F288827

General Info

Members Datasets Scaffolds Average Seq Length
188 133 188 265

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100455481|Ga0068868_1004554811
Length 260
Sequence MNKQQSTKTATHSKKKADQYNDPSHNYLKYWTGRDYEHAAEAMAIRRLLKGKHFKNAVDVGGGYGRLCVLLEAYADKVTLAEPSQQQLDIAKDYLKDHPEVDRKLLQADDLKFKDGAIDLLTMIRVMHHLPDPSSEFAEFARVLSDDGYAIIEVANYTHARNRLKHALKGKKLPLEPVDISSKKREGEIPFVNHNPDTVIKQLAHAGLKVDRILSVSNLRSPGLKKIMPKRVMLAIEGVLQPTLANSYFGPSVFLLVKKA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
109 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
113 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
119 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
122 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
125 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
126 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
130 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
131 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
132 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.32
Nodule 0
Rhizoplane 0.53
Rhizosphere 65.43
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002050 3300001915 Bacteria 5402
2 JGI24740J21852_10032587 3300001979 Bacteria 1665
3 JGI24737J22298_10000026 3300001990 Bacteria 43680
4 JGI24735J21928_10000080 3300002067 Bacteria 37384
5 rootL2_10042870 3300003322 Bacteria 7119
6 rootL2_10056829 3300003322 Bacteria 6572
7 rootL2_10141818 3300003322 Unclassified 1051
8 rootH1_10089243 3300003323 Bacteria 2252
9 rootH1_10313042 3300003323 Bacteria 1362
10 Ga0065704_10204474 3300005289 Unclassified 1133
11 Ga0070658_10000491 3300005327 Bacteria 34335
12 Ga0070683_100000138 3300005329 Bacteria 47210
13 Ga0070683_100000261 3300005329 Bacteria 36323
14 Ga0070683_100026595 3300005329 Bacteria 5213
15 Ga0070690_100000942 3300005330 Bacteria 14855
16 Ga0070670_100165314 3300005331 Bacteria 1918
17 Ga0070666_10007793 3300005335 Bacteria 6614
18 Ga0070666_10070962 3300005335 Bacteria 2370
19 Ga0068868_100455481 3300005338 Bacteria 1113
20 Ga0070668_100296285 3300005347 Bacteria 1355
21 Ga0070671_100000001 3300005355 Bacteria 1228151
22 Ga0070667_100000001 3300005367 Bacteria 1108638
23 Ga0070667_100014847 3300005367 Bacteria 6435
24 Ga0070700_100445199 3300005441 Bacteria 984
25 Ga0070678_100326689 3300005456 Bacteria 1311
26 Ga0070679_100026609 3300005530 Bacteria 5687
27 Ga0070684_100000229 3300005535 Bacteria 38887
28 Ga0070684_100006296 3300005535 Bacteria 9170
29 Ga0068855_100000003 3300005563 Bacteria 589862
30 Ga0068855_100003159 3300005563 Bacteria 20166
31 Ga0068855_100019950 3300005563 Bacteria 8051
32 Ga0068857_100363457 3300005577 Bacteria 1342
33 Ga0068856_100004358 3300005614 Bacteria 14102
34 Ga0068856_100033659 3300005614 Bacteria 5018
35 Ga0068852_100232967 3300005616 Bacteria 1756
36 Ga0068861_100365400 3300005719 Bacteria 1270
37 Ga0068860_100103081 3300005843 Bacteria 2723
38 Ga0081455_10000003 3300005937 Bacteria 367763
39 Ga0070717_10381845 3300006028 Bacteria 1263
40 Ga0075365_10000043 3300006038 Bacteria 41148
41 Ga0075368_10000232 3300006042 Bacteria 15751
42 Ga0075363_100000118 3300006048 Bacteria 18520
43 Ga0075362_10024790 3300006177 Bacteria 2547
44 Ga0075367_10000088 3300006178 Bacteria 24938
45 Ga0075367_10000840 3300006178 Bacteria 12203
46 Ga0075369_10000108 3300006186 Bacteria 22404
47 Ga0075366_10000001 3300006195 Bacteria 569172
48 Ga0075366_10000171 3300006195 Bacteria 27869
49 Ga0075366_10000294 3300006195 Bacteria 22461
50 Ga0075366_10000501 3300006195 Bacteria 18164
51 Ga0075366_10025226 3300006195 Bacteria 3471
52 Ga0075370_10003048 3300006353 Bacteria 7898
53 Ga0075370_10022939 3300006353 Bacteria 3433
54 Ga0075428_100037153 3300006844 Bacteria 5363
55 Ga0075430_100022638 3300006846 Bacteria 5347
56 Ga0105240_10036177 3300009093 Bacteria 6353
57 Ga0105245_10035217 3300009098 Bacteria 4443
58 Ga0105243_10003514 3300009148 Bacteria 12662
59 Ga0105241_10000003 3300009174 Bacteria 839043
60 Ga0105241_10014027 3300009174 Bacteria 5874
61 Ga0105242_10465788 3300009176 Bacteria 1194
62 Ga0105249_10000802 3300009553 Bacteria 28271
63 Ga0105033_100134 3300009986 Bacteria 5597
64 Ga0157373_10000042 3300013100 Bacteria 113564
65 Ga0157371_10001081 3300013102 Bacteria 29510
66 Ga0157370_10092682 3300013104 Unclassified 2835
67 Ga0157370_10122816 3300013104 Unclassified 2425
68 Ga0157369_10000945 3300013105 Bacteria 36893
69 Ga0157369_10435853 3300013105 Bacteria 1358
70 Ga0157374_10000945 3300013296 Bacteria 25227
71 Ga0163163_10142662 3300014325 Unclassified 2438
72 Ga0157377_10004608 3300014745 Bacteria 6372
73 Ga0207647_10000506 3300025904 Bacteria 31217
74 Ga0207645_10001659 3300025907 Bacteria 18129
75 Ga0207705_10000011 3300025909 Bacteria 517768
76 Ga0207705_10012998 3300025909 Bacteria 6008
77 Ga0207654_10000002 3300025911 Bacteria 1460142
78 Ga0207654_10024769 3300025911 Bacteria 3230
79 Ga0207657_10000931 3300025919 Bacteria 30961
80 Ga0207652_10001646 3300025921 Bacteria 19604
81 Ga0207652_10023052 3300025921 Bacteria 5156
82 Ga0207652_10357311 3300025921 Bacteria 1318
83 Ga0207650_10180484 3300025925 Unclassified 1682
84 Ga0207687_10111813 3300025927 Bacteria 2028
85 Ga0207644_10000001 3300025931 Bacteria 1243214
86 Ga0207709_10003739 3300025935 Bacteria 8955
87 Ga0207661_10000021 3300025944 Bacteria 205381
88 Ga0207661_10001940 3300025944 Bacteria 14232
89 Ga0207661_10026305 3300025944 Unclassified 4432
90 Ga0207667_10000008 3300025949 Bacteria 625138
91 Ga0207667_10009455 3300025949 Bacteria 11478
92 Ga0207667_10061073 3300025949 Bacteria 3944
93 Ga0207712_10033595 3300025961 Bacteria 3469
94 Ga0207658_10073053 3300025986 Bacteria 2602
95 Ga0207639_10052778 3300026041 Unclassified 3099
96 Ga0207708_10537330 3300026075 Bacteria 984
97 Ga0207702_10006432 3300026078 Bacteria 10135
98 Ga0207674_10548903 3300026116 Unclassified 1116
99 Ga0207683_10032328 3300026121 Bacteria 4545
100 Ga0209998_10003391 3300027717 Bacteria 3492
101 Ga0209813_10000004 3300027866 Bacteria 139340
102 Ga0209813_10021842 3300027866 Bacteria 1803
103 Ga0268264_10185867 3300028381 Unclassified 1891
104 Ga0265319_1002198 3300028563 Bacteria 10860
105 Ga0265338_10011893 3300028800 Bacteria 9995
106 Ga0265327_10002516 3300031251 Bacteria 19138
107 Ga0265327_10029695 3300031251 Bacteria 3105
108 Ga0265316_10146879 3300031344 Bacteria 1768
109 Ga0395898_0124309 3300037466 Unclassified 2472
110 Ga0395905_0003963 3300037471 Bacteria 15579
111 Ga0395901_0012871 3300038443 Bacteria 8484
112 Ga0395901_0098545 3300038443 Bacteria 3065
113 Ga0451807_0132164 3300041486 Unclassified 2267
114 Ga0495629_0030468 3300046459 Unclassified 3824
115 Ga0495622_0000082 3300046557 Bacteria 85266
116 Ga0495588_0000116 3300046674 Bacteria 135919
117 Ga0495658_0009320 3300046683 Bacteria 4889
118 Ga0495649_0000073 3300046694 Bacteria 86337
119 Ga0495672_0000129 3300047320 Bacteria 112879
120 Ga0495593_0236972 3300047673 Bacteria 914
121 Ga0496125_0132689 3300048928 Bacteria 1750
122 Ga0496126_0200540 3300048929 Bacteria 1685
123 Ga0501032_0002152 3300049569 Bacteria 15515
124 Ga0501034_0002756 3300049571 Bacteria 20637
125 Ga0501036_0008729 3300049572 Bacteria 8315
126 Ga0501037_0000133 3300049573 Bacteria 69741
127 Ga0501037_0083649 3300049573 Unclassified 2312
128 Ga0501038_0002588 3300049574 Bacteria 16889
129 Ga0501042_0188066 3300049578 Bacteria 1489
130 Ga0501043_0000404 3300049579 Bacteria 38801
131 Ga0501043_0301049 3300049579 Bacteria 1225
132 Ga0501046_0000038 3300049580 Bacteria 159193
133 Ga0501046_0356023 3300049580 Bacteria 1062
134 Ga0501047_0000229 3300049581 Bacteria 66412
135 Ga0501047_0007808 3300049581 Bacteria 10074
136 Ga0501048_0000033 3300049582 Bacteria 64896
137 Ga0501048_0040637 3300049582 Bacteria 3332
138 Ga0501070_0245615 3300049586 Bacteria 1465
139 Ga0501073_0027556 3300049589 Bacteria 4063
140 Ga0501073_0159470 3300049589 Bacteria 1563
141 Ga0501080_0002131 3300049742 Bacteria 17194
142 Ga0501080_0259962 3300049742 Bacteria 1582
143 Ga0501035_0000033 3300049822 Bacteria 175087
144 Ga0501035_0000562 3300049822 Bacteria 41104
145 Ga0501044_0041370 3300049823 Bacteria 4797
146 nmdc:mga03683_544_c1 3300050489 Bacteria 6579
147 nmdc:mga03n38_44_c1 3300050490 Bacteria 26398
148 nmdc:mga0yw44_11098_c1 3300050492 Bacteria 4631
149 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
150 nmdc:mga0yw44_31615_c2 3300050492 Bacteria 2782
151 nmdc:mga0k408_10908_c1 3300050493 Bacteria 4928
152 nmdc:mga0k408_13082_c1 3300050493 Bacteria 4545
153 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
154 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
155 nmdc:mga0k408_2058_c1 3300050493 Bacteria 10755
156 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
157 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
158 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
159 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
160 nmdc:mga04h51_5859_c1 3300050495 Bacteria 3151
161 nmdc:mga07m45_10433_c1 3300050496 Bacteria 4853
162 nmdc:mga07m45_14113_c1 3300050496 Bacteria 4250
163 nmdc:mga0qj67_16558_c1 3300050509 Bacteria 5594
164 nmdc:mga0sz30_8_c2 3300050516 Bacteria 48225
165 Ga0500610_0000001 3300053079 Bacteria 185468
166 Ga0500643_000010 3300053087 Bacteria 408084
167 Ga0500643_000038 3300053087 Bacteria 178974
168 Ga0500643_011258 3300053087 Bacteria 3273
169 Ga0500644_0000744 3300053088 Bacteria 11288
170 Ga0500644_0001904 3300053088 Bacteria 5356
171 Ga0500583_0014700 3300053092 Bacteria 3074
172 Ga0500583_0016014 3300053092 Bacteria 2983
173 Ga0500566_0000001 3300053094 Bacteria 1101031
174 Ga0500555_000001 3300053103 Bacteria 1353713
175 Ga0500555_000002 3300053103 Bacteria 1314346
176 Ga0500562_000002 3300053108 Bacteria 977234
177 Ga0500593_000001 3300053117 Bacteria 784404
178 Ga0500594_0001288 3300053118 Bacteria 5446
179 Ga0500614_000001 3300053123 Bacteria 1274484
180 Ga0500614_004635 3300053123 Unclassified 2898
181 Ga0500628_000012 3300053129 Bacteria 106556
182 Ga0500652_000950 3300053131 Bacteria 9599
183 Ga0500559_0011088 3300053136 Unclassified 3859
184 Ga0500561_0000001 3300053137 Bacteria 957685
185 Ga0500603_019647 3300053150 Bacteria 1642
186 Ga0500649_000013 3300053722 Bacteria 73694
187 Ga0500570_000005 3300053724 Bacteria 132994
188 Ga0501082_0009636 3300060353 Bacteria 8315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025961 Ga0207712_10033595 Ga0207712_100335952 218
2 3300006846 Ga0075430_100022638 Ga0075430_1000226383 249
3 3300025907 Ga0207645_10001659 Ga0207645_100016599 249
4 3300005330 Ga0070690_100000942 Ga0070690_1000009427 250
5 3300009098 Ga0105245_10035217 Ga0105245_100352174 251
6 3300009176 Ga0105242_10465788 Ga0105242_104657882 251
7 3300025927 Ga0207687_10111813 Ga0207687_101118132 251
8 3300031251 Ga0265327_10002516 Ga0265327_1000251612 251
9 3300049589 Ga0501073_0159470 Ga0501073_0159470_216_977 251
10 3300049742 Ga0501080_0002131 Ga0501080_0002131_14426_15187 251
11 3300005937 Ga0081455_10000003 Ga0081455_10000003321 252
12 3300009553 Ga0105249_10000802 Ga0105249_1000080220 252
13 3300049586 Ga0501070_0245615 Ga0501070_0245615_624_1391 252
14 3300006195 Ga0075366_10025226 Ga0075366_100252262 253
15 3300013104 Ga0157370_10122816 Ga0157370_101228163 253
16 3300049580 Ga0501046_0356023 Ga0501046_0356023_32_799 253
17 3300050493 nmdc:mga0k408_10908_c1 nmdc:mga0k408_10908_c1_2428_3237 253
18 3300053087 Ga0500643_000010 Ga0500643_000010_371181_372065 254
19 3300005563 Ga0068855_100003159 Ga0068855_1000031598 255
20 3300006028 Ga0070717_10381845 Ga0070717_103818452 255
21 3300025949 Ga0207667_10009455 Ga0207667_1000945511 255
22 3300025909 Ga0207705_10000011 Ga0207705_10000011284 256
23 3300025919 Ga0207657_10000931 Ga0207657_100009316 256
24 3300025921 Ga0207652_10357311 Ga0207652_103573112 256
25 3300001990 JGI24737J22298_10000026 JGI24737J22298_1000002611 257
26 3300002067 JGI24735J21928_10000080 JGI24735J21928_1000008011 257
27 3300025904 Ga0207647_10000506 Ga0207647_1000050617 257
28 3300053137 Ga0500561_0000001 Ga0500561_0000001_572355_573134 257
29 3300003322 rootL2_10056829 rootL2_100568294 258
30 3300005327 Ga0070658_10000491 Ga0070658_1000049131 258
31 3300005329 Ga0070683_100026595 Ga0070683_1000265953 258
32 3300005367 Ga0070667_100014847 Ga0070667_1000148472 258
33 3300005441 Ga0070700_100445199 Ga0070700_1004451991 258
34 3300005456 Ga0070678_100326689 Ga0070678_1003266892 258
35 3300005577 Ga0068857_100363457 Ga0068857_1003634572 258
36 3300006038 Ga0075365_10000043 Ga0075365_1000004326 258
37 3300006042 Ga0075368_10000232 Ga0075368_100002326 258
38 3300006048 Ga0075363_100000118 Ga0075363_10000011812 258
39 3300006178 Ga0075367_10000840 Ga0075367_1000084014 258
40 3300006353 Ga0075370_10003048 Ga0075370_100030482 258
41 3300006353 Ga0075370_10022939 Ga0075370_100229393 258
42 3300009148 Ga0105243_10003514 Ga0105243_100035146 258
43 3300013102 Ga0157371_10001081 Ga0157371_100010817 258
44 3300013105 Ga0157369_10435853 Ga0157369_104358532 258
45 3300014325 Ga0163163_10142662 Ga0163163_101426622 258
46 3300025909 Ga0207705_10012998 Ga0207705_100129983 258
47 3300025935 Ga0207709_10003739 Ga0207709_100037392 258
48 3300025944 Ga0207661_10026305 Ga0207661_100263053 258
49 3300025986 Ga0207658_10073053 Ga0207658_100730532 258
50 3300026075 Ga0207708_10537330 Ga0207708_105373301 258
51 3300026116 Ga0207674_10548903 Ga0207674_105489032 258
52 3300026121 Ga0207683_10032328 Ga0207683_100323282 258
53 3300027866 Ga0209813_10000004 Ga0209813_10000004136 258
54 3300028563 Ga0265319_1002198 Ga0265319_10021987 258
55 3300028800 Ga0265338_10011893 Ga0265338_100118937 258
56 3300031344 Ga0265316_10146879 Ga0265316_101468792 258
57 3300050490 nmdc:mga03n38_44_c1 nmdc:mga03n38_44_c1_8135_8920 258
58 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_257063_257848 258
59 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_75534_76319 258
60 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_8241_9026 258
61 3300050496 nmdc:mga07m45_10433_c1 nmdc:mga07m45_10433_c1_3823_4608 258
62 3300050496 nmdc:mga07m45_14113_c1 nmdc:mga07m45_14113_c1_1447_2232 258
63 3300053079 Ga0500610_0000001 Ga0500610_0000001_90216_90998 258
64 3300053087 Ga0500643_011258 Ga0500643_011258_497_1279 258
65 3300053088 Ga0500644_0000744 Ga0500644_0000744_6016_6798 258
66 3300053088 Ga0500644_0001904 Ga0500644_0001904_3165_3947 258
67 3300053092 Ga0500583_0016014 Ga0500583_0016014_158_940 258
68 3300053103 Ga0500555_000001 Ga0500555_000001_736867_737649 258
69 3300053103 Ga0500555_000002 Ga0500555_000002_506836_507618 258
70 3300053117 Ga0500593_000001 Ga0500593_000001_592007_592792 258
71 3300053118 Ga0500594_0001288 Ga0500594_0001288_2251_3033 258
72 3300053129 Ga0500628_000012 Ga0500628_000012_75576_76358 258
73 3300053131 Ga0500652_000950 Ga0500652_000950_4325_5107 258
74 3300053724 Ga0500570_000005 Ga0500570_000005_39151_39939 258
75 3300005563 Ga0068855_100000003 Ga0068855_100000003102 259
76 3300005614 Ga0068856_100033659 Ga0068856_1000336593 259
77 3300006177 Ga0075362_10024790 Ga0075362_100247902 259
78 3300006844 Ga0075428_100037153 Ga0075428_1000371533 259
79 3300009174 Ga0105241_10000003 Ga0105241_10000003200 259
80 3300013105 Ga0157369_10000945 Ga0157369_1000094526 259
81 3300025911 Ga0207654_10000002 Ga0207654_100000021009 259
82 3300025949 Ga0207667_10000008 Ga0207667_10000008101 259
83 3300031251 Ga0265327_10029695 Ga0265327_100296955 259
84 3300038443 Ga0395901_0012871 Ga0395901_0012871_6327_7151 259
85 3300041486 Ga0451807_0132164 Ga0451807_0132164_1176_2024 259
86 3300047320 Ga0495672_0000129 Ga0495672_0000129_7429_8340 259
87 3300048928 Ga0496125_0132689 Ga0496125_0132689_632_1447 259
88 3300050489 nmdc:mga03683_544_c1 nmdc:mga03683_544_c1_1297_2085 259
89 3300050509 nmdc:mga0qj67_16558_c1 nmdc:mga0qj67_16558_c1_4104_4892 259
90 3300001915 JGI24741J21665_1002050 JGI24741J21665_10020502 260
91 3300001979 JGI24740J21852_10032587 JGI24740J21852_100325872 260
92 3300003322 rootL2_10042870 rootL2_100428704 260
93 3300003322 rootL2_10141818 rootL2_101418181 260
94 3300003323 rootH1_10089243 rootH1_100892432 260
95 3300003323 rootH1_10313042 rootH1_103130421 260
96 3300005289 Ga0065704_10204474 Ga0065704_102044741 260
97 3300005329 Ga0070683_100000138 Ga0070683_10000013829 260
98 3300005329 Ga0070683_100000261 Ga0070683_10000026119 260
99 3300005331 Ga0070670_100165314 Ga0070670_1001653142 260
100 3300005335 Ga0070666_10007793 Ga0070666_100077933 260
101 3300005335 Ga0070666_10070962 Ga0070666_100709622 260
102 3300005338 Ga0068868_100455481 Ga0068868_1004554811 260
103 3300005347 Ga0070668_100296285 Ga0070668_1002962852 260
104 3300005355 Ga0070671_100000001 Ga0070671_100000001504 260
105 3300005367 Ga0070667_100000001 Ga0070667_100000001767 260
106 3300005530 Ga0070679_100026609 Ga0070679_1000266093 260
107 3300005535 Ga0070684_100000229 Ga0070684_10000022934 260
108 3300005535 Ga0070684_100006296 Ga0070684_1000062965 260
109 3300005563 Ga0068855_100019950 Ga0068855_1000199503 260
110 3300005614 Ga0068856_100004358 Ga0068856_1000043584 260
111 3300005616 Ga0068852_100232967 Ga0068852_1002329672 260
112 3300005719 Ga0068861_100365400 Ga0068861_1003654002 260
113 3300005843 Ga0068860_100103081 Ga0068860_1001030813 260
114 3300006178 Ga0075367_10000088 Ga0075367_1000008816 260
115 3300006186 Ga0075369_10000108 Ga0075369_1000010816 260
116 3300006195 Ga0075366_10000001 Ga0075366_10000001414 260
117 3300006195 Ga0075366_10000171 Ga0075366_1000017118 260
118 3300006195 Ga0075366_10000294 Ga0075366_100002943 260
119 3300006195 Ga0075366_10000501 Ga0075366_100005018 260
120 3300009093 Ga0105240_10036177 Ga0105240_100361773 260
121 3300009174 Ga0105241_10014027 Ga0105241_100140273 260
122 3300009986 Ga0105033_100134 Ga0105033_1001343 260
123 3300013100 Ga0157373_10000042 Ga0157373_1000004253 260
124 3300013104 Ga0157370_10092682 Ga0157370_100926822 260
125 3300013296 Ga0157374_10000945 Ga0157374_100009456 260
126 3300014745 Ga0157377_10004608 Ga0157377_100046088 260
127 3300025911 Ga0207654_10024769 Ga0207654_100247693 260
128 3300025921 Ga0207652_10001646 Ga0207652_1000164613 260
129 3300025921 Ga0207652_10023052 Ga0207652_100230523 260
130 3300025925 Ga0207650_10180484 Ga0207650_101804842 260
131 3300025931 Ga0207644_10000001 Ga0207644_10000001932 260
132 3300025944 Ga0207661_10000021 Ga0207661_10000021115 260
133 3300025944 Ga0207661_10001940 Ga0207661_100019402 260
134 3300025949 Ga0207667_10061073 Ga0207667_100610732 260
135 3300026041 Ga0207639_10052778 Ga0207639_100527782 260
136 3300026078 Ga0207702_10006432 Ga0207702_100064323 260
137 3300027717 Ga0209998_10003391 Ga0209998_100033912 260
138 3300027866 Ga0209813_10021842 Ga0209813_100218422 260
139 3300028381 Ga0268264_10185867 Ga0268264_101858672 260
140 3300037466 Ga0395898_0124309 Ga0395898_0124309_304_1101 260
141 3300037471 Ga0395905_0003963 Ga0395905_0003963_5598_6422 260
142 3300038443 Ga0395901_0098545 Ga0395901_0098545_837_1634 260
143 3300046459 Ga0495629_0030468 Ga0495629_0030468_2523_3317 260
144 3300046557 Ga0495622_0000082 Ga0495622_0000082_2248_3042 260
145 3300046674 Ga0495588_0000116 Ga0495588_0000116_66747_67538 260
146 3300046683 Ga0495658_0009320 Ga0495658_0009320_3858_4652 260
147 3300046694 Ga0495649_0000073 Ga0495649_0000073_70815_71606 260
148 3300047673 Ga0495593_0236972 Ga0495593_0236972_110_904 260
149 3300048929 Ga0496126_0200540 Ga0496126_0200540_596_1384 260
150 3300049569 Ga0501032_0002152 Ga0501032_0002152_6206_7042 260
151 3300049571 Ga0501034_0002756 Ga0501034_0002756_13302_14138 260
152 3300049572 Ga0501036_0008729 Ga0501036_0008729_4682_5518 260
153 3300049573 Ga0501037_0000133 Ga0501037_0000133_1959_2795 260
154 3300049573 Ga0501037_0083649 Ga0501037_0083649_1354_2169 260
155 3300049574 Ga0501038_0002588 Ga0501038_0002588_13866_14702 260
156 3300049578 Ga0501042_0188066 Ga0501042_0188066_486_1322 260
157 3300049579 Ga0501043_0000404 Ga0501043_0000404_1128_1964 260
158 3300049579 Ga0501043_0301049 Ga0501043_0301049_281_1096 260
159 3300049580 Ga0501046_0000038 Ga0501046_0000038_147394_148230 260
160 3300049581 Ga0501047_0000229 Ga0501047_0000229_34403_35218 260
161 3300049581 Ga0501047_0007808 Ga0501047_0007808_1110_1946 260
162 3300049582 Ga0501048_0000033 Ga0501048_0000033_16333_17169 260
163 3300049582 Ga0501048_0040637 Ga0501048_0040637_1320_2135 260
164 3300049589 Ga0501073_0027556 Ga0501073_0027556_739_1575 260
165 3300049742 Ga0501080_0259962 Ga0501080_0259962_202_1038 260
166 3300049822 Ga0501035_0000033 Ga0501035_0000033_132447_133262 260
167 3300049822 Ga0501035_0000562 Ga0501035_0000562_5058_5894 260
168 3300049823 Ga0501044_0041370 Ga0501044_0041370_2415_3251 260
169 3300050492 nmdc:mga0yw44_11098_c1 nmdc:mga0yw44_11098_c1_2303_3187 260
170 3300050492 nmdc:mga0yw44_31615_c2 nmdc:mga0yw44_31615_c2_962_1750 260
171 3300050493 nmdc:mga0k408_13082_c1 nmdc:mga0k408_13082_c1_3441_4229 260
172 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_61997_62788 260
173 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_702439_703230 260
174 3300050493 nmdc:mga0k408_2058_c1 nmdc:mga0k408_2058_c1_6881_7675 260
175 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_7291_8082 260
176 3300050494 nmdc:mga06z11_44_c1 nmdc:mga06z11_44_c1_6206_7000 260
177 3300050495 nmdc:mga04h51_5859_c1 nmdc:mga04h51_5859_c1_758_1552 260
178 3300050516 nmdc:mga0sz30_8_c2 nmdc:mga0sz30_8_c2_38473_39264 260
179 3300053087 Ga0500643_000038 Ga0500643_000038_96685_97632 260
180 3300053092 Ga0500583_0014700 Ga0500583_0014700_1415_2362 260
181 3300053094 Ga0500566_0000001 Ga0500566_0000001_643423_644217 260
182 3300053108 Ga0500562_000002 Ga0500562_000002_888663_889451 260
183 3300053123 Ga0500614_000001 Ga0500614_000001_266374_267165 260
184 3300053123 Ga0500614_004635 Ga0500614_004635_790_1584 260
185 3300053136 Ga0500559_0011088 Ga0500559_0011088_1014_1808 260
186 3300053150 Ga0500603_019647 Ga0500603_019647_162_950 260
187 3300053722 Ga0500649_000013 Ga0500649_000013_13357_14148 260
188 3300060353 Ga0501082_0009636 Ga0501082_0009636_5686_6522 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

58

152

0.97

PF13649

Methyltransf_25

Methyltransferase domain

57

148

0.93

PF08242

Methyltransf_12

Methyltransferase domain

58

150

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

35

169

0.86

PF13489

Methyltransf_23

Methyltransferase domain

30

212

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vlm-assembly2.cif.gz_B crystal structure of sam-dependent methyltransferase, possible histamine n-methyltransferase (tm1293) from thermotoga maritima at 2.20 a resolution 0.8131 27 260
3ofj-assembly1.cif.gz_A crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 0.8045 33 259
3ofk-assembly2.cif.gz_B crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 in complex with s-adenosyl-l-homocysteine (sah) 0.8039 30 259
3ofj-assembly1.cif.gz_A crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 0.7841 33 259
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.7822 42 259
ID Description Score Start End Superfamily
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.847 53 152 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8457 52 160 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8299 42 150 3.40.50.150
af_A0A1D6I0D9_80_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8224 41 152 3.40.50.150
af_A0A2R8Q1A0_7_169_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8177 27 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F4ZUD1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9689 16 259 GO:0008757
GO:0032259
AF-A0A2Z4V5C0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.96 16 260 GO:0008757
AF-A0A1F4ZUD1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9424 16 259 GO:0008757
GO:0032259
AF-A0A2H0WMA8-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9373 19 259 GO:0008757
GO:0032259
AF-A0A847AH86-F1-model_v4 deleted 0.9351 20 260

Feature Viewer

pLDDT pTM Quality
89.93 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map