F288489

General Info

Members Datasets Scaffolds Average Seq Length
187 140 374 219

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0547336|Ga0501082_0547336_120_869
Length 249
Sequence MLGIKSALPVLRMGQPRQDVLVMWPQHKEWKSMSKQFAVIGMGRFGSSVARTLYEMDYEVMGIDENEERINENIQYVTHAVAADSTDERALKEIGIRNFDVVVVAIGADIQASILTVLILKELGVKKIVAKAQNERHGQVLYKVGADRVVFPERDMGVRVAHNLISANVLDFIELAEDYSVAEVVVSSGMVGKTLRQLDIRARYGVNVIAIKSGEKFNIAPSPDEVIQYGDVLVVIGNNKHLNAFEEQA

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
14 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
18 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
23 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
24 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
25 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
26 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
29 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
32 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
33 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
34 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
35 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
39 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
40 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
41 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
42 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
43 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
44 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
45 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
46 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
47 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
48 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
49 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
50 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
51 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
54 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
55 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
56 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
59 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
60 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
61 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
62 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
63 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
64 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
65 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
66 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
67 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
68 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
69 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
70 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
71 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
72 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
73 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
74 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
75 2671180694 Paenibacillus sp. A3 Isolate Unclassified
76 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
77 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
78 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
79 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
80 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
81 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
82 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
83 2818991459 Paenibacillus sp. 597 Isolate Unclassified
84 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
85 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
86 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
87 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
88 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
89 2857472729 Cohnella sp. R-74144 Isolate Unclassified
90 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
91 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
92 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
93 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
94 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
95 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
96 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
97 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
98 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
99 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
100 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
101 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
102 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
103 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
104 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
105 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
106 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
107 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
108 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
109 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
110 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
111 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
112 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
113 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
114 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
115 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
116 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
117 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
118 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
119 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
120 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
121 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
122 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
123 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
124 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
125 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
126 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
127 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
128 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
129 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
130 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
131 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
132 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
133 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
134 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
135 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
136 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
137 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
138 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
139 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
140 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 51.87
Metatranscriptomes 1.07
Isolates 47.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 1.07
Rhizoplane 0.53
Rhizosphere 48.66
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0547336 3300060353 Bacteria 1012
2 JGI25162J39368_1010222 3300002737 Bacteria 1201
3 JGI25406J46586_10044524 3300003203 Bacteria 1536
4 Ga0006562J51391_1043808 3300003578 Bacteria 1038
5 Ga0055532_1001436 3300003758 Bacteria 6637
6 Ga0055535_1001524 3300003761 Bacteria 11415
7 Ga0055541_1000493 3300003841 Bacteria 11107
8 Ga0055541_1001831 3300003841 Bacteria 4436
9 Ga0065704_10236953 3300005289 Unclassified 1026
10 Ga0081539_10001339 3300005985 Bacteria 42916
11 Ga0081539_10021326 3300005985 Bacteria 4335
12 Ga0105244_10010102 3300009036 Bacteria 5747
13 Ga0105244_10141996 3300009036 Bacteria 1154
14 Ga0105244_10205228 3300009036 Bacteria 928
15 Ga0111539_11342615 3300009094 Bacteria 830
16 Ga0105246_10032160 3300011119 Bacteria 3477
17 Ga0157371_10321238 3300013102 Bacteria 1123
18 Ga0209784_100092 3300025224 Bacteria 116472
19 Ga0209566_100130 3300025225 Bacteria 91966
20 Ga0209566_100363 3300025225 Bacteria 38102
21 Ga0209566_100585 3300025225 Bacteria 23257
22 Ga0209566_100589 3300025225 Bacteria 23056
23 Ga0209566_103653 3300025225 Bacteria 2288
24 Ga0209147_100050 3300025229 Bacteria 274639
25 Ga0209437_100695 3300025233 Bacteria 17636
26 Ga0209437_100770 3300025233 Bacteria 15235
27 Ga0209258_103242 3300025242 Bacteria 3620
28 Ga0209675_1003469 3300025291 Bacteria 7474
29 Ga0209025_1010327 3300025294 Bacteria 6339
30 Ga0207655_1012230 3300025728 Bacteria 5034
31 Ga0207655_1056664 3300025728 Bacteria 1544
32 Ga0209281_1000051 3300027111 Bacteria 319152
33 Ga0307408_100030210 3300031548 Bacteria 3762
34 Ga0316580_10108626 3300032139 Bacteria 849
35 Ga0316574_0008945 3300035398 Bacteria 5592
36 Ga0400483_187608 3300039062 Bacteria 1274
37 Ga0439436_0012960 3300041404 Bacteria 2527
38 Ga0439439_0001946 3300041406 Bacteria 4277
39 Ga0439433_0002987 3300041999 Bacteria 3625
40 Ga0439449_0000333 3300042007 Bacteria 17098
41 Ga0439449_0006022 3300042007 Bacteria 4632
42 Ga0439462_0001079 3300042015 Bacteria 5885
43 Ga0439462_0017516 3300042015 Bacteria 1855
44 Ga0466965_0292477 3300044683 Bacteria 882
45 Ga0466966_0052371 3300044684 Bacteria 2593
46 Ga0466961_0053514 3300044693 Bacteria 2576
47 Ga0466963_0349090 3300044694 Bacteria 1042
48 Ga0466968_0012585 3300044735 Bacteria 3315
49 Ga0466970_0225998 3300044765 Bacteria 1045
50 Ga0466959_0008409 3300045049 Bacteria 7295
51 Ga0495590_0037090 3300046457 Bacteria 1700
52 Ga0495620_0098226 3300046515 Bacteria 1169
53 Ga0495654_0104432 3300046530 Bacteria 1300
54 Ga0495661_0254101 3300046665 Bacteria 896
55 Ga0495660_0036509 3300046810 Bacteria 2741
56 Ga0495672_0020332 3300047320 Bacteria 4355
57 Ga0495626_0101619 3300048091 Bacteria 1253
58 Ga0496116_0021055 3300048919 Bacteria 4929
59 Ga0496116_0051868 3300048919 Bacteria 2721
60 Ga0496116_0063430 3300048919 Bacteria 2381
61 Ga0496116_0082085 3300048919 Bacteria 1995
62 Ga0496116_0130964 3300048919 Unclassified 1430
63 Ga0496116_0141760 3300048919 Bacteria 1351
64 Ga0496116_0187915 3300048919 Bacteria 1097
65 Ga0496116_0382224 3300048919 Bacteria 631
66 Ga0496118_0076508 3300048921 Bacteria 2379
67 Ga0496119_0002406 3300048922 Bacteria 20551
68 Ga0496119_0004663 3300048922 Bacteria 13513
69 Ga0496119_0352292 3300048922 Unclassified 713
70 Ga0496120_0000212 3300048923 Bacteria 99961
71 Ga0496121_0028878 3300048924 Bacteria 5150
72 Ga0496121_0062439 3300048924 Bacteria 3051
73 Ga0496121_0069753 3300048924 Bacteria 2835
74 Ga0496121_0124060 3300048924 Bacteria 1945
75 Ga0496121_0249128 3300048924 Bacteria 1233
76 Ga0496121_0417063 3300048924 Bacteria 875
77 Ga0496122_0007178 3300048925 Bacteria 12477
78 Ga0496122_0014314 3300048925 Bacteria 7680
79 Ga0496122_0022554 3300048925 Bacteria 5590
80 Ga0496122_0025312 3300048925 Bacteria 5157
81 Ga0496122_0045262 3300048925 Bacteria 3422
82 Ga0496122_0109976 3300048925 Bacteria 1812
83 Ga0496122_0141362 3300048925 Bacteria 1505
84 Ga0496122_0190286 3300048925 Bacteria 1212
85 Ga0496123_0024294 3300048926 Bacteria 4610
86 Ga0496124_0000170 3300048927 Bacteria 131603
87 Ga0496124_0132252 3300048927 Bacteria 1981
88 Ga0496124_0153281 3300048927 Bacteria 1805
89 Ga0496124_0812167 3300048927 Bacteria 578
90 Ga0496125_0001530 3300048928 Bacteria 33186
91 Ga0496125_0084393 3300048928 Bacteria 2412
92 Ga0496125_0257895 3300048928 Bacteria 1095
93 Ga0496126_0001067 3300048929 Bacteria 46207
94 Ga0496126_0002583 3300048929 Bacteria 24153
95 Ga0496126_0137037 3300048929 Bacteria 2110
96 Ga0501306_003101 3300049127 Bacteria 1764
97 Ga0501048_0424425 3300049582 Bacteria 951
98 Ga0501217_024745 3300049661 Bacteria 1439
99 Ga0501081_0500003 3300049743 Unclassified 906
100 2511176144 2510917027 Bacteria 5287437
101 2512640913 2512564013 Bacteria 6286191
102 2512730649 2512564039 Bacteria 8739048
103 2512733404 2512564039 Bacteria 8739048
104 2524187051 2524023129 Bacteria 6762600
105 2550903774 2548877040 Bacteria 7507281
106 2571529829 2571042143 Bacteria 6986194
107 2573040497 2571042588 Bacteria 5045676
108 2578338388 2576861424 Bacteria 5270569
109 2580930636 2579778775 Bacteria 5360914
110 2587742868 2585428059 Bacteria 8696589
111 2595319591 2593339198 Bacteria 7267884
112 2601640717 2600255286 Bacteria 5390125
113 2621276835 2619619294 Bacteria 5575484
114 2643739062 2643221543 Bacteria 6628015
115 2643740939 2643221543 Bacteria 6628015
116 2644428113 2643221676 Bacteria 8119172
117 2673818122 2671180694 Bacteria 7506943
118 2723605739 2721755693 Bacteria 6126117
119 2728532160 2728368933 Bacteria 7044283
120 2730136414 2728369359 Bacteria 5621728
121 2745165703 2744054657 Bacteria 5016802
122 2753810368 2751185905 Bacteria 6142767
123 2802438664 2802428803 Bacteria 5806948
124 2817617370 2816332336 Bacteria 5207640
125 2819674872 2818991459 Bacteria 8736032
126 2821117332 2821111986 Bacteria 6894338
127 2831906558 2831905167 Bacteria 3319172
128 2857458000 2857453340 Bacteria 8090534
129 2857462760 2857460504 Bacteria 5194327
130 2857466315 2857465823 Bacteria 6772595
131 2857475994 2857472729 Bacteria 6568124
132 2857593608 2857591370 Bacteria 6569758
133 2864735589 2864733723 Bacteria 6770668
134 2865001280 2864997549 Bacteria 5139696
135 2865005674 2865002811 Bacteria 6333767
136 2881640172 2881636855 Bacteria 5205297
137 2885533056 2885526491 Bacteria 7164189
138 2889047600 2889042446 Bacteria 7618936
139 2889276251 2889276214 Bacteria 5979355
140 2889300175 2889295896 Bacteria 4704906
141 2889300511 2889295896 Bacteria 4704906
142 2898909368 2898907183 Bacteria 4067722
143 2904162449 2904162308 Bacteria 7086713
144 2904495608 2904490793 Bacteria 7046938
145 2904598961 2904595352 Bacteria 6124848
146 2904759365 2904755435 Bacteria 7986759
147 2907207573 2907202186 Bacteria 6632024
148 2915600203 2915597211 Bacteria 6475886
149 2915609795 2915606848 Bacteria 6032732
150 2919164504 2919160200 Bacteria 6929020
151 2919414995 2919414237 Bacteria 5429133
152 2919428585 2919425241 Bacteria 8055701
153 2925328827 2925326138 Bacteria 9652120
154 2929185389 2929183550 Bacteria 6377511
155 2931384650 2931384279 Bacteria 7299545
156 2938652885 2938649242 Bacteria 7118381
157 2939683934 2939679117 Bacteria 6921672
158 2939704260 2939702853 Bacteria 5139229
159 2945996693 2945991243 Bacteria 7008369
160 2946059383 2946053406 Bacteria 6978655
161 2968563645 2968558590 Bacteria 6956864
162 2971408806 2971403814 Bacteria 7370929
163 2971413500 2971410472 Bacteria 8311090
164 2971516022 2971511577 Bacteria 5404012
165 2980126830 2980125574 Bacteria 5567337
166 2980177766 2980176882 Bacteria 5397533
167 2980185927 2980182181 Bacteria 9454109
168 2981287574 2981284811 Bacteria 4641497
169 2981289411 2981284811 Bacteria 4641497
170 2981292769 2981289755 Bacteria 4641509
171 2981294356 2981289755 Bacteria 4641509
172 2981983017 2981980479 Bacteria 4641628
173 2981985024 2981980479 Bacteria 4641628
174 2981987927 2981985349 Bacteria 4641497
175 2981989954 2981985349 Bacteria 4641497
176 2988225987 2988225383 Bacteria 7221625
177 2996637635 2996632988 Bacteria 6921523
178 3001898228 3001892409 Bacteria 6328293
179 648171783 648028048 Bacteria 5394884
180 8002321396 8002317523 Bacteria 8051857
181 8007376642 8007375930 Bacteria 4080554
182 8046995630 8046991243 Bacteria 8497463
183 8054470705 8054465665 Bacteria 7323556
184 8055633432 8055632911 Bacteria 5283357
185 8056535752 8056533031 Bacteria 8964429
186 8057737134 8057733483 Bacteria 6578323
187 8057980958 8057977335 Bacteria 5694872
188 Ga0501082_0547336
189 JGI25162J39368_1010222
190 JGI25406J46586_10044524
191 Ga0006562J51391_1043808
192 Ga0055532_1001436
193 Ga0055535_1001524
194 Ga0055541_1000493
195 Ga0055541_1001831
196 Ga0065704_10236953
197 Ga0081539_10001339
198 Ga0081539_10021326
199 Ga0105244_10010102
200 Ga0105244_10141996
201 Ga0105244_10205228
202 Ga0111539_11342615
203 Ga0105246_10032160
204 Ga0157371_10321238
205 Ga0209784_100092
206 Ga0209566_100130
207 Ga0209566_100363
208 Ga0209566_100585
209 Ga0209566_100589
210 Ga0209566_103653
211 Ga0209147_100050
212 Ga0209437_100695
213 Ga0209437_100770
214 Ga0209258_103242
215 Ga0209675_1003469
216 Ga0209025_1010327
217 Ga0207655_1012230
218 Ga0207655_1056664
219 Ga0209281_1000051
220 Ga0307408_100030210
221 Ga0316580_10108626
222 Ga0316574_0008945
223 Ga0400483_187608
224 Ga0439436_0012960
225 Ga0439439_0001946
226 Ga0439433_0002987
227 Ga0439449_0000333
228 Ga0439449_0006022
229 Ga0439462_0001079
230 Ga0439462_0017516
231 Ga0466965_0292477
232 Ga0466966_0052371
233 Ga0466961_0053514
234 Ga0466963_0349090
235 Ga0466968_0012585
236 Ga0466970_0225998
237 Ga0466959_0008409
238 Ga0495590_0037090
239 Ga0495620_0098226
240 Ga0495654_0104432
241 Ga0495661_0254101
242 Ga0495660_0036509
243 Ga0495672_0020332
244 Ga0495626_0101619
245 Ga0496116_0021055
246 Ga0496116_0051868
247 Ga0496116_0063430
248 Ga0496116_0082085
249 Ga0496116_0130964
250 Ga0496116_0141760
251 Ga0496116_0187915
252 Ga0496116_0382224
253 Ga0496118_0076508
254 Ga0496119_0002406
255 Ga0496119_0004663
256 Ga0496119_0352292
257 Ga0496120_0000212
258 Ga0496121_0028878
259 Ga0496121_0062439
260 Ga0496121_0069753
261 Ga0496121_0124060
262 Ga0496121_0249128
263 Ga0496121_0417063
264 Ga0496122_0007178
265 Ga0496122_0014314
266 Ga0496122_0022554
267 Ga0496122_0025312
268 Ga0496122_0045262
269 Ga0496122_0109976
270 Ga0496122_0141362
271 Ga0496122_0190286
272 Ga0496123_0024294
273 Ga0496124_0000170
274 Ga0496124_0132252
275 Ga0496124_0153281
276 Ga0496124_0812167
277 Ga0496125_0001530
278 Ga0496125_0084393
279 Ga0496125_0257895
280 Ga0496126_0001067
281 Ga0496126_0002583
282 Ga0496126_0137037
283 Ga0501306_003101
284 Ga0501048_0424425
285 Ga0501217_024745
286 Ga0501081_0500003
287 2511176144
288 2512640913
289 2512730649
290 2512733404
291 2524187051
292 2550903774
293 2571529829
294 2573040497
295 2578338388
296 2580930636
297 2587742868
298 2595319591
299 2601640717
300 2621276835
301 2643739062
302 2643740939
303 2644428113
304 2673818122
305 2723605739
306 2728532160
307 2730136414
308 2745165703
309 2753810368
310 2802438664
311 2817617370
312 2819674872
313 2821117332
314 2831906558
315 2857458000
316 2857462760
317 2857466315
318 2857475994
319 2857593608
320 2864735589
321 2865001280
322 2865005674
323 2881640172
324 2885533056
325 2889047600
326 2889276251
327 2889300175
328 2889300511
329 2898909368
330 2904162449
331 2904495608
332 2904598961
333 2904759365
334 2907207573
335 2915600203
336 2915609795
337 2919164504
338 2919414995
339 2919428585
340 2925328827
341 2929185389
342 2931384650
343 2938652885
344 2939683934
345 2939704260
346 2945996693
347 2946059383
348 2968563645
349 2971408806
350 2971413500
351 2971516022
352 2980126830
353 2980177766
354 2980185927
355 2981287574
356 2981289411
357 2981292769
358 2981294356
359 2981983017
360 2981985024
361 2981987927
362 2981989954
363 2988225987
364 2996637635
365 3001898228
366 648171783
367 8002321396
368 8007376642
369 8046995630
370 8054470705
371 8055633432
372 8056535752
373 8057737134
374 8057980958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

37

152

0.97

PF02080

TrkA_C

TrkA-C domain

181

249

0.93

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

36

139

0.76

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

36

135

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fgp-assembly1.cif.gz_B crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9511 4 36
4xtt-assembly1.cif.gz_B structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp) 0.9358 148 217
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9135 2 36
7ahm-assembly2.cif.gz_C low-resolution structure of the k+/h+ antiporter subunit khtt in complex with c-di-amp 0.9125 147 214
7zp9-assembly1.cif.gz_L ktrab complex - ktra8 ring with a ktrb dimer on each side 0.9115 4 134
ID Description Score Start End Superfamily
4j91B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9841 5 119 3.40.50.720
4j91B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9675 5 119 3.40.50.720
4ntdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.96 4 35 3.50.50.60
af_O13670_11_235_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.944 4 35 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.943 6 36 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A662F4D1-F1-model_v4 deleted 0.9856 2 103
AF-B7AVB4-F1-model_v4 RCK N-terminal domain-containing protein 0.9849 3 95 GO:0006813
AF-A0A7U6QM71-F1-model_v4 RCK N-terminal domain-containing protein 0.9658 4 111 GO:0006813
AF-B7AVB4-F1-model_v4 RCK N-terminal domain-containing protein 0.9644 3 95 GO:0006813
AF-A0A257LU40-F1-model_v4 Potassium uptake system protein 0.9637 3 127 GO:0006813

Map