F287575

General Info

Members Datasets Scaffolds Average Seq Length
187 114 187 76

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11812184|Ga0105245_118121841
Length 92
Sequence LNQPGATLALSLTGEQTMRNEMIGAVVRRAIEHPEFRRRLVESPREALTAHGFALEDSDMAEIESIRGKLSQDDAEQQLVTIAEHYGVDARP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13995695 2162886012 Bacteria 965
2 JGI24743J22301_10141209 3300001991 Bacteria 536
3 JGI24033J26618_1020566 3300002155 Unclassified 843
4 Ga0070658_10099092 3300005327 Unclassified 2408
5 Ga0070683_100132444 3300005329 Bacteria 2360
6 Ga0070683_100340859 3300005329 Unclassified 1427
7 Ga0070670_100000192 3300005331 Bacteria 56249
8 Ga0070677_10058779 3300005333 Bacteria 1580
9 Ga0068869_100022045 3300005334 Unclassified 4385
10 Ga0070682_100000024 3300005337 Bacteria 199229
11 Ga0070682_100182279 3300005337 Unclassified 1468
12 Ga0070682_100518326 3300005337 Unclassified 927
13 Ga0068868_100000010 3300005338 Bacteria 117927
14 Ga0068868_100000681 3300005338 Bacteria 22821
15 Ga0070689_101309117 3300005340 Bacteria 653
16 Ga0070689_101904981 3300005340 Bacteria 543
17 Ga0070687_100002309 3300005343 Bacteria 7091
18 Ga0070687_100357590 3300005343 Unclassified 944
19 Ga0070687_101494171 3300005343 Bacteria 508
20 Ga0070692_10001577 3300005345 Bacteria 8371
21 Ga0070692_10465926 3300005345 Bacteria 812
22 Ga0070669_100259872 3300005353 Bacteria 1385
23 Ga0070669_101000737 3300005353 Bacteria 717
24 Ga0070669_101457881 3300005353 Bacteria 594
25 Ga0070675_100455083 3300005354 Unclassified 1148
26 Ga0070713_100195910 3300005436 Bacteria 1822
27 Ga0070710_10745397 3300005437 Bacteria 695
28 Ga0070701_10002999 3300005438 Bacteria 6605
29 Ga0070708_100353819 3300005445 Bacteria 1384
30 Ga0070706_100168224 3300005467 Unclassified 2047
31 Ga0070698_100046391 3300005471 Bacteria 4442
32 Ga0070699_100967639 3300005518 Bacteria 780
33 Ga0070679_101956391 3300005530 Unclassified 535
34 Ga0070684_100017078 3300005535 Bacteria 5948
35 Ga0070684_100082583 3300005535 Unclassified 2845
36 Ga0068853_100164965 3300005539 Bacteria 2001
37 Ga0068853_100644042 3300005539 Bacteria 1008
38 Ga0070672_100000247 3300005543 Bacteria 30388
39 Ga0070672_100601955 3300005543 Bacteria 957
40 Ga0070686_100485653 3300005544 Bacteria 956
41 Ga0070696_100236084 3300005546 Bacteria 1377
42 Ga0070693_100591436 3300005547 Unclassified 800
43 Ga0068857_100341171 3300005577 Unclassified 1386
44 Ga0068857_100558496 3300005577 Bacteria 1079
45 Ga0068854_100008925 3300005578 Bacteria 6457
46 Ga0068854_100036260 3300005578 Bacteria 3457
47 Ga0070702_100014106 3300005615 Unclassified 4049
48 Ga0070702_100048869 3300005615 Bacteria 2410
49 Ga0070702_100117934 3300005615 Unclassified 1657
50 Ga0070702_100923129 3300005615 Bacteria 685
51 Ga0070702_101365169 3300005615 Unclassified 578
52 Ga0068852_101913423 3300005616 Unclassified 615
53 Ga0068859_100862612 3300005617 Bacteria 991
54 Ga0068864_100000034 3300005618 Bacteria 199411
55 Ga0068864_101195011 3300005618 Bacteria 759
56 Ga0068858_101841125 3300005842 Unclassified 598
57 Ga0070717_10000115 3300006028 Bacteria 62733
58 Ga0070716_100079669 3300006173 Bacteria 1951
59 Ga0070716_100618610 3300006173 Unclassified 817
60 Ga0097621_100163170 3300006237 Bacteria 1916
61 Ga0097621_100796759 3300006237 Unclassified 875
62 Ga0075428_100017989 3300006844 Bacteria 7809
63 Ga0075431_100007322 3300006847 Bacteria 10990
64 Ga0075431_100167955 3300006847 Unclassified 2255
65 Ga0075433_11662492 3300006852 Unclassified 550
66 Ga0075434_100468974 3300006871 Bacteria 1280
67 Ga0075434_102046857 3300006871 Bacteria 577
68 Ga0075429_101256473 3300006880 Bacteria 646
69 Ga0068865_100352814 3300006881 Unclassified 1192
70 Ga0075436_100001088 3300006914 Bacteria 18303
71 Ga0097620_100862772 3300006931 Bacteria 991
72 Ga0075435_100000632 3300007076 Bacteria 21607
73 Ga0075435_100108637 3300007076 Unclassified 2305
74 Ga0075435_100179085 3300007076 Bacteria 1791
75 Ga0075435_100438985 3300007076 Bacteria 1125
76 Ga0105240_10941902 3300009093 Unclassified 927
77 Ga0105245_10000057 3300009098 Bacteria 124024
78 Ga0105245_10001388 3300009098 Bacteria 21931
79 Ga0105245_10091534 3300009098 Bacteria 2799
80 Ga0105245_10411327 3300009098 Unclassified 1354
81 Ga0105245_11812184 3300009098 Unclassified 663
82 Ga0105248_10741797 3300009177 Bacteria 1108
83 Ga0105238_10000001 3300009551 Bacteria 2036163
84 Ga0105239_10024296 3300010375 Bacteria 6675
85 Ga0105246_10283937 3300011119 Unclassified 1329
86 Ga0105246_10305049 3300011119 Bacteria 1287
87 Ga0157371_10382014 3300013102 Unclassified 1028
88 Ga0157369_10000351 3300013105 Bacteria 61398
89 Ga0157374_10000019 3300013296 Bacteria 280543
90 Ga0157374_10949765 3300013296 Bacteria 878
91 Ga0157378_10000286 3300013297 Bacteria 49248
92 Ga0157378_11060164 3300013297 Bacteria 846
93 Ga0163162_10052394 3300013306 Bacteria 4098
94 Ga0163162_10349257 3300013306 Unclassified 1612
95 Ga0163162_13161930 3300013306 Unclassified 528
96 Ga0157372_10716603 3300013307 Unclassified 1164
97 Ga0157372_10753216 3300013307 Unclassified 1132
98 Ga0157375_10000002 3300013308 Bacteria 495826
99 Ga0157375_10000004 3300013308 Bacteria 474935
100 Ga0157375_10010500 3300013308 Bacteria 8153
101 Ga0157375_10976161 3300013308 Unclassified 988
102 Ga0157375_11893934 3300013308 Unclassified 708
103 Ga0163163_10120832 3300014325 Unclassified 2654
104 Ga0157380_10004598 3300014326 Bacteria 9584
105 Ga0157377_10000008 3300014745 Bacteria 394748
106 Ga0157377_10000018 3300014745 Bacteria 178091
107 Ga0157377_10969727 3300014745 Bacteria 641
108 Ga0157376_10000021 3300014969 Bacteria 240083
109 Ga0213873_10000003 3300021358 Bacteria 973849
110 Ga0213873_10000366 3300021358 Bacteria 7455
111 Ga0213876_10000003 3300021384 Bacteria 973849
112 Ga0213876_10000077 3300021384 Bacteria 112133
113 Ga0207688_10840151 3300025901 Bacteria 582
114 Ga0207645_10415224 3300025907 Bacteria 906
115 Ga0207705_10071623 3300025909 Unclassified 2513
116 Ga0207684_10322691 3300025910 Bacteria 1331
117 Ga0207654_10601259 3300025911 Unclassified 785
118 Ga0207695_10614437 3300025913 Unclassified 968
119 Ga0207662_10009143 3300025918 Bacteria 5446
120 Ga0207662_11275166 3300025918 Bacteria 522
121 Ga0207681_10971502 3300025923 Bacteria 712
122 Ga0207681_11385135 3300025923 Unclassified 590
123 Ga0207694_10000001 3300025924 Bacteria 4078485
124 Ga0207650_10000123 3300025925 Bacteria 98317
125 Ga0207650_10093656 3300025925 Bacteria 2300
126 Ga0207687_10000002 3300025927 Bacteria 975489
127 Ga0207687_10008072 3300025927 Bacteria 6887
128 Ga0207687_10088627 3300025927 Bacteria 2251
129 Ga0207687_10614420 3300025927 Bacteria 917
130 Ga0207690_10835864 3300025932 Bacteria 762
131 Ga0207670_10201425 3300025936 Bacteria 1513
132 Ga0207670_10461504 3300025936 Bacteria 1025
133 Ga0207704_10074078 3300025938 Bacteria 2171
134 Ga0207665_10105020 3300025939 Bacteria 1978
135 Ga0207691_10002417 3300025940 Bacteria 18271
136 Ga0207689_10149333 3300025942 Bacteria 1926
137 Ga0207689_10764184 3300025942 Bacteria 816
138 Ga0207661_10000007 3300025944 Bacteria 471636
139 Ga0207661_10105564 3300025944 Bacteria 2374
140 Ga0207661_10349773 3300025944 Unclassified 1333
141 Ga0207679_11211803 3300025945 Unclassified 693
142 Ga0207640_10006585 3300025981 Bacteria 6377
143 Ga0207640_10847022 3300025981 Bacteria 795
144 Ga0207677_10000005 3300026023 Bacteria 287656
145 Ga0207677_10000057 3300026023 Bacteria 97301
146 Ga0207703_10260443 3300026035 Bacteria 1567
147 Ga0207639_10000007 3300026041 Bacteria 451321
148 Ga0207639_10748353 3300026041 Bacteria 909
149 Ga0207648_10696890 3300026089 Unclassified 941
150 Ga0207648_10939460 3300026089 Unclassified 809
151 Ga0207676_10000020 3300026095 Bacteria 301541
152 Ga0207676_11871924 3300026095 Unclassified 599
153 Ga0207683_11952299 3300026121 Unclassified 535
154 Ga0307408_101942287 3300031548 Bacteria 565
155 Ga0307412_11818172 3300031911 Unclassified 561
156 Ga0307416_100074985 3300032002 Bacteria 2829
157 Ga0307416_101416340 3300032002 Bacteria 801
158 Ga0307415_102024973 3300032126 Unclassified 561
159 Ga0373932_0000267 3300035112 Bacteria 15747
160 Ga0436365_0599494 3300039437 Unclassified 1165
161 Ga0436365_0732477 3300039437 Bacteria 196205
162 Ga0436365_1171278 3300039437 Bacteria 105378
163 Ga0436363_0189466 3300039450 Bacteria 1131
164 Ga0436363_0712003 3300039450 Unclassified 1610
165 Ga0436362_0263779 3300039453 Bacteria 319094
166 Ga0436362_0967117 3300039453 Bacteria 3042
167 Ga0451839_0991182 3300041496 Unclassified 1387
168 Ga0451839_1598528 3300041496 Unclassified 564
169 Ga0451577_0500949 3300042876 Bacteria 1103
170 Ga0495620_0007257 3300046515 Bacteria 6034
171 Ga0495621_0143608 3300046539 Unclassified 935
172 Ga0495679_027317 3300047446 Unclassified 1885
173 Ga0496106_0063948 3300048909 Unclassified 2798
174 nmdc:mga09592_1107694_c1 3300050508 Bacteria 658
175 nmdc:mga06r32_164077_c1 3300050510 Unclassified 2204
176 nmdc:mga06r32_5947_c1 3300050510 Bacteria 10977
177 nmdc:mga0n895_134810_c1 3300050512 Bacteria 2495
178 nmdc:mga0n895_1520762_c1 3300050512 Bacteria 635
179 nmdc:mga0n895_676877_c1 3300050512 Bacteria 1029
180 nmdc:mga0rr50_183854_c1 3300050513 Bacteria 1710
181 nmdc:mga0rr50_23148_c1 3300050513 Bacteria 4277
182 nmdc:mga0rr50_461_c1 3300050513 Bacteria 21669
183 nmdc:mga0rr50_95634_c1 3300050513 Unclassified 2322
184 nmdc:mga08x19_1254116_c1 3300050514 Unclassified 525
185 nmdc:mga08x19_941_c1 3300050514 Bacteria 18307
186 Ga0495655_0000107 3300053083 Bacteria 15872
187 Ga0501082_0954649 3300060353 Unclassified 750

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005616 Ga0068852_101913423 Ga0068852_1019134231 69
2 3300005471 Ga0070698_100046391 Ga0070698_1000463912 74
3 3300005518 Ga0070699_100967639 Ga0070699_1009676392 74
4 3300005327 Ga0070658_10099092 Ga0070658_100990922 75
5 3300005331 Ga0070670_100000192 Ga0070670_10000019228 75
6 3300005334 Ga0068869_100022045 Ga0068869_1000220453 75
7 3300005337 Ga0070682_100182279 Ga0070682_1001822792 75
8 3300005337 Ga0070682_100518326 Ga0070682_1005183262 75
9 3300005338 Ga0068868_100000010 Ga0068868_10000001059 75
10 3300005345 Ga0070692_10001577 Ga0070692_100015772 75
11 3300005345 Ga0070692_10465926 Ga0070692_104659262 75
12 3300005353 Ga0070669_100259872 Ga0070669_1002598721 75
13 3300005437 Ga0070710_10745397 Ga0070710_107453972 75
14 3300005445 Ga0070708_100353819 Ga0070708_1003538192 75
15 3300005530 Ga0070679_101956391 Ga0070679_1019563911 75
16 3300005535 Ga0070684_100017078 Ga0070684_1000170782 75
17 3300005539 Ga0068853_100644042 Ga0068853_1006440422 75
18 3300005543 Ga0070672_100601955 Ga0070672_1006019551 75
19 3300005578 Ga0068854_100008925 Ga0068854_1000089254 75
20 3300005578 Ga0068854_100036260 Ga0068854_1000362602 75
21 3300005615 Ga0070702_100923129 Ga0070702_1009231292 75
22 3300005618 Ga0068864_101195011 Ga0068864_1011950112 75
23 3300006237 Ga0097621_100163170 Ga0097621_1001631701 75
24 3300006237 Ga0097621_100796759 Ga0097621_1007967591 75
25 3300009098 Ga0105245_10000057 Ga0105245_1000005783 75
26 3300009098 Ga0105245_11812184 Ga0105245_118121841 75
27 3300009177 Ga0105248_10741797 Ga0105248_107417971 75
28 3300009551 Ga0105238_10000001 Ga0105238_100000011560 75
29 3300011119 Ga0105246_10283937 Ga0105246_102839372 75
30 3300011119 Ga0105246_10305049 Ga0105246_103050492 75
31 3300013105 Ga0157369_10000351 Ga0157369_1000035124 75
32 3300013296 Ga0157374_10000019 Ga0157374_10000019192 75
33 3300013296 Ga0157374_10949765 Ga0157374_109497651 75
34 3300013297 Ga0157378_10000286 Ga0157378_1000028641 75
35 3300013297 Ga0157378_11060164 Ga0157378_110601641 75
36 3300013307 Ga0157372_10716603 Ga0157372_107166032 75
37 3300013308 Ga0157375_10000004 Ga0157375_10000004372 75
38 3300013308 Ga0157375_10010500 Ga0157375_100105005 75
39 3300013308 Ga0157375_11893934 Ga0157375_118939341 75
40 3300014325 Ga0163163_10120832 Ga0163163_101208322 75
41 3300014745 Ga0157377_10000008 Ga0157377_10000008217 75
42 3300014969 Ga0157376_10000021 Ga0157376_10000021118 75
43 3300021358 Ga0213873_10000366 Ga0213873_100003663 75
44 3300021384 Ga0213876_10000077 Ga0213876_1000007746 75
45 3300025909 Ga0207705_10071623 Ga0207705_100716232 75
46 3300025911 Ga0207654_10601259 Ga0207654_106012591 75
47 3300025923 Ga0207681_11385135 Ga0207681_113851351 75
48 3300025924 Ga0207694_10000001 Ga0207694_100000012596 75
49 3300025925 Ga0207650_10000123 Ga0207650_1000012368 75
50 3300025925 Ga0207650_10093656 Ga0207650_100936563 75
51 3300025927 Ga0207687_10000002 Ga0207687_10000002465 75
52 3300025927 Ga0207687_10614420 Ga0207687_106144202 75
53 3300025942 Ga0207689_10149333 Ga0207689_101493332 75
54 3300025944 Ga0207661_10000007 Ga0207661_10000007312 75
55 3300025945 Ga0207679_11211803 Ga0207679_112118031 75
56 3300025981 Ga0207640_10006585 Ga0207640_100065854 75
57 3300025981 Ga0207640_10847022 Ga0207640_108470222 75
58 3300026023 Ga0207677_10000057 Ga0207677_1000005775 75
59 3300026041 Ga0207639_10748353 Ga0207639_107483532 75
60 3300026095 Ga0207676_11871924 Ga0207676_118719241 75
61 3300031548 Ga0307408_101942287 Ga0307408_1019422872 75
62 3300031911 Ga0307412_11818172 Ga0307412_118181721 75
63 3300032002 Ga0307416_100074985 Ga0307416_1000749852 75
64 3300039437 Ga0436365_0732477 Ga0436365_0732477_162125_162352 75
65 3300039450 Ga0436363_0189466 Ga0436363_0189466_577_804 75
66 3300039450 Ga0436363_0712003 Ga0436363_0712003_1234_1464 75
67 3300039453 Ga0436362_0967117 Ga0436362_0967117_1030_1257 75
68 3300041496 Ga0451839_0991182 Ga0451839_0991182_579_806 75
69 3300041496 Ga0451839_1598528 Ga0451839_1598528_220_447 75
70 3300046539 Ga0495621_0143608 Ga0495621_0143608_499_726 75
71 3300047446 Ga0495679_027317 Ga0495679_027317_1136_1363 75
72 3300048909 Ga0496106_0063948 Ga0496106_0063948_1374_1601 75
73 3300050514 nmdc:mga08x19_1254116_c1 nmdc:mga08x19_1254116_c1_46_273 75
74 3300001991 JGI24743J22301_10141209 JGI24743J22301_101412092 76
75 3300005329 Ga0070683_100132444 Ga0070683_1001324442 76
76 3300005329 Ga0070683_100340859 Ga0070683_1003408592 76
77 3300005333 Ga0070677_10058779 Ga0070677_100587792 76
78 3300005337 Ga0070682_100000024 Ga0070682_10000002459 76
79 3300005338 Ga0068868_100000681 Ga0068868_1000006813 76
80 3300005340 Ga0070689_101309117 Ga0070689_1013091171 76
81 3300005340 Ga0070689_101904981 Ga0070689_1019049811 76
82 3300005436 Ga0070713_100195910 Ga0070713_1001959102 76
83 3300005467 Ga0070706_100168224 Ga0070706_1001682242 76
84 3300005535 Ga0070684_100082583 Ga0070684_1000825832 76
85 3300005543 Ga0070672_100000247 Ga0070672_10000024730 76
86 3300005544 Ga0070686_100485653 Ga0070686_1004856532 76
87 3300005546 Ga0070696_100236084 Ga0070696_1002360841 76
88 3300005547 Ga0070693_100591436 Ga0070693_1005914362 76
89 3300005577 Ga0068857_100341171 Ga0068857_1003411712 76
90 3300005577 Ga0068857_100558496 Ga0068857_1005584962 76
91 3300005615 Ga0070702_100117934 Ga0070702_1001179342 76
92 3300005617 Ga0068859_100862612 Ga0068859_1008626122 76
93 3300005618 Ga0068864_100000034 Ga0068864_10000003455 76
94 3300005842 Ga0068858_101841125 Ga0068858_1018411252 76
95 3300006028 Ga0070717_10000115 Ga0070717_100001152 76
96 3300006852 Ga0075433_11662492 Ga0075433_116624921 76
97 3300006881 Ga0068865_100352814 Ga0068865_1003528142 76
98 3300006931 Ga0097620_100862772 Ga0097620_1008627722 76
99 3300007076 Ga0075435_100108637 Ga0075435_1001086372 76
100 3300007076 Ga0075435_100179085 Ga0075435_1001790852 76
101 3300013308 Ga0157375_10000002 Ga0157375_10000002318 76
102 3300013308 Ga0157375_10976161 Ga0157375_109761612 76
103 3300014745 Ga0157377_10000018 Ga0157377_1000001866 76
104 3300014745 Ga0157377_10969727 Ga0157377_109697272 76
105 3300025910 Ga0207684_10322691 Ga0207684_103226912 76
106 3300025918 Ga0207662_11275166 Ga0207662_112751661 76
107 3300025936 Ga0207670_10461504 Ga0207670_104615042 76
108 3300025938 Ga0207704_10074078 Ga0207704_100740782 76
109 3300025940 Ga0207691_10002417 Ga0207691_100024175 76
110 3300025944 Ga0207661_10105564 Ga0207661_101055642 76
111 3300025944 Ga0207661_10349773 Ga0207661_103497732 76
112 3300026023 Ga0207677_10000005 Ga0207677_1000000563 76
113 3300026035 Ga0207703_10260443 Ga0207703_102604432 76
114 3300026089 Ga0207648_10939460 Ga0207648_109394601 76
115 3300026095 Ga0207676_10000020 Ga0207676_10000020146 76
116 3300026121 Ga0207683_11952299 Ga0207683_119522991 76
117 3300032002 Ga0307416_101416340 Ga0307416_1014163402 76
118 3300032126 Ga0307415_102024973 Ga0307415_1020249731 76
119 3300035112 Ga0373932_0000267 Ga0373932_0000267_572_802 76
120 3300042876 Ga0451577_0500949 Ga0451577_0500949_310_540 76
121 3300050512 nmdc:mga0n895_134810_c1 nmdc:mga0n895_134810_c1_1810_2040 76
122 3300050513 nmdc:mga0rr50_183854_c1 nmdc:mga0rr50_183854_c1_949_1179 76
123 3300050513 nmdc:mga0rr50_95634_c1 nmdc:mga0rr50_95634_c1_1858_2088 76
124 3300002155 JGI24033J26618_1020566 JGI24033J26618_10205662 77
125 3300005343 Ga0070687_100357590 Ga0070687_1003575901 77
126 3300005353 Ga0070669_101000737 Ga0070669_1010007371 77
127 3300005354 Ga0070675_100455083 Ga0070675_1004550831 77
128 3300005438 Ga0070701_10002999 Ga0070701_100029995 77
129 3300005539 Ga0068853_100164965 Ga0068853_1001649651 77
130 3300005615 Ga0070702_100014106 Ga0070702_1000141063 77
131 3300005615 Ga0070702_100048869 Ga0070702_1000488691 77
132 3300005615 Ga0070702_101365169 Ga0070702_1013651691 77
133 3300006173 Ga0070716_100079669 Ga0070716_1000796692 77
134 3300006871 Ga0075434_102046857 Ga0075434_1020468571 77
135 3300006914 Ga0075436_100001088 Ga0075436_10000108813 77
136 3300007076 Ga0075435_100000632 Ga0075435_1000006327 77
137 3300007076 Ga0075435_100438985 Ga0075435_1004389852 77
138 3300009093 Ga0105240_10941902 Ga0105240_109419022 77
139 3300009098 Ga0105245_10001388 Ga0105245_100013886 77
140 3300009098 Ga0105245_10091534 Ga0105245_100915342 77
141 3300010375 Ga0105239_10024296 Ga0105239_100242964 77
142 3300013102 Ga0157371_10382014 Ga0157371_103820142 77
143 3300013306 Ga0163162_10052394 Ga0163162_100523942 77
144 3300013306 Ga0163162_13161930 Ga0163162_131619301 77
145 3300013307 Ga0157372_10753216 Ga0157372_107532162 77
146 3300025901 Ga0207688_10840151 Ga0207688_108401512 77
147 3300025913 Ga0207695_10614437 Ga0207695_106144372 77
148 3300025927 Ga0207687_10008072 Ga0207687_100080723 77
149 3300025927 Ga0207687_10088627 Ga0207687_100886272 77
150 3300025932 Ga0207690_10835864 Ga0207690_108358641 77
151 3300025936 Ga0207670_10201425 Ga0207670_102014252 77
152 3300025939 Ga0207665_10105020 Ga0207665_101050202 77
153 3300025942 Ga0207689_10764184 Ga0207689_107641842 77
154 3300026041 Ga0207639_10000007 Ga0207639_10000007176 77
155 3300026089 Ga0207648_10696890 Ga0207648_106968901 77
156 3300050512 nmdc:mga0n895_1520762_c1 nmdc:mga0n895_1520762_c1_169_405 77
157 3300050513 nmdc:mga0rr50_23148_c1 nmdc:mga0rr50_23148_c1_387_623 77
158 3300050513 nmdc:mga0rr50_461_c1 nmdc:mga0rr50_461_c1_15293_15529 77
159 3300050514 nmdc:mga08x19_941_c1 nmdc:mga08x19_941_c1_6769_7005 77
160 3300053083 Ga0495655_0000107 Ga0495655_0000107_7628_7861 77
161 3300060353 Ga0501082_0954649 Ga0501082_0954649_269_508 77
162 3300005343 Ga0070687_100002309 Ga0070687_10000230910 78
163 3300005343 Ga0070687_101494171 Ga0070687_1014941711 78
164 3300005353 Ga0070669_101457881 Ga0070669_1014578811 78
165 3300006844 Ga0075428_100017989 Ga0075428_1000179896 78
166 3300006847 Ga0075431_100007322 Ga0075431_1000073226 78
167 3300006847 Ga0075431_100167955 Ga0075431_1001679553 78
168 3300006880 Ga0075429_101256473 Ga0075429_1012564731 78
169 3300025918 Ga0207662_10009143 Ga0207662_100091432 78
170 3300025923 Ga0207681_10971502 Ga0207681_109715022 78
171 3300039437 Ga0436365_0599494 Ga0436365_0599494_702_938 78
172 3300046515 Ga0495620_0007257 Ga0495620_0007257_3547_3783 78
173 3300050508 nmdc:mga09592_1107694_c1 nmdc:mga09592_1107694_c1_164_400 78
174 3300050510 nmdc:mga06r32_164077_c1 nmdc:mga06r32_164077_c1_1483_1719 78
175 3300050510 nmdc:mga06r32_5947_c1 nmdc:mga06r32_5947_c1_6025_6261 78
176 2162886012 MBSR1b_contig_13995695 MBSR1b_0553.00007190 79
177 3300006173 Ga0070716_100618610 Ga0070716_1006186102 79
178 3300006871 Ga0075434_100468974 Ga0075434_1004689741 79
179 3300009098 Ga0105245_10411327 Ga0105245_104113272 79
180 3300013306 Ga0163162_10349257 Ga0163162_103492572 79
181 3300014326 Ga0157380_10004598 Ga0157380_100045985 79
182 3300021358 Ga0213873_10000003 Ga0213873_10000003862 79
183 3300021384 Ga0213876_10000003 Ga0213876_100000037 79
184 3300025907 Ga0207645_10415224 Ga0207645_104152242 79
185 3300039437 Ga0436365_1171278 Ga0436365_1171278_98053_98292 79
186 3300039453 Ga0436362_0263779 Ga0436362_0263779_7087_7326 79
187 3300050512 nmdc:mga0n895_676877_c1 nmdc:mga0n895_676877_c1_60_302 79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zgd-assembly7.cif.gz_M mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.7717 3 40
4fm4-assembly5.cif.gz_I wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.7689 3 40
3qz5-assembly2.cif.gz_C crystal structure of co-type nitrile hydratase alpha-e168q from pseudomonas putida. 0.7105 2 40
4zgj-assembly1.cif.gz_A double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.7032 5 41
6lk7-assembly2.cif.gz_D crystal structure of os1348 from pseudomonas sp. os17 0.6798 4 63
ID Description Score Start End Superfamily
af_Q5JK67_51_150_1.20.120.140 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.4794 3 71 1.20.120.140
2og2A01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.4767 3 72 1.20.120.140
af_O80842_54_155_1.20.120.140 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.4707 3 72 1.20.120.140
2og2A01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.4343 3 72 1.20.120.140
af_Q5JK67_51_150_1.20.120.140 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.4338 3 71 1.20.120.140
ID Description Score Start End GO Terms
AF-A0A2V7YBP5-F1-model_v4 Nif11-like leader peptide family natural product 0.9837 1 74 GO:0003824
GO:0046914
AF-A0A2V7XSH4-F1-model_v4 Nif11 domain-containing protein 0.9666 1 75 GO:0003824
GO:0046914
AF-A0A2V7YBP5-F1-model_v4 Nif11-like leader peptide family natural product 0.9577 1 74 GO:0003824
GO:0046914
AF-A0A1Q3SWR5-F1-model_v4 Nif11 domain-containing protein 0.9376 4 51
AF-A0A6G8Q5S6-F1-model_v4 Nif11 domain-containing protein 0.9019 2 72

Feature Viewer

pLDDT pTM Quality
83.26 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map