F288419

General Info

Members Datasets Scaffolds Average Seq Length
187 116 187 400

Family's Representative Sequence

Representative Sequence 3300050489|nmdc:mga03683_660_c1|nmdc:mga03683_660_c1_6302_7555
Length 417
Sequence MLGKTTWGCSKAMKILMLGWELPPHNSGGLGVACYQLCRALSTQGADIEFVVPYKADHAISFMKVTPAHPQGVTEVQRAGSAYDSYKYIYKDGTVKSIDIFGQQQLYEEAVNDLVAKTEATYDVIHAHDWLTFRAALRAKQLTNLPLVIHLHSVERDRAGGGFGNPLVREIEATAMQMADRIVAVSQHTKDMIVQDYDIPADKIEVVHNSIDREMFEELDDANAYRYLTALKNQGYRVVVNIGRLTMQKNLPNLLHAAKDVIERVPKTIFLIVGSGEQYFELIQLVANLGISKNIVFTGFQRGKNWRDAYAIGDLFVMPSISEPFGLTALEAIGYGAPVLMSNQSGVAEVIRNSLKVDFWDTREMANKIAAVLQNDSLRDTLHANSLAEYSGLSWQPSAKKLLGIYGQHTSLQGTMS

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
44 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
89 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
96 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
97 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
101 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
102 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
103 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
104 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
105 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
106 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
107 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
108 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
109 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
110 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
111 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
112 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
113 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
114 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
115 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
116 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.83
Nodule 0
Rhizoplane 0.53
Rhizosphere 59.89
Stem 0
Stem Tuber 0
Unclassified 3.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000566 3300001915 Bacteria 11301
2 JGI24741J21665_1001815 3300001915 Bacteria 5849
3 JGI24737J22298_10000185 3300001990 Bacteria 20041
4 JGI24735J21928_10000436 3300002067 Bacteria 14576
5 JGI24742J22300_10000015 3300002244 Bacteria 27133
6 rootH1_10129286 3300003316 Unclassified 2185
7 rootH2_10259699 3300003320 Bacteria 2163
8 rootL2_10088415 3300003322 Bacteria 2199
9 rootL2_10278098 3300003322 Unclassified 2513
10 rootH1_10171055 3300003323 Bacteria 3095
11 rootH1_10318703 3300003323 Bacteria 2083
12 Ga0065704_10102698 3300005289 Bacteria 2196
13 Ga0070658_10000118 3300005327 Bacteria 71171
14 Ga0070658_10006369 3300005327 Bacteria 9564
15 Ga0070658_10016333 3300005327 Bacteria 5941
16 Ga0070676_10000882 3300005328 Bacteria 14791
17 Ga0070683_100000530 3300005329 Bacteria 26876
18 Ga0070683_100001342 3300005329 Bacteria 18774
19 Ga0070677_10029138 3300005333 Bacteria 2091
20 Ga0068869_100057336 3300005334 Bacteria 2843
21 Ga0070680_100098642 3300005336 Bacteria 2423
22 Ga0070674_100001917 3300005356 Bacteria 11325
23 Ga0070667_100011502 3300005367 Bacteria 7319
24 Ga0070685_10000840 3300005466 Bacteria 16747
25 Ga0070679_100032587 3300005530 Bacteria 5155
26 Ga0070679_100117092 3300005530 Bacteria 2649
27 Ga0070679_100175512 3300005530 Bacteria 2115
28 Ga0070684_100007796 3300005535 Bacteria 8351
29 Ga0070684_100016302 3300005535 Bacteria 6071
30 Ga0068853_100001601 3300005539 Bacteria 16493
31 Ga0070665_100017387 3300005548 Bacteria 7217
32 Ga0068855_100000003 3300005563 Bacteria 589862
33 Ga0068855_100210313 3300005563 Bacteria 2186
34 Ga0068857_100238282 3300005577 Bacteria 1665
35 Ga0068856_100000001 3300005614 Bacteria 565602
36 Ga0068856_100001939 3300005614 Bacteria 21582
37 Ga0068856_100071810 3300005614 Bacteria 3427
38 Ga0068859_100375936 3300005617 Bacteria 1516
39 Ga0081455_10000003 3300005937 Bacteria 367763
40 Ga0070717_10233167 3300006028 Unclassified 1621
41 Ga0075365_10000015 3300006038 Bacteria 73530
42 Ga0075365_10029794 3300006038 Bacteria 3491
43 Ga0075368_10000647 3300006042 Bacteria 10601
44 Ga0075363_100000006 3300006048 Bacteria 47292
45 Ga0075364_10000700 3300006051 Bacteria 17542
46 Ga0075364_10005582 3300006051 Bacteria 7332
47 Ga0075364_10055018 3300006051 Bacteria 2603
48 Ga0075362_10000049 3300006177 Bacteria 39227
49 Ga0075362_10001108 3300006177 Bacteria 8359
50 Ga0075369_10000003 3300006186 Bacteria 205269
51 Ga0075369_10000057 3300006186 Bacteria 28832
52 Ga0075366_10000001 3300006195 Bacteria 569172
53 Ga0075366_10000005 3300006195 Bacteria 107438
54 Ga0075366_10000065 3300006195 Bacteria 39633
55 Ga0075366_10000216 3300006195 Bacteria 25389
56 Ga0075366_10000328 3300006195 Bacteria 21743
57 Ga0075366_10028768 3300006195 Bacteria 3263
58 Ga0075366_10030947 3300006195 Bacteria 3148
59 Ga0097621_100001442 3300006237 Bacteria 16323
60 Ga0075370_10001676 3300006353 Bacteria 9810
61 Ga0075370_10003905 3300006353 Bacteria 7152
62 Ga0075370_10028859 3300006353 Bacteria 3087
63 Ga0068871_100000039 3300006358 Bacteria 69204
64 Ga0097620_100375967 3300006931 Bacteria 1516
65 Ga0105245_10000001 3300009098 Bacteria 939270
66 Ga0105245_10000002 3300009098 Bacteria 634374
67 Ga0105245_10116033 3300009098 Bacteria 2496
68 Ga0105243_10003970 3300009148 Bacteria 11796
69 Ga0105241_10000003 3300009174 Bacteria 839043
70 Ga0105241_10000102 3300009174 Bacteria 62230
71 Ga0105241_10077376 3300009174 Bacteria 2597
72 Ga0105032_100250 3300009979 Bacteria 5569
73 Ga0105033_100020 3300009986 Bacteria 14374
74 Ga0105239_10019556 3300010375 Bacteria 7475
75 Ga0157373_10000351 3300013100 Bacteria 37083
76 Ga0157371_10000176 3300013102 Bacteria 93047
77 Ga0157369_10006673 3300013105 Bacteria 13332
78 Ga0157369_10037570 3300013105 Bacteria 5301
79 Ga0157374_10000031 3300013296 Bacteria 204840
80 Ga0157374_10002651 3300013296 Bacteria 15074
81 Ga0157374_10003322 3300013296 Bacteria 13513
82 Ga0157374_10101839 3300013296 Bacteria 2754
83 Ga0163163_10083956 3300014325 Bacteria 3190
84 Ga0207647_10071341 3300025904 Unclassified 2096
85 Ga0207645_10000476 3300025907 Bacteria 33063
86 Ga0207705_10000167 3300025909 Bacteria 71284
87 Ga0207654_10000002 3300025911 Bacteria 1460142
88 Ga0207654_10000463 3300025911 Bacteria 23194
89 Ga0207654_10015737 3300025911 Bacteria 3930
90 Ga0207660_10018218 3300025917 Bacteria 4677
91 Ga0207652_10011483 3300025921 Bacteria 7140
92 Ga0207652_10036785 3300025921 Bacteria 4140
93 Ga0207687_10000001 3300025927 Bacteria 1130810
94 Ga0207687_10000030 3300025927 Bacteria 155548
95 Ga0207669_10002872 3300025937 Bacteria 7389
96 Ga0207661_10000021 3300025944 Bacteria 205381
97 Ga0207667_10000008 3300025949 Bacteria 625138
98 Ga0207667_10014149 3300025949 Bacteria 9107
99 Ga0207658_10004436 3300025986 Bacteria 9760
100 Ga0207639_10030353 3300026041 Bacteria 3964
101 Ga0207702_10000001 3300026078 Bacteria 895738
102 Ga0207702_10001013 3300026078 Bacteria 28866
103 Ga0207702_10137773 3300026078 Unclassified 2204
104 Ga0209813_10000009 3300027866 Bacteria 102315
105 Ga0268266_10001018 3300028379 Bacteria 35297
106 Ga0265334_10000114 3300028573 Bacteria 52821
107 Ga0265334_10002952 3300028573 Bacteria 7793
108 Ga0265322_10008253 3300028654 Bacteria 3035
109 Ga0265338_10000217 3300028800 Bacteria 106453
110 Ga0265338_10000543 3300028800 Bacteria 66162
111 Ga0265338_10000925 3300028800 Bacteria 49504
112 Ga0265324_10000345 3300029957 Bacteria 33698
113 Ga0265340_10000533 3300031247 Bacteria 21017
114 Ga0265327_10000017 3300031251 Bacteria 445264
115 Ga0265327_10001794 3300031251 Bacteria 25181
116 Ga0265327_10004581 3300031251 Bacteria 12169
117 Ga0265316_10001231 3300031344 Bacteria 27541
118 Ga0265342_10102941 3300031712 Bacteria 1624
119 Ga0395899_0008531 3300037312 Bacteria 7893
120 Ga0395899_0062905 3300037312 Archaea 2732
121 Ga0395899_0158105 3300037312 Bacteria 1603
122 Ga0395900_0002167 3300037418 Bacteria 21936
123 Ga0395900_0026294 3300037418 Bacteria 5960
124 Ga0395900_0115395 3300037418 Bacteria 2755
125 Ga0395900_0135606 3300037418 Bacteria 2522
126 Ga0395898_0066300 3300037466 Bacteria 3498
127 Ga0395905_0002458 3300037471 Bacteria 20515
128 Ga0395905_0006749 3300037471 Bacteria 11494
129 Ga0395901_0032784 3300038443 Bacteria 5359
130 Ga0395901_0168420 3300038443 Bacteria 2299
131 Ga0451793_0067620 3300041452 Bacteria 2012
132 Ga0466963_0031709 3300044694 Bacteria 3418
133 Ga0466967_0320011 3300045976 Bacteria 1496
134 Ga0495622_0000035 3300046557 Bacteria 122963
135 Ga0495588_0000235 3300046674 Bacteria 48543
136 Ga0495649_0000182 3300046694 Bacteria 54760
137 Ga0496126_0012819 3300048929 Bacteria 8567
138 Ga0501034_0026304 3300049571 Bacteria 5926
139 Ga0501047_0014762 3300049581 Bacteria 7433
140 Ga0501234_009061 3300049707 Unclassified 1553
141 Ga0501276_000451 3300049773 Unclassified 2512
142 Ga0501035_0001229 3300049822 Bacteria 26660
143 nmdc:mga03683_660_c1 3300050489 Bacteria 9603
144 nmdc:mga03683_66_c2 3300050489 Bacteria 39227
145 nmdc:mga03n38_19_c1 3300050490 Bacteria 41192
146 nmdc:mga00v17_145_c2 3300050491 Bacteria 17914
147 nmdc:mga00v17_26505_c1 3300050491 Bacteria 3379
148 nmdc:mga00v17_46567_c1 3300050491 Bacteria 2624
149 nmdc:mga0yw44_24849_c1 3300050492 Bacteria 3396
150 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
151 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
152 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
153 nmdc:mga0k408_21663_c1 3300050493 Bacteria 3181
154 nmdc:mga0k408_26861_c1 3300050493 Bacteria 3265
155 nmdc:mga0k408_34_c1 3300050493 Bacteria 65613
156 nmdc:mga0k408_3542_c1 3300050493 Bacteria 8250
157 nmdc:mga0k408_555_c1 3300050493 Bacteria 20549
158 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
159 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
160 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
161 nmdc:mga07m45_10695_c1 3300050496 Bacteria 4801
162 nmdc:mga07m45_1278_c5 3300050496 Bacteria 3116
163 nmdc:mga07m45_9524_c1 3300050496 Bacteria 5042
164 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
165 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
166 Ga0500610_0000001 3300053079 Bacteria 185468
167 Ga0500643_000948 3300053087 Bacteria 18151
168 Ga0500644_0000199 3300053088 Bacteria 36622
169 Ga0500644_0000281 3300053088 Bacteria 28221
170 Ga0500644_0002190 3300053088 Bacteria 4938
171 Ga0500583_0000067 3300053092 Bacteria 64775
172 Ga0500566_0000001 3300053094 Bacteria 1101031
173 Ga0500555_000001 3300053103 Bacteria 1353713
174 Ga0500555_000002 3300053103 Bacteria 1314346
175 Ga0500556_0000246 3300053104 Bacteria 43933
176 Ga0500556_0012928 3300053104 Bacteria 2511
177 Ga0500562_000009 3300053108 Bacteria 187538
178 Ga0500614_000001 3300053123 Bacteria 1274484
179 Ga0500614_002529 3300053123 Unclassified 4054
180 Ga0500621_023410 3300053126 Unclassified 2394
181 Ga0500628_000006 3300053129 Bacteria 154858
182 Ga0500642_0004467 3300053130 Bacteria 4382
183 Ga0500652_000054 3300053131 Bacteria 52348
184 Ga0500561_0000001 3300053137 Bacteria 957685
185 Ga0500577_0002085 3300053142 Bacteria 5107
186 Ga0500589_000008 3300053147 Bacteria 137145
187 Ga0500649_000010 3300053722 Bacteria 91784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0320011 Ga0466967_0320011_345_1403 338
2 3300053087 Ga0500643_000948 Ga0500643_000948_9714_10769 351
3 3300053103 Ga0500555_000002 Ga0500555_000002_437538_438593 351
4 3300053131 Ga0500652_000054 Ga0500652_000054_14374_15429 351
5 3300025904 Ga0207647_10071341 Ga0207647_100713412 360
6 3300037312 Ga0395899_0158105 Ga0395899_0158105_204_1331 373
7 3300037418 Ga0395900_0135606 Ga0395900_0135606_1104_2231 373
8 3300038443 Ga0395901_0168420 Ga0395901_0168420_282_1409 373
9 3300053103 Ga0500555_000001 Ga0500555_000001_838655_839788 377
10 3300005336 Ga0070680_100098642 Ga0070680_1000986421 378
11 3300025917 Ga0207660_10018218 Ga0207660_100182182 378
12 3300031712 Ga0265342_10102941 Ga0265342_101029412 381
13 3300050496 nmdc:mga07m45_10695_c1 nmdc:mga07m45_10695_c1_2076_3221 381
14 3300005289 Ga0065704_10102698 Ga0065704_101026982 396
15 3300005530 Ga0070679_100117092 Ga0070679_1001170922 396
16 3300005614 Ga0068856_100071810 Ga0068856_1000718102 396
17 3300006195 Ga0075366_10000065 Ga0075366_100000656 396
18 3300009098 Ga0105245_10000001 Ga0105245_10000001300 396
19 3300014325 Ga0163163_10083956 Ga0163163_100839563 396
20 3300025927 Ga0207687_10000030 Ga0207687_10000030139 396
21 3300026078 Ga0207702_10137773 Ga0207702_101377732 396
22 3300037312 Ga0395899_0062905 Ga0395899_0062905_242_1444 396
23 3300037418 Ga0395900_0002167 Ga0395900_0002167_16963_18165 396
24 3300050493 nmdc:mga0k408_14_c3 nmdc:mga0k408_14_c3_4453_5667 396
25 3300003320 rootH2_10259699 rootH2_102596991 397
26 3300003322 rootL2_10278098 rootL2_102780982 397
27 3300003323 rootH1_10171055 rootH1_101710552 397
28 3300003323 rootH1_10318703 rootH1_103187031 397
29 3300005327 Ga0070658_10000118 Ga0070658_1000011834 397
30 3300005327 Ga0070658_10006369 Ga0070658_100063696 397
31 3300005356 Ga0070674_100001917 Ga0070674_1000019175 397
32 3300005367 Ga0070667_100011502 Ga0070667_1000115027 397
33 3300005466 Ga0070685_10000840 Ga0070685_100008405 397
34 3300005530 Ga0070679_100175512 Ga0070679_1001755121 397
35 3300005539 Ga0068853_100001601 Ga0068853_10000160110 397
36 3300005548 Ga0070665_100017387 Ga0070665_1000173876 397
37 3300005563 Ga0068855_100210313 Ga0068855_1002103132 397
38 3300005577 Ga0068857_100238282 Ga0068857_1002382821 397
39 3300005614 Ga0068856_100000001 Ga0068856_100000001330 397
40 3300005937 Ga0081455_10000003 Ga0081455_10000003254 397
41 3300006038 Ga0075365_10000015 Ga0075365_1000001571 397
42 3300006038 Ga0075365_10029794 Ga0075365_100297943 397
43 3300006042 Ga0075368_10000647 Ga0075368_100006472 397
44 3300006048 Ga0075363_100000006 Ga0075363_10000000661 397
45 3300006051 Ga0075364_10000700 Ga0075364_1000070014 397
46 3300006177 Ga0075362_10000049 Ga0075362_1000004918 397
47 3300006177 Ga0075362_10001108 Ga0075362_100011083 397
48 3300006186 Ga0075369_10000057 Ga0075369_1000005714 397
49 3300006195 Ga0075366_10000001 Ga0075366_10000001340 397
50 3300006195 Ga0075366_10028768 Ga0075366_100287683 397
51 3300006237 Ga0097621_100001442 Ga0097621_1000014422 397
52 3300006353 Ga0075370_10001676 Ga0075370_100016767 397
53 3300006353 Ga0075370_10003905 Ga0075370_100039055 397
54 3300006353 Ga0075370_10028859 Ga0075370_100288592 397
55 3300006358 Ga0068871_100000039 Ga0068871_10000003942 397
56 3300009098 Ga0105245_10000002 Ga0105245_10000002283 397
57 3300009098 Ga0105245_10116033 Ga0105245_101160332 397
58 3300009148 Ga0105243_10003970 Ga0105243_100039709 397
59 3300009174 Ga0105241_10000102 Ga0105241_1000010258 397
60 3300010375 Ga0105239_10019556 Ga0105239_100195562 397
61 3300013102 Ga0157371_10000176 Ga0157371_1000017656 397
62 3300013105 Ga0157369_10037570 Ga0157369_100375703 397
63 3300013296 Ga0157374_10000031 Ga0157374_1000003188 397
64 3300013296 Ga0157374_10101839 Ga0157374_101018392 397
65 3300025909 Ga0207705_10000167 Ga0207705_1000016754 397
66 3300025911 Ga0207654_10000463 Ga0207654_1000046310 397
67 3300025921 Ga0207652_10036785 Ga0207652_100367852 397
68 3300025927 Ga0207687_10000001 Ga0207687_10000001928 397
69 3300025937 Ga0207669_10002872 Ga0207669_100028722 397
70 3300025949 Ga0207667_10014149 Ga0207667_1001414910 397
71 3300025986 Ga0207658_10004436 Ga0207658_100044365 397
72 3300026041 Ga0207639_10030353 Ga0207639_100303533 397
73 3300026078 Ga0207702_10000001 Ga0207702_10000001879 397
74 3300027866 Ga0209813_10000009 Ga0209813_1000000976 397
75 3300028379 Ga0268266_10001018 Ga0268266_1000101813 397
76 3300028573 Ga0265334_10002952 Ga0265334_100029523 397
77 3300028654 Ga0265322_10008253 Ga0265322_100082533 397
78 3300028800 Ga0265338_10000543 Ga0265338_1000054310 397
79 3300028800 Ga0265338_10000925 Ga0265338_1000092533 397
80 3300029957 Ga0265324_10000345 Ga0265324_1000034515 397
81 3300031251 Ga0265327_10000017 Ga0265327_10000017205 397
82 3300031251 Ga0265327_10001794 Ga0265327_100017949 397
83 3300031251 Ga0265327_10004581 Ga0265327_100045818 397
84 3300031344 Ga0265316_10001231 Ga0265316_1000123113 397
85 3300037312 Ga0395899_0008531 Ga0395899_0008531_1588_2826 397
86 3300037418 Ga0395900_0115395 Ga0395900_0115395_1202_2440 397
87 3300037466 Ga0395898_0066300 Ga0395898_0066300_583_1821 397
88 3300037471 Ga0395905_0002458 Ga0395905_0002458_10260_11468 397
89 3300037471 Ga0395905_0006749 Ga0395905_0006749_5528_6766 397
90 3300038443 Ga0395901_0032784 Ga0395901_0032784_2191_3429 397
91 3300041452 Ga0451793_0067620 Ga0451793_0067620_216_1424 397
92 3300046557 Ga0495622_0000035 Ga0495622_0000035_51843_53066 397
93 3300046674 Ga0495588_0000235 Ga0495588_0000235_40447_41661 397
94 3300049571 Ga0501034_0026304 Ga0501034_0026304_2042_3256 397
95 3300049581 Ga0501047_0014762 Ga0501047_0014762_3782_4996 397
96 3300049707 Ga0501234_009061 Ga0501234_009061_23_1231 397
97 3300049822 Ga0501035_0001229 Ga0501035_0001229_12864_14078 397
98 3300050489 nmdc:mga03683_660_c1 nmdc:mga03683_660_c1_6302_7555 397
99 3300050489 nmdc:mga03683_66_c2 nmdc:mga03683_66_c2_20250_21464 397
100 3300050490 nmdc:mga03n38_19_c1 nmdc:mga03n38_19_c1_37119_38327 397
101 3300050491 nmdc:mga00v17_145_c2 nmdc:mga00v17_145_c2_6599_7852 397
102 3300050492 nmdc:mga0yw44_24849_c1 nmdc:mga0yw44_24849_c1_584_1837 397
103 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_325344_326561 397
104 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_759526_760737 397
105 3300050493 nmdc:mga0k408_26861_c1 nmdc:mga0k408_26861_c1_1288_2493 397
106 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_2956_4164 397
107 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_63134_64342 397
108 3300050496 nmdc:mga07m45_1278_c5 nmdc:mga07m45_1278_c5_1246_2460 397
109 3300050496 nmdc:mga07m45_9524_c1 nmdc:mga07m45_9524_c1_2778_3986 397
110 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_88871_90082 397
111 3300053079 Ga0500610_0000001 Ga0500610_0000001_19286_20491 397
112 3300053088 Ga0500644_0000199 Ga0500644_0000199_21028_22233 397
113 3300053088 Ga0500644_0002190 Ga0500644_0002190_3699_4913 397
114 3300053094 Ga0500566_0000001 Ga0500566_0000001_698163_699374 397
115 3300053104 Ga0500556_0000246 Ga0500556_0000246_17918_19162 397
116 3300053104 Ga0500556_0012928 Ga0500556_0012928_324_1517 397
117 3300053123 Ga0500614_000001 Ga0500614_000001_197455_198669 397
118 3300053123 Ga0500614_002529 Ga0500614_002529_1126_2349 397
119 3300053129 Ga0500628_000006 Ga0500628_000006_114573_115787 397
120 3300053722 Ga0500649_000010 Ga0500649_000010_49359_50573 397
121 3300002244 JGI24742J22300_10000015 JGI24742J22300_1000001545 398
122 3300005327 Ga0070658_10016333 Ga0070658_100163333 398
123 3300005328 Ga0070676_10000882 Ga0070676_100008823 398
124 3300005333 Ga0070677_10029138 Ga0070677_100291382 398
125 3300005530 Ga0070679_100032587 Ga0070679_1000325872 398
126 3300005617 Ga0068859_100375936 Ga0068859_1003759361 398
127 3300006028 Ga0070717_10233167 Ga0070717_102331671 398
128 3300006195 Ga0075366_10000005 Ga0075366_10000005105 398
129 3300006931 Ga0097620_100375967 Ga0097620_1003759671 398
130 3300009979 Ga0105032_100250 Ga0105032_1002503 398
131 3300013296 Ga0157374_10002651 Ga0157374_1000265112 398
132 3300013296 Ga0157374_10003322 Ga0157374_100033222 398
133 3300025907 Ga0207645_10000476 Ga0207645_1000047625 398
134 3300025921 Ga0207652_10011483 Ga0207652_100114835 398
135 3300028573 Ga0265334_10000114 Ga0265334_1000011464 398
136 3300028800 Ga0265338_10000217 Ga0265338_1000021774 398
137 3300031247 Ga0265340_10000533 Ga0265340_100005334 398
138 3300050493 nmdc:mga0k408_555_c1 nmdc:mga0k408_555_c1_318_1526 398
139 3300001915 JGI24741J21665_1001815 JGI24741J21665_10018151 399
140 3300003316 rootH1_10129286 rootH1_101292861 399
141 3300003322 rootL2_10088415 rootL2_100884152 399
142 3300005329 Ga0070683_100000530 Ga0070683_10000053024 399
143 3300005329 Ga0070683_100001342 Ga0070683_10000134220 399
144 3300005334 Ga0068869_100057336 Ga0068869_1000573362 399
145 3300005535 Ga0070684_100007796 Ga0070684_1000077966 399
146 3300005535 Ga0070684_100016302 Ga0070684_1000163022 399
147 3300005614 Ga0068856_100001939 Ga0068856_1000019399 399
148 3300006051 Ga0075364_10005582 Ga0075364_100055826 399
149 3300006051 Ga0075364_10055018 Ga0075364_100550182 399
150 3300006186 Ga0075369_10000003 Ga0075369_10000003170 399
151 3300006195 Ga0075366_10000216 Ga0075366_1000021628 399
152 3300006195 Ga0075366_10000328 Ga0075366_100003284 399
153 3300009174 Ga0105241_10077376 Ga0105241_100773762 399
154 3300009986 Ga0105033_100020 Ga0105033_10002012 399
155 3300013100 Ga0157373_10000351 Ga0157373_1000035120 399
156 3300025911 Ga0207654_10015737 Ga0207654_100157372 399
157 3300025944 Ga0207661_10000021 Ga0207661_10000021217 399
158 3300026078 Ga0207702_10001013 Ga0207702_1000101319 399
159 3300037418 Ga0395900_0026294 Ga0395900_0026294_3672_4886 399
160 3300044694 Ga0466963_0031709 Ga0466963_0031709_2097_3314 399
161 3300046694 Ga0495649_0000182 Ga0495649_0000182_35183_36394 399
162 3300048929 Ga0496126_0012819 Ga0496126_0012819_942_2159 399
163 3300049773 Ga0501276_000451 Ga0501276_000451_698_1909 399
164 3300050491 nmdc:mga00v17_26505_c1 nmdc:mga00v17_26505_c1_115_1326 399
165 3300050491 nmdc:mga00v17_46567_c1 nmdc:mga00v17_46567_c1_1109_2323 399
166 3300050493 nmdc:mga0k408_34_c1 nmdc:mga0k408_34_c1_10145_11359 399
167 3300050493 nmdc:mga0k408_3542_c1 nmdc:mga0k408_3542_c1_1762_2988 399
168 3300050494 nmdc:mga06z11_53_c2 nmdc:mga06z11_53_c2_26717_27943 399
169 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_362270_363469 399
170 3300053088 Ga0500644_0000281 Ga0500644_0000281_9524_10744 399
171 3300053092 Ga0500583_0000067 Ga0500583_0000067_34354_35565 399
172 3300053108 Ga0500562_000009 Ga0500562_000009_3561_4763 399
173 3300053126 Ga0500621_023410 Ga0500621_023410_838_2049 399
174 3300053130 Ga0500642_0004467 Ga0500642_0004467_1737_2948 399
175 3300053142 Ga0500577_0002085 Ga0500577_0002085_1917_3134 399
176 3300053147 Ga0500589_000008 Ga0500589_000008_60595_61806 399
177 3300001915 JGI24741J21665_1000566 JGI24741J21665_10005669 400
178 3300001990 JGI24737J22298_10000185 JGI24737J22298_100001858 400
179 3300002067 JGI24735J21928_10000436 JGI24735J21928_100004363 400
180 3300005563 Ga0068855_100000003 Ga0068855_100000003180 400
181 3300006195 Ga0075366_10030947 Ga0075366_100309472 400
182 3300009174 Ga0105241_10000003 Ga0105241_10000003126 400
183 3300013105 Ga0157369_10006673 Ga0157369_1000667318 400
184 3300025911 Ga0207654_10000002 Ga0207654_100000021083 400
185 3300025949 Ga0207667_10000008 Ga0207667_10000008177 400
186 3300050493 nmdc:mga0k408_21663_c1 nmdc:mga0k408_21663_c1_333_1547 400
187 3300053137 Ga0500561_0000001 Ga0500561_0000001_485358_486572 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

229

388

0.96

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

236

375

0.93

PF08323

Glyco_transf_5

Starch synthase catalytic domain

14

204

0.81

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

28

210

0.81

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

101

402

0.73

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

27

215

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8716 222 379
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8599 222 378
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8564 222 379
3qhp-assembly2.cif.gz_B crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8493 222 378
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8156 195 377
ID Description Score Start End Superfamily
af_P9WMY9_212_374_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9291 220 373 3.40.50.2000
af_P9WMZ3_200_365_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9241 225 379 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9213 226 379 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9161 221 375 3.40.50.2000
af_Q2G0L2_318_480_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.91 219 378 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7X9K598-F1-model_v4 deleted 0.9079 177 397
AF-A0A662RJY4-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.8879 224 399 GO:0016757
AF-A0A536BPE0-F1-model_v4 Glycosyltransferase family 4 protein 0.8743 222 393 GO:0016757
AF-A0A554IE75-F1-model_v4 Group 1 glycosyl transferase 0.8739 222 393 GO:0009103
GO:0016757
GO:0045226
AF-A0A166TZU9-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.8704 221 393 GO:0016757

Feature Viewer

pLDDT pTM Quality
87.96 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map