F287575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 114 | 187 | 76 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_11812184|Ga0105245_118121841 |
| Length | 92 |
| Sequence | LNQPGATLALSLTGEQTMRNEMIGAVVRRAIEHPEFRRRLVESPREALTAHGFALEDSDMAEIESIRGKLSQDDAEQQLVTIAEHYGVDARP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 67 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 101 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 102 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 103 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 104 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 108 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 110 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13995695 | 2162886012 | Bacteria | 965 |
| 2 | JGI24743J22301_10141209 | 3300001991 | Bacteria | 536 |
| 3 | JGI24033J26618_1020566 | 3300002155 | Unclassified | 843 |
| 4 | Ga0070658_10099092 | 3300005327 | Unclassified | 2408 |
| 5 | Ga0070683_100132444 | 3300005329 | Bacteria | 2360 |
| 6 | Ga0070683_100340859 | 3300005329 | Unclassified | 1427 |
| 7 | Ga0070670_100000192 | 3300005331 | Bacteria | 56249 |
| 8 | Ga0070677_10058779 | 3300005333 | Bacteria | 1580 |
| 9 | Ga0068869_100022045 | 3300005334 | Unclassified | 4385 |
| 10 | Ga0070682_100000024 | 3300005337 | Bacteria | 199229 |
| 11 | Ga0070682_100182279 | 3300005337 | Unclassified | 1468 |
| 12 | Ga0070682_100518326 | 3300005337 | Unclassified | 927 |
| 13 | Ga0068868_100000010 | 3300005338 | Bacteria | 117927 |
| 14 | Ga0068868_100000681 | 3300005338 | Bacteria | 22821 |
| 15 | Ga0070689_101309117 | 3300005340 | Bacteria | 653 |
| 16 | Ga0070689_101904981 | 3300005340 | Bacteria | 543 |
| 17 | Ga0070687_100002309 | 3300005343 | Bacteria | 7091 |
| 18 | Ga0070687_100357590 | 3300005343 | Unclassified | 944 |
| 19 | Ga0070687_101494171 | 3300005343 | Bacteria | 508 |
| 20 | Ga0070692_10001577 | 3300005345 | Bacteria | 8371 |
| 21 | Ga0070692_10465926 | 3300005345 | Bacteria | 812 |
| 22 | Ga0070669_100259872 | 3300005353 | Bacteria | 1385 |
| 23 | Ga0070669_101000737 | 3300005353 | Bacteria | 717 |
| 24 | Ga0070669_101457881 | 3300005353 | Bacteria | 594 |
| 25 | Ga0070675_100455083 | 3300005354 | Unclassified | 1148 |
| 26 | Ga0070713_100195910 | 3300005436 | Bacteria | 1822 |
| 27 | Ga0070710_10745397 | 3300005437 | Bacteria | 695 |
| 28 | Ga0070701_10002999 | 3300005438 | Bacteria | 6605 |
| 29 | Ga0070708_100353819 | 3300005445 | Bacteria | 1384 |
| 30 | Ga0070706_100168224 | 3300005467 | Unclassified | 2047 |
| 31 | Ga0070698_100046391 | 3300005471 | Bacteria | 4442 |
| 32 | Ga0070699_100967639 | 3300005518 | Bacteria | 780 |
| 33 | Ga0070679_101956391 | 3300005530 | Unclassified | 535 |
| 34 | Ga0070684_100017078 | 3300005535 | Bacteria | 5948 |
| 35 | Ga0070684_100082583 | 3300005535 | Unclassified | 2845 |
| 36 | Ga0068853_100164965 | 3300005539 | Bacteria | 2001 |
| 37 | Ga0068853_100644042 | 3300005539 | Bacteria | 1008 |
| 38 | Ga0070672_100000247 | 3300005543 | Bacteria | 30388 |
| 39 | Ga0070672_100601955 | 3300005543 | Bacteria | 957 |
| 40 | Ga0070686_100485653 | 3300005544 | Bacteria | 956 |
| 41 | Ga0070696_100236084 | 3300005546 | Bacteria | 1377 |
| 42 | Ga0070693_100591436 | 3300005547 | Unclassified | 800 |
| 43 | Ga0068857_100341171 | 3300005577 | Unclassified | 1386 |
| 44 | Ga0068857_100558496 | 3300005577 | Bacteria | 1079 |
| 45 | Ga0068854_100008925 | 3300005578 | Bacteria | 6457 |
| 46 | Ga0068854_100036260 | 3300005578 | Bacteria | 3457 |
| 47 | Ga0070702_100014106 | 3300005615 | Unclassified | 4049 |
| 48 | Ga0070702_100048869 | 3300005615 | Bacteria | 2410 |
| 49 | Ga0070702_100117934 | 3300005615 | Unclassified | 1657 |
| 50 | Ga0070702_100923129 | 3300005615 | Bacteria | 685 |
| 51 | Ga0070702_101365169 | 3300005615 | Unclassified | 578 |
| 52 | Ga0068852_101913423 | 3300005616 | Unclassified | 615 |
| 53 | Ga0068859_100862612 | 3300005617 | Bacteria | 991 |
| 54 | Ga0068864_100000034 | 3300005618 | Bacteria | 199411 |
| 55 | Ga0068864_101195011 | 3300005618 | Bacteria | 759 |
| 56 | Ga0068858_101841125 | 3300005842 | Unclassified | 598 |
| 57 | Ga0070717_10000115 | 3300006028 | Bacteria | 62733 |
| 58 | Ga0070716_100079669 | 3300006173 | Bacteria | 1951 |
| 59 | Ga0070716_100618610 | 3300006173 | Unclassified | 817 |
| 60 | Ga0097621_100163170 | 3300006237 | Bacteria | 1916 |
| 61 | Ga0097621_100796759 | 3300006237 | Unclassified | 875 |
| 62 | Ga0075428_100017989 | 3300006844 | Bacteria | 7809 |
| 63 | Ga0075431_100007322 | 3300006847 | Bacteria | 10990 |
| 64 | Ga0075431_100167955 | 3300006847 | Unclassified | 2255 |
| 65 | Ga0075433_11662492 | 3300006852 | Unclassified | 550 |
| 66 | Ga0075434_100468974 | 3300006871 | Bacteria | 1280 |
| 67 | Ga0075434_102046857 | 3300006871 | Bacteria | 577 |
| 68 | Ga0075429_101256473 | 3300006880 | Bacteria | 646 |
| 69 | Ga0068865_100352814 | 3300006881 | Unclassified | 1192 |
| 70 | Ga0075436_100001088 | 3300006914 | Bacteria | 18303 |
| 71 | Ga0097620_100862772 | 3300006931 | Bacteria | 991 |
| 72 | Ga0075435_100000632 | 3300007076 | Bacteria | 21607 |
| 73 | Ga0075435_100108637 | 3300007076 | Unclassified | 2305 |
| 74 | Ga0075435_100179085 | 3300007076 | Bacteria | 1791 |
| 75 | Ga0075435_100438985 | 3300007076 | Bacteria | 1125 |
| 76 | Ga0105240_10941902 | 3300009093 | Unclassified | 927 |
| 77 | Ga0105245_10000057 | 3300009098 | Bacteria | 124024 |
| 78 | Ga0105245_10001388 | 3300009098 | Bacteria | 21931 |
| 79 | Ga0105245_10091534 | 3300009098 | Bacteria | 2799 |
| 80 | Ga0105245_10411327 | 3300009098 | Unclassified | 1354 |
| 81 | Ga0105245_11812184 | 3300009098 | Unclassified | 663 |
| 82 | Ga0105248_10741797 | 3300009177 | Bacteria | 1108 |
| 83 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 84 | Ga0105239_10024296 | 3300010375 | Bacteria | 6675 |
| 85 | Ga0105246_10283937 | 3300011119 | Unclassified | 1329 |
| 86 | Ga0105246_10305049 | 3300011119 | Bacteria | 1287 |
| 87 | Ga0157371_10382014 | 3300013102 | Unclassified | 1028 |
| 88 | Ga0157369_10000351 | 3300013105 | Bacteria | 61398 |
| 89 | Ga0157374_10000019 | 3300013296 | Bacteria | 280543 |
| 90 | Ga0157374_10949765 | 3300013296 | Bacteria | 878 |
| 91 | Ga0157378_10000286 | 3300013297 | Bacteria | 49248 |
| 92 | Ga0157378_11060164 | 3300013297 | Bacteria | 846 |
| 93 | Ga0163162_10052394 | 3300013306 | Bacteria | 4098 |
| 94 | Ga0163162_10349257 | 3300013306 | Unclassified | 1612 |
| 95 | Ga0163162_13161930 | 3300013306 | Unclassified | 528 |
| 96 | Ga0157372_10716603 | 3300013307 | Unclassified | 1164 |
| 97 | Ga0157372_10753216 | 3300013307 | Unclassified | 1132 |
| 98 | Ga0157375_10000002 | 3300013308 | Bacteria | 495826 |
| 99 | Ga0157375_10000004 | 3300013308 | Bacteria | 474935 |
| 100 | Ga0157375_10010500 | 3300013308 | Bacteria | 8153 |
| 101 | Ga0157375_10976161 | 3300013308 | Unclassified | 988 |
| 102 | Ga0157375_11893934 | 3300013308 | Unclassified | 708 |
| 103 | Ga0163163_10120832 | 3300014325 | Unclassified | 2654 |
| 104 | Ga0157380_10004598 | 3300014326 | Bacteria | 9584 |
| 105 | Ga0157377_10000008 | 3300014745 | Bacteria | 394748 |
| 106 | Ga0157377_10000018 | 3300014745 | Bacteria | 178091 |
| 107 | Ga0157377_10969727 | 3300014745 | Bacteria | 641 |
| 108 | Ga0157376_10000021 | 3300014969 | Bacteria | 240083 |
| 109 | Ga0213873_10000003 | 3300021358 | Bacteria | 973849 |
| 110 | Ga0213873_10000366 | 3300021358 | Bacteria | 7455 |
| 111 | Ga0213876_10000003 | 3300021384 | Bacteria | 973849 |
| 112 | Ga0213876_10000077 | 3300021384 | Bacteria | 112133 |
| 113 | Ga0207688_10840151 | 3300025901 | Bacteria | 582 |
| 114 | Ga0207645_10415224 | 3300025907 | Bacteria | 906 |
| 115 | Ga0207705_10071623 | 3300025909 | Unclassified | 2513 |
| 116 | Ga0207684_10322691 | 3300025910 | Bacteria | 1331 |
| 117 | Ga0207654_10601259 | 3300025911 | Unclassified | 785 |
| 118 | Ga0207695_10614437 | 3300025913 | Unclassified | 968 |
| 119 | Ga0207662_10009143 | 3300025918 | Bacteria | 5446 |
| 120 | Ga0207662_11275166 | 3300025918 | Bacteria | 522 |
| 121 | Ga0207681_10971502 | 3300025923 | Bacteria | 712 |
| 122 | Ga0207681_11385135 | 3300025923 | Unclassified | 590 |
| 123 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 124 | Ga0207650_10000123 | 3300025925 | Bacteria | 98317 |
| 125 | Ga0207650_10093656 | 3300025925 | Bacteria | 2300 |
| 126 | Ga0207687_10000002 | 3300025927 | Bacteria | 975489 |
| 127 | Ga0207687_10008072 | 3300025927 | Bacteria | 6887 |
| 128 | Ga0207687_10088627 | 3300025927 | Bacteria | 2251 |
| 129 | Ga0207687_10614420 | 3300025927 | Bacteria | 917 |
| 130 | Ga0207690_10835864 | 3300025932 | Bacteria | 762 |
| 131 | Ga0207670_10201425 | 3300025936 | Bacteria | 1513 |
| 132 | Ga0207670_10461504 | 3300025936 | Bacteria | 1025 |
| 133 | Ga0207704_10074078 | 3300025938 | Bacteria | 2171 |
| 134 | Ga0207665_10105020 | 3300025939 | Bacteria | 1978 |
| 135 | Ga0207691_10002417 | 3300025940 | Bacteria | 18271 |
| 136 | Ga0207689_10149333 | 3300025942 | Bacteria | 1926 |
| 137 | Ga0207689_10764184 | 3300025942 | Bacteria | 816 |
| 138 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 139 | Ga0207661_10105564 | 3300025944 | Bacteria | 2374 |
| 140 | Ga0207661_10349773 | 3300025944 | Unclassified | 1333 |
| 141 | Ga0207679_11211803 | 3300025945 | Unclassified | 693 |
| 142 | Ga0207640_10006585 | 3300025981 | Bacteria | 6377 |
| 143 | Ga0207640_10847022 | 3300025981 | Bacteria | 795 |
| 144 | Ga0207677_10000005 | 3300026023 | Bacteria | 287656 |
| 145 | Ga0207677_10000057 | 3300026023 | Bacteria | 97301 |
| 146 | Ga0207703_10260443 | 3300026035 | Bacteria | 1567 |
| 147 | Ga0207639_10000007 | 3300026041 | Bacteria | 451321 |
| 148 | Ga0207639_10748353 | 3300026041 | Bacteria | 909 |
| 149 | Ga0207648_10696890 | 3300026089 | Unclassified | 941 |
| 150 | Ga0207648_10939460 | 3300026089 | Unclassified | 809 |
| 151 | Ga0207676_10000020 | 3300026095 | Bacteria | 301541 |
| 152 | Ga0207676_11871924 | 3300026095 | Unclassified | 599 |
| 153 | Ga0207683_11952299 | 3300026121 | Unclassified | 535 |
| 154 | Ga0307408_101942287 | 3300031548 | Bacteria | 565 |
| 155 | Ga0307412_11818172 | 3300031911 | Unclassified | 561 |
| 156 | Ga0307416_100074985 | 3300032002 | Bacteria | 2829 |
| 157 | Ga0307416_101416340 | 3300032002 | Bacteria | 801 |
| 158 | Ga0307415_102024973 | 3300032126 | Unclassified | 561 |
| 159 | Ga0373932_0000267 | 3300035112 | Bacteria | 15747 |
| 160 | Ga0436365_0599494 | 3300039437 | Unclassified | 1165 |
| 161 | Ga0436365_0732477 | 3300039437 | Bacteria | 196205 |
| 162 | Ga0436365_1171278 | 3300039437 | Bacteria | 105378 |
| 163 | Ga0436363_0189466 | 3300039450 | Bacteria | 1131 |
| 164 | Ga0436363_0712003 | 3300039450 | Unclassified | 1610 |
| 165 | Ga0436362_0263779 | 3300039453 | Bacteria | 319094 |
| 166 | Ga0436362_0967117 | 3300039453 | Bacteria | 3042 |
| 167 | Ga0451839_0991182 | 3300041496 | Unclassified | 1387 |
| 168 | Ga0451839_1598528 | 3300041496 | Unclassified | 564 |
| 169 | Ga0451577_0500949 | 3300042876 | Bacteria | 1103 |
| 170 | Ga0495620_0007257 | 3300046515 | Bacteria | 6034 |
| 171 | Ga0495621_0143608 | 3300046539 | Unclassified | 935 |
| 172 | Ga0495679_027317 | 3300047446 | Unclassified | 1885 |
| 173 | Ga0496106_0063948 | 3300048909 | Unclassified | 2798 |
| 174 | nmdc:mga09592_1107694_c1 | 3300050508 | Bacteria | 658 |
| 175 | nmdc:mga06r32_164077_c1 | 3300050510 | Unclassified | 2204 |
| 176 | nmdc:mga06r32_5947_c1 | 3300050510 | Bacteria | 10977 |
| 177 | nmdc:mga0n895_134810_c1 | 3300050512 | Bacteria | 2495 |
| 178 | nmdc:mga0n895_1520762_c1 | 3300050512 | Bacteria | 635 |
| 179 | nmdc:mga0n895_676877_c1 | 3300050512 | Bacteria | 1029 |
| 180 | nmdc:mga0rr50_183854_c1 | 3300050513 | Bacteria | 1710 |
| 181 | nmdc:mga0rr50_23148_c1 | 3300050513 | Bacteria | 4277 |
| 182 | nmdc:mga0rr50_461_c1 | 3300050513 | Bacteria | 21669 |
| 183 | nmdc:mga0rr50_95634_c1 | 3300050513 | Unclassified | 2322 |
| 184 | nmdc:mga08x19_1254116_c1 | 3300050514 | Unclassified | 525 |
| 185 | nmdc:mga08x19_941_c1 | 3300050514 | Bacteria | 18307 |
| 186 | Ga0495655_0000107 | 3300053083 | Bacteria | 15872 |
| 187 | Ga0501082_0954649 | 3300060353 | Unclassified | 750 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005616 | Ga0068852_101913423 | Ga0068852_1019134231 | 69 |
| 2 | 3300005471 | Ga0070698_100046391 | Ga0070698_1000463912 | 74 |
| 3 | 3300005518 | Ga0070699_100967639 | Ga0070699_1009676392 | 74 |
| 4 | 3300005327 | Ga0070658_10099092 | Ga0070658_100990922 | 75 |
| 5 | 3300005331 | Ga0070670_100000192 | Ga0070670_10000019228 | 75 |
| 6 | 3300005334 | Ga0068869_100022045 | Ga0068869_1000220453 | 75 |
| 7 | 3300005337 | Ga0070682_100182279 | Ga0070682_1001822792 | 75 |
| 8 | 3300005337 | Ga0070682_100518326 | Ga0070682_1005183262 | 75 |
| 9 | 3300005338 | Ga0068868_100000010 | Ga0068868_10000001059 | 75 |
| 10 | 3300005345 | Ga0070692_10001577 | Ga0070692_100015772 | 75 |
| 11 | 3300005345 | Ga0070692_10465926 | Ga0070692_104659262 | 75 |
| 12 | 3300005353 | Ga0070669_100259872 | Ga0070669_1002598721 | 75 |
| 13 | 3300005437 | Ga0070710_10745397 | Ga0070710_107453972 | 75 |
| 14 | 3300005445 | Ga0070708_100353819 | Ga0070708_1003538192 | 75 |
| 15 | 3300005530 | Ga0070679_101956391 | Ga0070679_1019563911 | 75 |
| 16 | 3300005535 | Ga0070684_100017078 | Ga0070684_1000170782 | 75 |
| 17 | 3300005539 | Ga0068853_100644042 | Ga0068853_1006440422 | 75 |
| 18 | 3300005543 | Ga0070672_100601955 | Ga0070672_1006019551 | 75 |
| 19 | 3300005578 | Ga0068854_100008925 | Ga0068854_1000089254 | 75 |
| 20 | 3300005578 | Ga0068854_100036260 | Ga0068854_1000362602 | 75 |
| 21 | 3300005615 | Ga0070702_100923129 | Ga0070702_1009231292 | 75 |
| 22 | 3300005618 | Ga0068864_101195011 | Ga0068864_1011950112 | 75 |
| 23 | 3300006237 | Ga0097621_100163170 | Ga0097621_1001631701 | 75 |
| 24 | 3300006237 | Ga0097621_100796759 | Ga0097621_1007967591 | 75 |
| 25 | 3300009098 | Ga0105245_10000057 | Ga0105245_1000005783 | 75 |
| 26 | 3300009098 | Ga0105245_11812184 | Ga0105245_118121841 | 75 |
| 27 | 3300009177 | Ga0105248_10741797 | Ga0105248_107417971 | 75 |
| 28 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011560 | 75 |
| 29 | 3300011119 | Ga0105246_10283937 | Ga0105246_102839372 | 75 |
| 30 | 3300011119 | Ga0105246_10305049 | Ga0105246_103050492 | 75 |
| 31 | 3300013105 | Ga0157369_10000351 | Ga0157369_1000035124 | 75 |
| 32 | 3300013296 | Ga0157374_10000019 | Ga0157374_10000019192 | 75 |
| 33 | 3300013296 | Ga0157374_10949765 | Ga0157374_109497651 | 75 |
| 34 | 3300013297 | Ga0157378_10000286 | Ga0157378_1000028641 | 75 |
| 35 | 3300013297 | Ga0157378_11060164 | Ga0157378_110601641 | 75 |
| 36 | 3300013307 | Ga0157372_10716603 | Ga0157372_107166032 | 75 |
| 37 | 3300013308 | Ga0157375_10000004 | Ga0157375_10000004372 | 75 |
| 38 | 3300013308 | Ga0157375_10010500 | Ga0157375_100105005 | 75 |
| 39 | 3300013308 | Ga0157375_11893934 | Ga0157375_118939341 | 75 |
| 40 | 3300014325 | Ga0163163_10120832 | Ga0163163_101208322 | 75 |
| 41 | 3300014745 | Ga0157377_10000008 | Ga0157377_10000008217 | 75 |
| 42 | 3300014969 | Ga0157376_10000021 | Ga0157376_10000021118 | 75 |
| 43 | 3300021358 | Ga0213873_10000366 | Ga0213873_100003663 | 75 |
| 44 | 3300021384 | Ga0213876_10000077 | Ga0213876_1000007746 | 75 |
| 45 | 3300025909 | Ga0207705_10071623 | Ga0207705_100716232 | 75 |
| 46 | 3300025911 | Ga0207654_10601259 | Ga0207654_106012591 | 75 |
| 47 | 3300025923 | Ga0207681_11385135 | Ga0207681_113851351 | 75 |
| 48 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012596 | 75 |
| 49 | 3300025925 | Ga0207650_10000123 | Ga0207650_1000012368 | 75 |
| 50 | 3300025925 | Ga0207650_10093656 | Ga0207650_100936563 | 75 |
| 51 | 3300025927 | Ga0207687_10000002 | Ga0207687_10000002465 | 75 |
| 52 | 3300025927 | Ga0207687_10614420 | Ga0207687_106144202 | 75 |
| 53 | 3300025942 | Ga0207689_10149333 | Ga0207689_101493332 | 75 |
| 54 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007312 | 75 |
| 55 | 3300025945 | Ga0207679_11211803 | Ga0207679_112118031 | 75 |
| 56 | 3300025981 | Ga0207640_10006585 | Ga0207640_100065854 | 75 |
| 57 | 3300025981 | Ga0207640_10847022 | Ga0207640_108470222 | 75 |
| 58 | 3300026023 | Ga0207677_10000057 | Ga0207677_1000005775 | 75 |
| 59 | 3300026041 | Ga0207639_10748353 | Ga0207639_107483532 | 75 |
| 60 | 3300026095 | Ga0207676_11871924 | Ga0207676_118719241 | 75 |
| 61 | 3300031548 | Ga0307408_101942287 | Ga0307408_1019422872 | 75 |
| 62 | 3300031911 | Ga0307412_11818172 | Ga0307412_118181721 | 75 |
| 63 | 3300032002 | Ga0307416_100074985 | Ga0307416_1000749852 | 75 |
| 64 | 3300039437 | Ga0436365_0732477 | Ga0436365_0732477_162125_162352 | 75 |
| 65 | 3300039450 | Ga0436363_0189466 | Ga0436363_0189466_577_804 | 75 |
| 66 | 3300039450 | Ga0436363_0712003 | Ga0436363_0712003_1234_1464 | 75 |
| 67 | 3300039453 | Ga0436362_0967117 | Ga0436362_0967117_1030_1257 | 75 |
| 68 | 3300041496 | Ga0451839_0991182 | Ga0451839_0991182_579_806 | 75 |
| 69 | 3300041496 | Ga0451839_1598528 | Ga0451839_1598528_220_447 | 75 |
| 70 | 3300046539 | Ga0495621_0143608 | Ga0495621_0143608_499_726 | 75 |
| 71 | 3300047446 | Ga0495679_027317 | Ga0495679_027317_1136_1363 | 75 |
| 72 | 3300048909 | Ga0496106_0063948 | Ga0496106_0063948_1374_1601 | 75 |
| 73 | 3300050514 | nmdc:mga08x19_1254116_c1 | nmdc:mga08x19_1254116_c1_46_273 | 75 |
| 74 | 3300001991 | JGI24743J22301_10141209 | JGI24743J22301_101412092 | 76 |
| 75 | 3300005329 | Ga0070683_100132444 | Ga0070683_1001324442 | 76 |
| 76 | 3300005329 | Ga0070683_100340859 | Ga0070683_1003408592 | 76 |
| 77 | 3300005333 | Ga0070677_10058779 | Ga0070677_100587792 | 76 |
| 78 | 3300005337 | Ga0070682_100000024 | Ga0070682_10000002459 | 76 |
| 79 | 3300005338 | Ga0068868_100000681 | Ga0068868_1000006813 | 76 |
| 80 | 3300005340 | Ga0070689_101309117 | Ga0070689_1013091171 | 76 |
| 81 | 3300005340 | Ga0070689_101904981 | Ga0070689_1019049811 | 76 |
| 82 | 3300005436 | Ga0070713_100195910 | Ga0070713_1001959102 | 76 |
| 83 | 3300005467 | Ga0070706_100168224 | Ga0070706_1001682242 | 76 |
| 84 | 3300005535 | Ga0070684_100082583 | Ga0070684_1000825832 | 76 |
| 85 | 3300005543 | Ga0070672_100000247 | Ga0070672_10000024730 | 76 |
| 86 | 3300005544 | Ga0070686_100485653 | Ga0070686_1004856532 | 76 |
| 87 | 3300005546 | Ga0070696_100236084 | Ga0070696_1002360841 | 76 |
| 88 | 3300005547 | Ga0070693_100591436 | Ga0070693_1005914362 | 76 |
| 89 | 3300005577 | Ga0068857_100341171 | Ga0068857_1003411712 | 76 |
| 90 | 3300005577 | Ga0068857_100558496 | Ga0068857_1005584962 | 76 |
| 91 | 3300005615 | Ga0070702_100117934 | Ga0070702_1001179342 | 76 |
| 92 | 3300005617 | Ga0068859_100862612 | Ga0068859_1008626122 | 76 |
| 93 | 3300005618 | Ga0068864_100000034 | Ga0068864_10000003455 | 76 |
| 94 | 3300005842 | Ga0068858_101841125 | Ga0068858_1018411252 | 76 |
| 95 | 3300006028 | Ga0070717_10000115 | Ga0070717_100001152 | 76 |
| 96 | 3300006852 | Ga0075433_11662492 | Ga0075433_116624921 | 76 |
| 97 | 3300006881 | Ga0068865_100352814 | Ga0068865_1003528142 | 76 |
| 98 | 3300006931 | Ga0097620_100862772 | Ga0097620_1008627722 | 76 |
| 99 | 3300007076 | Ga0075435_100108637 | Ga0075435_1001086372 | 76 |
| 100 | 3300007076 | Ga0075435_100179085 | Ga0075435_1001790852 | 76 |
| 101 | 3300013308 | Ga0157375_10000002 | Ga0157375_10000002318 | 76 |
| 102 | 3300013308 | Ga0157375_10976161 | Ga0157375_109761612 | 76 |
| 103 | 3300014745 | Ga0157377_10000018 | Ga0157377_1000001866 | 76 |
| 104 | 3300014745 | Ga0157377_10969727 | Ga0157377_109697272 | 76 |
| 105 | 3300025910 | Ga0207684_10322691 | Ga0207684_103226912 | 76 |
| 106 | 3300025918 | Ga0207662_11275166 | Ga0207662_112751661 | 76 |
| 107 | 3300025936 | Ga0207670_10461504 | Ga0207670_104615042 | 76 |
| 108 | 3300025938 | Ga0207704_10074078 | Ga0207704_100740782 | 76 |
| 109 | 3300025940 | Ga0207691_10002417 | Ga0207691_100024175 | 76 |
| 110 | 3300025944 | Ga0207661_10105564 | Ga0207661_101055642 | 76 |
| 111 | 3300025944 | Ga0207661_10349773 | Ga0207661_103497732 | 76 |
| 112 | 3300026023 | Ga0207677_10000005 | Ga0207677_1000000563 | 76 |
| 113 | 3300026035 | Ga0207703_10260443 | Ga0207703_102604432 | 76 |
| 114 | 3300026089 | Ga0207648_10939460 | Ga0207648_109394601 | 76 |
| 115 | 3300026095 | Ga0207676_10000020 | Ga0207676_10000020146 | 76 |
| 116 | 3300026121 | Ga0207683_11952299 | Ga0207683_119522991 | 76 |
| 117 | 3300032002 | Ga0307416_101416340 | Ga0307416_1014163402 | 76 |
| 118 | 3300032126 | Ga0307415_102024973 | Ga0307415_1020249731 | 76 |
| 119 | 3300035112 | Ga0373932_0000267 | Ga0373932_0000267_572_802 | 76 |
| 120 | 3300042876 | Ga0451577_0500949 | Ga0451577_0500949_310_540 | 76 |
| 121 | 3300050512 | nmdc:mga0n895_134810_c1 | nmdc:mga0n895_134810_c1_1810_2040 | 76 |
| 122 | 3300050513 | nmdc:mga0rr50_183854_c1 | nmdc:mga0rr50_183854_c1_949_1179 | 76 |
| 123 | 3300050513 | nmdc:mga0rr50_95634_c1 | nmdc:mga0rr50_95634_c1_1858_2088 | 76 |
| 124 | 3300002155 | JGI24033J26618_1020566 | JGI24033J26618_10205662 | 77 |
| 125 | 3300005343 | Ga0070687_100357590 | Ga0070687_1003575901 | 77 |
| 126 | 3300005353 | Ga0070669_101000737 | Ga0070669_1010007371 | 77 |
| 127 | 3300005354 | Ga0070675_100455083 | Ga0070675_1004550831 | 77 |
| 128 | 3300005438 | Ga0070701_10002999 | Ga0070701_100029995 | 77 |
| 129 | 3300005539 | Ga0068853_100164965 | Ga0068853_1001649651 | 77 |
| 130 | 3300005615 | Ga0070702_100014106 | Ga0070702_1000141063 | 77 |
| 131 | 3300005615 | Ga0070702_100048869 | Ga0070702_1000488691 | 77 |
| 132 | 3300005615 | Ga0070702_101365169 | Ga0070702_1013651691 | 77 |
| 133 | 3300006173 | Ga0070716_100079669 | Ga0070716_1000796692 | 77 |
| 134 | 3300006871 | Ga0075434_102046857 | Ga0075434_1020468571 | 77 |
| 135 | 3300006914 | Ga0075436_100001088 | Ga0075436_10000108813 | 77 |
| 136 | 3300007076 | Ga0075435_100000632 | Ga0075435_1000006327 | 77 |
| 137 | 3300007076 | Ga0075435_100438985 | Ga0075435_1004389852 | 77 |
| 138 | 3300009093 | Ga0105240_10941902 | Ga0105240_109419022 | 77 |
| 139 | 3300009098 | Ga0105245_10001388 | Ga0105245_100013886 | 77 |
| 140 | 3300009098 | Ga0105245_10091534 | Ga0105245_100915342 | 77 |
| 141 | 3300010375 | Ga0105239_10024296 | Ga0105239_100242964 | 77 |
| 142 | 3300013102 | Ga0157371_10382014 | Ga0157371_103820142 | 77 |
| 143 | 3300013306 | Ga0163162_10052394 | Ga0163162_100523942 | 77 |
| 144 | 3300013306 | Ga0163162_13161930 | Ga0163162_131619301 | 77 |
| 145 | 3300013307 | Ga0157372_10753216 | Ga0157372_107532162 | 77 |
| 146 | 3300025901 | Ga0207688_10840151 | Ga0207688_108401512 | 77 |
| 147 | 3300025913 | Ga0207695_10614437 | Ga0207695_106144372 | 77 |
| 148 | 3300025927 | Ga0207687_10008072 | Ga0207687_100080723 | 77 |
| 149 | 3300025927 | Ga0207687_10088627 | Ga0207687_100886272 | 77 |
| 150 | 3300025932 | Ga0207690_10835864 | Ga0207690_108358641 | 77 |
| 151 | 3300025936 | Ga0207670_10201425 | Ga0207670_102014252 | 77 |
| 152 | 3300025939 | Ga0207665_10105020 | Ga0207665_101050202 | 77 |
| 153 | 3300025942 | Ga0207689_10764184 | Ga0207689_107641842 | 77 |
| 154 | 3300026041 | Ga0207639_10000007 | Ga0207639_10000007176 | 77 |
| 155 | 3300026089 | Ga0207648_10696890 | Ga0207648_106968901 | 77 |
| 156 | 3300050512 | nmdc:mga0n895_1520762_c1 | nmdc:mga0n895_1520762_c1_169_405 | 77 |
| 157 | 3300050513 | nmdc:mga0rr50_23148_c1 | nmdc:mga0rr50_23148_c1_387_623 | 77 |
| 158 | 3300050513 | nmdc:mga0rr50_461_c1 | nmdc:mga0rr50_461_c1_15293_15529 | 77 |
| 159 | 3300050514 | nmdc:mga08x19_941_c1 | nmdc:mga08x19_941_c1_6769_7005 | 77 |
| 160 | 3300053083 | Ga0495655_0000107 | Ga0495655_0000107_7628_7861 | 77 |
| 161 | 3300060353 | Ga0501082_0954649 | Ga0501082_0954649_269_508 | 77 |
| 162 | 3300005343 | Ga0070687_100002309 | Ga0070687_10000230910 | 78 |
| 163 | 3300005343 | Ga0070687_101494171 | Ga0070687_1014941711 | 78 |
| 164 | 3300005353 | Ga0070669_101457881 | Ga0070669_1014578811 | 78 |
| 165 | 3300006844 | Ga0075428_100017989 | Ga0075428_1000179896 | 78 |
| 166 | 3300006847 | Ga0075431_100007322 | Ga0075431_1000073226 | 78 |
| 167 | 3300006847 | Ga0075431_100167955 | Ga0075431_1001679553 | 78 |
| 168 | 3300006880 | Ga0075429_101256473 | Ga0075429_1012564731 | 78 |
| 169 | 3300025918 | Ga0207662_10009143 | Ga0207662_100091432 | 78 |
| 170 | 3300025923 | Ga0207681_10971502 | Ga0207681_109715022 | 78 |
| 171 | 3300039437 | Ga0436365_0599494 | Ga0436365_0599494_702_938 | 78 |
| 172 | 3300046515 | Ga0495620_0007257 | Ga0495620_0007257_3547_3783 | 78 |
| 173 | 3300050508 | nmdc:mga09592_1107694_c1 | nmdc:mga09592_1107694_c1_164_400 | 78 |
| 174 | 3300050510 | nmdc:mga06r32_164077_c1 | nmdc:mga06r32_164077_c1_1483_1719 | 78 |
| 175 | 3300050510 | nmdc:mga06r32_5947_c1 | nmdc:mga06r32_5947_c1_6025_6261 | 78 |
| 176 | 2162886012 | MBSR1b_contig_13995695 | MBSR1b_0553.00007190 | 79 |
| 177 | 3300006173 | Ga0070716_100618610 | Ga0070716_1006186102 | 79 |
| 178 | 3300006871 | Ga0075434_100468974 | Ga0075434_1004689741 | 79 |
| 179 | 3300009098 | Ga0105245_10411327 | Ga0105245_104113272 | 79 |
| 180 | 3300013306 | Ga0163162_10349257 | Ga0163162_103492572 | 79 |
| 181 | 3300014326 | Ga0157380_10004598 | Ga0157380_100045985 | 79 |
| 182 | 3300021358 | Ga0213873_10000003 | Ga0213873_10000003862 | 79 |
| 183 | 3300021384 | Ga0213876_10000003 | Ga0213876_100000037 | 79 |
| 184 | 3300025907 | Ga0207645_10415224 | Ga0207645_104152242 | 79 |
| 185 | 3300039437 | Ga0436365_1171278 | Ga0436365_1171278_98053_98292 | 79 |
| 186 | 3300039453 | Ga0436362_0263779 | Ga0436362_0263779_7087_7326 | 79 |
| 187 | 3300050512 | nmdc:mga0n895_676877_c1 | nmdc:mga0n895_676877_c1_60_302 | 79 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zgd-assembly7.cif.gz_M | mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.7717 | 3 | 40 |
| 4fm4-assembly5.cif.gz_I | wild type fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.7689 | 3 | 40 |
| 3qz5-assembly2.cif.gz_C | crystal structure of co-type nitrile hydratase alpha-e168q from pseudomonas putida. | 0.7105 | 2 | 40 |
| 4zgj-assembly1.cif.gz_A | double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1 | 0.7032 | 5 | 41 |
| 6lk7-assembly2.cif.gz_D | crystal structure of os1348 from pseudomonas sp. os17 | 0.6798 | 4 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5JK67_51_150_1.20.120.140 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.4794 | 3 | 71 | 1.20.120.140 |
| 2og2A01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.4767 | 3 | 72 | 1.20.120.140 |
| af_O80842_54_155_1.20.120.140 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.4707 | 3 | 72 | 1.20.120.140 |
| 2og2A01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.4343 | 3 | 72 | 1.20.120.140 |
| af_Q5JK67_51_150_1.20.120.140 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain | 0.4338 | 3 | 71 | 1.20.120.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7YBP5-F1-model_v4 | Nif11-like leader peptide family natural product | 0.9837 | 1 | 74 |
GO:0003824
GO:0046914 |
| AF-A0A2V7XSH4-F1-model_v4 | Nif11 domain-containing protein | 0.9666 | 1 | 75 |
GO:0003824
GO:0046914 |
| AF-A0A2V7YBP5-F1-model_v4 | Nif11-like leader peptide family natural product | 0.9577 | 1 | 74 |
GO:0003824
GO:0046914 |
| AF-A0A1Q3SWR5-F1-model_v4 | Nif11 domain-containing protein | 0.9376 | 4 | 51 |
|
| AF-A0A6G8Q5S6-F1-model_v4 | Nif11 domain-containing protein | 0.9019 | 2 | 72 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar