 6402
99 Ga0207706_10139121 3300025933 Bacteria 2136
100 Ga0207686_10017816 3300025934 Unclassified 4009
101 Ga0207686_10039866 3300025934 Unclassified 2852
102 Ga0207709_10137536 3300025935 Bacteria 1675
103 Ga0207670_10155342 3300025936 Bacteria 1702
104 Ga0207704_10156451 3300025938 Unclassified 1616
105 Ga0207665_10299989 3300025939 Bacteria 1201
106 Ga0207691_10084944 3300025940 Bacteria 2841
107 Ga0207691_10130434 3300025940 Bacteria 2221
108 Ga0207711_10015322 3300025941 Bacteria 6364
109 Ga0207711_10040332 3300025941 Bacteria 3972
110 Ga0207711_10096613 3300025941 Unclassified 2608
111 Ga0207689_10008538 3300025942 Bacteria 8930
112 Ga0207689_10048266 3300025942 Unclassified 3511
113 Ga0207679_10027608 3300025945 Bacteria 3928
114 Ga0207667_10045517 3300025949 Bacteria 4647
115 Ga0207712_10117909 3300025961 Unclassified 2003
116 Ga0207712_10170940 3300025961 Bacteria 1699
117 Ga0207668_10218530 3300025972 Bacteria 1529
118 Ga0207658_10060393 3300025986 Unclassified 2829
119 Ga0207677_10111898 3300026023 Bacteria 2035
120 Ga0207703_10163686 3300026035 Bacteria 1950
121 Ga0207648_10024718 3300026089 Bacteria 5358
122 Ga0207648_10066623 3300026089 Bacteria 3140
123 Ga0207683_10013898 3300026121 Bacteria 6864
124 Ga0207428_10000941 3300027907 Bacteria 32362
125 Ga0268264_10164054 3300028381 Unclassified 2004
126 Ga0265338_10107291 3300028800 Bacteria 2259
127 Ga0307407_10206146 3300031903 Unclassified 1321
128 Ga0307411_10323483 3300032005 Unclassified 1246
129 Ga0373926_0010447 3300035083 Unclassified 3113
130 Ga0373934_0048872 3300035086 Unclassified 1675
131 Ga0373957_0049094 3300035120 Unclassified 1610
132 Ga0373955_0088817 3300035172 Unclassified 1758
133 Ga0373927_0034868 3300035695 Unclassified 3272
134 Ga0373933_0007909 3300035724 Viruses 5803
135 Ga0373937_0016761 3300036401 Bacteria 6512
136 Ga0436364_0883828 3300037853 Bacteria 5051
137 Ga0436365_0636108 3300039437 Bacteria 3920
138 Ga0439445_0027655 3300042004 Unclassified 1458
139 Ga0451576_0258188 3300045051 Bacteria 1821
140 Ga0495653_0061678 3300046463 Bacteria 2836
141 Ga0495653_0062174 3300046463 Bacteria 2822
142 Ga0495639_0022404 3300046475 Unclassified 2771
143 Ga0495664_0073271 3300046477 Archaea 2047
144 Ga0495594_0012453 3300046499 Bacteria 4431
145 Ga0495628_0023384 3300046516 Bacteria 5073
146 Ga0495630_0196162 3300046517 Archaea 1540
147 Ga0495643_0004398 3300046522 Bacteria 9873
148 Ga0495665_0084011 3300046531 Archaea 1674
149 Ga0495640_0245465 3300046533 Unclassified 1123
150 Ga0495586_0097833 3300046535 Unclassified 1626
151 Ga0495586_0227749 3300046535 Bacteria 1060
152 Ga0495587_0007341 3300046536 Bacteria 7144
153 Ga0495587_0036027 3300046536 Bacteria 2978
154 Ga0495634_0105261 3300046642 Unclassified 1819
155 Ga0495634_0115757 3300046642 Archaea 1720
156 Ga0495635_0022019 3300046663 Unclassified 4441
157 Ga0495657_0225241 3300046675 Unclassified 1136
158 Ga0495599_0002994 3300046678 Bacteria 9840
159 Ga0495646_0071678 3300046680 Archaea 2038
160 Ga0495669_0127922 3300046684 Unclassified 1194
161 Ga0495613_0168164 3300046689 Unclassified 1557
162 Ga0495624_0339447 3300046690 Archaea 904
163 Ga0495600_0072659 3300046809 Archaea 2246
164 Ga0495600_0238434 3300046809 Unclassified 1159
165 Ga0495636_0085660 3300047318 Bacteria 1362
166 Ga0495680_0050229 3300047322 Archaea 3262
167 Ga0495680_0261806 3300047322 Bacteria 1223
168 Ga0495602_0182079 3300048088 Unclassified 1619
169 Ga0496115_0152336 3300048918 Bacteria 1909
170 Ga0501037_0047495 3300049573 Unclassified 3146
171 Ga0501042_0010605 3300049578 Bacteria 6189
172 Ga0501048_0195105 3300049582 Bacteria 1435
173 Ga0501073_0088085 3300049589 Bacteria 2159
174 nmdc:mga05p37_41943_c1 3300050507 Bacteria 5621
175 nmdc:mga05p37_523979_c1 3300050507 Bacteria 1355
176 nmdc:mga06r32_155517_c1 3300050510 Unclassified 2268
177 nmdc:mga06r32_177944_c1 3300050510 Bacteria 2112
178 nmdc:mga06r32_280233_c1 3300050510 Unclassified 1654
179 nmdc:mga08y16_20271_c1 3300050511 Bacteria 7018
180 nmdc:mga08y16_248961_c1 3300050511 Bacteria 1836
181 nmdc:mga08y16_5897_c1 3300050511 Bacteria 12841
182 nmdc:mga0rr50_114879_c1 3300050513 Bacteria 2135
183 nmdc:mga0a205_50568_c1 3300050515 Bacteria 4012
184 nmdc:mga0a205_51388_c1 3300050515 Bacteria 3979
185 Ga0500568_0000363 3300053139 Bacteria 35129
186 Ga0501084_0038852 3300054114 Unclassified 3980
187 Ga0501082_0076928 3300060353 Unclassified 2877
188 Ga0530510_0177930 3300061734 Unclassified 1577
189 Ga0105246_10166724
190 Ga0065707_10089747
191 Ga0070658_10035943
192 Ga0070683_100019409
193 Ga0070683_100029060
194 Ga0070666_10088293
195 Ga0068868_100239162
196 Ga0070689_100144339
197 Ga0070668_100038905
198 Ga0070671_100009002
199 Ga0070673_100030871
200 Ga0070688_100100041
201 Ga0070688_100108263
202 Ga0070713_100000949
203 Ga0070705_100114247
204 Ga0070678_100090285
205 Ga0068867_100125837
206 Ga0068867_100218094
207 Ga0070685_10375579
208 Ga0070684_100068747
209 Ga0070684_100153835
210 Ga0070672_100052478
211 Ga0070693_100033475
212 Ga0070704_100235405
213 Ga0068855_100085231
214 Ga0068857_100288378
215 Ga0068859_100023346
216 Ga0068859_100032589
217 Ga0068870_10164103
218 Ga0068860_100018714
219 Ga0068860_100036851
220 Ga0068860_100557977
221 Ga0075367_10112752
222 Ga0075366_10025368
223 Ga0097621_100046740
224 Ga0097621_100330364
225 Ga0075428_100055242
226 Ga0075428_100212411
227 Ga0075430_100233574
228 Ga0075431_100186076
229 Ga0075431_100273794
230 Ga0075433_10122368
231 Ga0075434_100276324
232 Ga0075434_100558192
233 Ga0097620_100023345
234 Ga0097620_100032589
235 Ga0075435_100087870
236 Ga0105240_10219212
237 Ga0111539_10001690
238 Ga0111539_10052759
239 Ga0111539_10099300
240 Ga0114129_10042769
241 Ga0114129_10297510
242 Ga0114129_10683934
243 Ga0105241_10054146
244 Ga0105242_10026981
245 Ga0105242_10041382
246 Ga0105242_10326241
247 Ga0105248_10012915
248 Ga0105248_10032091
249 Ga0105248_10069022
250 Ga0105248_10212010
251 Ga0105238_10010557
252 Ga0105238_10103447
253 Ga0105238_10168765
254 Ga0105249_10621422
255 Ga0105249_10752412
256 Ga0105239_10047901
257 Ga0105246_10032289
258 Ga0157369_10270899
259 Ga0157374_10002252
260 Ga0157374_10053674
261 Ga0157378_10002681
262 Ga0157378_10120973
263 Ga0163162_10265286
264 Ga0157372_10102762
265 Ga0157375_10005404
266 Ga0163163_10000102
267 Ga0163163_10027913
268 Ga0163163_10122684
269 Ga0163163_10225386
270 Ga0163163_10397705
271 Ga0157380_10493782
272 Ga0157379_10044035
273 Ga0157376_10022115
274 Ga0157376_10347444
275 Ga0213876_10072483
276 Ga0213875_10007778
277 Ga0213875_10037103
278 Ga0207643_10090754
279 Ga0207654_10049752
280 Ga0207695_10021371
281 Ga0207695_10153802
282 Ga0207694_10011162
283 Ga0207694_10037239
284 Ga0207650_10116164
285 Ga0207687_10000469
286 Ga0207700_10008375
287 Ga0207706_10139121
288 Ga0207686_10017816
289 Ga0207686_10039866
290 Ga0207709_10137536
291 Ga0207670_10155342
292 Ga0207704_10156451
293 Ga0207665_10299989
294 Ga0207691_10084944
295 Ga0207691_10130434
296 Ga0207711_10015322
297 Ga0207711_10040332
298 Ga0207711_10096613
299 Ga0207689_10008538
300 Ga0207689_10048266
301 Ga0207679_10027608
302 Ga0207667_10045517
303 Ga0207712_10117909
304 Ga0207712_10170940
305 Ga0207668_10218530
306 Ga0207658_10060393
307 Ga0207677_10111898
308 Ga0207703_10163686
309 Ga0207648_10024718
310 Ga0207648_10066623
311 Ga0207683_10013898
312 Ga0207428_10000941
313 Ga0268264_10164054
314 Ga0265338_10107291
315 Ga0307407_10206146
316 Ga0307411_10323483
317 Ga0373926_0010447
318 Ga0373934_0048872
319 Ga0373957_0049094
320 Ga0373955_0088817
321 Ga0373927_0034868
322 Ga0373933_0007909
323 Ga0373937_0016761
324 Ga0436364_0883828
325 Ga0436365_0636108
326 Ga0439445_0027655
327 Ga0451576_0258188
328 Ga0495653_0061678
329 Ga0495653_0062174
330 Ga0495639_0022404
331 Ga0495664_0073271
332 Ga0495594_0012453
333 Ga0495628_0023384
334 Ga0495630_0196162
335 Ga0495643_0004398
336 Ga0495665_0084011
337 Ga0495640_0245465
338 Ga0495586_0097833
339 Ga0495586_0227749
340 Ga0495587_0007341
341 Ga0495587_0036027
342 Ga0495634_0105261
343 Ga0495634_0115757
344 Ga0495635_0022019
345 Ga0495657_0225241
346 Ga0495599_0002994
347 Ga0495646_0071678
348 Ga0495669_0127922
349 Ga0495613_0168164
350 Ga0495624_0339447
351 Ga0495600_0072659
352 Ga0495600_0238434
353 Ga0495636_0085660
354 Ga0495680_0050229
355 Ga0495680_0261806
356 Ga0495602_0182079
357 Ga0496115_0152336
358 Ga0501037_0047495
359 Ga0501042_0010605
360 Ga0501048_0195105
361 Ga0501073_0088085
362 nmdc:mga05p37_41943_c1
363 nmdc:mga05p37_523979_c1
364 nmdc:mga06r32_155517_c1
365 nmdc:mga06r32_177944_c1
366 nmdc:mga06r32_280233_c1
367 nmdc:mga08y16_20271_c1
368 nmdc:mga08y16_248961_c1
369 nmdc:mga08y16_5897_c1
370 nmdc:mga0rr50_114879_c1
371 nmdc:mga0a205_50568_c1
372 nmdc:mga0a205_51388_c1
373 Ga0500568_0000363
374 Ga0501084_0038852
375 Ga0501082_0076928
376 Ga0530510_0177930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13472

Lipase_GDSL_2

GDSL-like Lipase/Acylhydrolase family

157

322

0.82

PF00657

Lipase_GDSL

GDSL-like Lipase/Acylhydrolase

155

327

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1es9-assembly1.cif.gz_A-2 x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah) 0.8742 67 277
3dt9-assembly1.cif.gz_A crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by soman 0.874 67 277
1bwp-assembly1.cif.gz_A-2 probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase 0.8727 67 277
1wab-assembly1.cif.gz_A platelet-activating factor acetylhydrolase 0.8676 67 277
1bwr-assembly1.cif.gz_A-2 probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase 0.8671 67 277
ID Description Score Start End Superfamily
af_Q9VXP4_1_222_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8677 67 278 3.40.50.1110
af_O35264_1_229_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8536 62 278 3.40.50.1110
af_Q9VXP4_1_222_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.8273 67 278 3.40.50.1110
af_O35264_1_229_3.40.50.1110 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.808 62 278 3.40.50.1110
af_A0A2R8QJS0_198_300_3.40.50.12700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7983 177 276 3.40.50.12700
ID Description Score Start End GO Terms
AF-A0A7C4LUX5-F1-model_v4 GDSL family lipase 0.9382 99 279
AF-A0A4Q3BIC8-F1-model_v4 deleted 0.9307 129 279
AF-A0A6N6PDQ8-F1-model_v4 Trehalose utilization protein 0.9302 117 278
AF-A0A4Q5S0F6-F1-model_v4 GDSL family lipase 0.9282 99 279 GO:0052689
AF-A0A7C4LUX5-F1-model_v4 GDSL family lipase 0.9281 99 279

Map