F287011

General Info

Members Datasets Scaffolds Average Seq Length
187 122 374 136

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10128691|Ga0065704_101286912
Length 146
Sequence VSKQFTLGKNERLKSRKQIEQLFAEGKSFVVNPFRVYYVVNDLPIAIGTSLVNKNGLLQFGIGVSSKNFKRAVDRNRIKRLTKEAWRLQKNDPIAIGLKEKMKAAGKQLNVFFIYTGKELPDFTTVKSKTAIALKKLEGKTDENIS

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
119 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
120 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
121 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
122 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 4.28
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 20.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10128691 3300005289 Bacteria 1659
2 Ga0065704_10128520 3300005289 Bacteria 1661
3 Ga0068869_100175228 3300005334 Bacteria 1678
4 Ga0070682_100030181 3300005337 Bacteria 3270
5 Ga0070682_100117535 3300005337 Bacteria 1780
6 Ga0068868_101540151 3300005338 Unclassified 623
7 Ga0070691_10238180 3300005341 Unclassified 971
8 Ga0070687_100498208 3300005343 Unclassified 819
9 Ga0070669_100081536 3300005353 Bacteria 2410
10 Ga0070675_100628841 3300005354 Unclassified 975
11 Ga0070675_101315381 3300005354 Bacteria 666
12 Ga0070671_100009797 3300005355 Bacteria 7691
13 Ga0070674_100990534 3300005356 Unclassified 737
14 Ga0070673_100665757 3300005364 Bacteria 954
15 Ga0070667_100143806 3300005367 Bacteria 2090
16 Ga0070667_100410677 3300005367 Bacteria 1233
17 Ga0070663_101067943 3300005455 Unclassified 705
18 Ga0070678_100114975 3300005456 Bacteria 2112
19 Ga0068867_100319265 3300005459 Unclassified 1286
20 Ga0068867_101059972 3300005459 Unclassified 738
21 Ga0070698_100007114 3300005471 Bacteria 12118
22 Ga0070698_100041323 3300005471 Bacteria 4734
23 Ga0070679_100474219 3300005530 Bacteria 1196
24 Ga0070697_100211758 3300005536 Bacteria 1650
25 Ga0068853_100049921 3300005539 Bacteria 3598
26 Ga0068853_100130066 3300005539 Bacteria 2253
27 Ga0068853_100178809 3300005539 Unclassified 1923
28 Ga0070686_100423991 3300005544 Bacteria 1017
29 Ga0070665_100644888 3300005548 Bacteria 1072
30 Ga0068855_100083133 3300005563 Bacteria 3709
31 Ga0068855_100721007 3300005563 Bacteria 1065
32 Ga0068857_100012449 3300005577 Bacteria 7406
33 Ga0068857_100326497 3300005577 Bacteria 1418
34 Ga0068857_100361399 3300005577 Bacteria 1346
35 Ga0068854_100033493 3300005578 Bacteria 3582
36 Ga0068854_100062420 3300005578 Bacteria 2701
37 Ga0070702_100333650 3300005615 Bacteria 1061
38 Ga0068852_100025691 3300005616 Bacteria 4776
39 Ga0068852_100905035 3300005616 Bacteria 899
40 Ga0068859_100005138 3300005617 Bacteria 13287
41 Ga0068859_100956455 3300005617 Unclassified 940
42 Ga0068864_100014426 3300005618 Bacteria 6563
43 Ga0068864_100070488 3300005618 Bacteria 3041
44 Ga0068864_100642857 3300005618 Bacteria 1032
45 Ga0068861_100055486 3300005719 Bacteria 3021
46 Ga0068861_100186315 3300005719 Unclassified 1731
47 Ga0068861_100192329 3300005719 Bacteria 1707
48 Ga0068863_100030630 3300005841 Bacteria 5137
49 Ga0068863_100859615 3300005841 Unclassified 906
50 Ga0068863_101576187 3300005841 Bacteria 666
51 Ga0068858_100785051 3300005842 Bacteria 929
52 Ga0068860_100037273 3300005843 Bacteria 4655
53 Ga0068862_100373442 3300005844 Bacteria 1328
54 Ga0075366_10007392 3300006195 Bacteria 6065
55 Ga0075366_10147765 3300006195 Bacteria 1423
56 Ga0097621_100000710 3300006237 Bacteria 23372
57 Ga0068871_100001042 3300006358 Bacteria 18566
58 Ga0068871_101850442 3300006358 Bacteria 573
59 Ga0075428_100009099 3300006844 Bacteria 11019
60 Ga0075428_100145832 3300006844 Bacteria 2572
61 Ga0075430_100103137 3300006846 Bacteria 2381
62 Ga0075431_100101125 3300006847 Bacteria 2975
63 Ga0075429_100029307 3300006880 Bacteria 4780
64 Ga0075429_100697912 3300006880 Unclassified 889
65 Ga0068865_101208363 3300006881 Unclassified 669
66 Ga0097620_100005138 3300006931 Bacteria 13287
67 Ga0097620_100956447 3300006931 Unclassified 940
68 Ga0105240_10012537 3300009093 Bacteria 11694
69 Ga0105240_10118285 3300009093 Bacteria 3193
70 Ga0111539_10508678 3300009094 Unclassified 1403
71 Ga0111539_12519138 3300009094 Unclassified 597
72 Ga0105247_10002367 3300009101 Bacteria 12851
73 Ga0114129_10004777 3300009147 Bacteria 19148
74 Ga0114129_10018262 3300009147 Bacteria 9988
75 Ga0114129_10136819 3300009147 Bacteria 3361
76 Ga0114129_12127912 3300009147 Bacteria 676
77 Ga0105241_10086762 3300009174 Bacteria 2462
78 Ga0105241_10404047 3300009174 Bacteria 1199
79 Ga0105241_10553895 3300009174 Unclassified 1033
80 Ga0105242_10052137 3300009176 Bacteria 3337
81 Ga0105248_10100235 3300009177 Bacteria 3264
82 Ga0105248_12747447 3300009177 Bacteria 561
83 Ga0105237_10018756 3300009545 Bacteria 7153
84 Ga0105249_10000623 3300009553 Bacteria 32238
85 Ga0105249_10001375 3300009553 Bacteria 21278
86 Ga0105249_11012149 3300009553 Bacteria 900
87 Ga0105249_11053497 3300009553 Unclassified 883
88 Ga0105239_10015130 3300010375 Bacteria 8552
89 Ga0105239_10065548 3300010375 Bacteria 3989
90 Ga0105246_10210164 3300011119 Bacteria 1518
91 Ga0157373_10004255 3300013100 Bacteria 10793
92 Ga0157371_10097184 3300013102 Bacteria 2087
93 Ga0157370_10025275 3300013104 Bacteria 5879
94 Ga0157370_11201474 3300013104 Bacteria 684
95 Ga0157369_10008966 3300013105 Bacteria 11458
96 Ga0157378_10017916 3300013297 Bacteria 6216
97 Ga0163162_10030853 3300013306 Bacteria 5312
98 Ga0157372_10245594 3300013307 Bacteria 2077
99 Ga0157375_10000850 3300013308 Bacteria 26585
100 Ga0157375_10307629 3300013308 Unclassified 1749
101 Ga0157375_11335012 3300013308 Bacteria 844
102 Ga0163163_10000825 3300014325 Bacteria 26376
103 Ga0163163_10017061 3300014325 Bacteria 6763
104 Ga0157379_10987553 3300014968 Unclassified 802
105 Ga0157379_11672042 3300014968 Unclassified 623
106 Ga0157376_10003419 3300014969 Bacteria 10926
107 Ga0157376_10116834 3300014969 Bacteria 2358
108 Ga0163161_10009574 3300017792 Bacteria 6699
109 Ga0163161_11950996 3300017792 Unclassified 522
110 Ga0207642_10180796 3300025899 Bacteria 1149
111 Ga0207710_10003661 3300025900 Bacteria 6815
112 Ga0207705_10463684 3300025909 Bacteria 983
113 Ga0207654_10034923 3300025911 Bacteria 2797
114 Ga0207654_10725421 3300025911 Unclassified 715
115 Ga0207695_10009898 3300025913 Bacteria 11715
116 Ga0207695_10018827 3300025913 Bacteria 7968
117 Ga0207671_10069000 3300025914 Bacteria 2635
118 Ga0207644_10053533 3300025931 Bacteria 2904
119 Ga0207686_10048174 3300025934 Bacteria 2639
120 Ga0207704_11639239 3300025938 Unclassified 553
121 Ga0207667_10009488 3300025949 Bacteria 11459
122 Ga0207712_10002336 3300025961 Bacteria 12303
123 Ga0207712_10003285 3300025961 Bacteria 10257
124 Ga0207712_10711648 3300025961 Unclassified 877
125 Ga0207668_10399964 3300025972 Unclassified 1161
126 Ga0207640_10050509 3300025981 Bacteria 2699
127 Ga0207640_10091455 3300025981 Bacteria 2108
128 Ga0207658_10188109 3300025986 Unclassified 1714
129 Ga0207677_10409739 3300026023 Unclassified 1152
130 Ga0207677_10825574 3300026023 Unclassified 831
131 Ga0207639_10013099 3300026041 Bacteria 5791
132 Ga0207639_10376087 3300026041 Unclassified 1275
133 Ga0207639_10580117 3300026041 Bacteria 1032
134 Ga0207641_10652754 3300026088 Unclassified 1033
135 Ga0207648_10024478 3300026089 Bacteria 5388
136 Ga0207648_10798883 3300026089 Bacteria 878
137 Ga0207648_10963632 3300026089 Bacteria 798
138 Ga0207676_10011174 3300026095 Bacteria 6410
139 Ga0207676_10666293 3300026095 Bacteria 1005
140 Ga0207674_10022575 3300026116 Bacteria 6754
141 Ga0207674_10352211 3300026116 Bacteria 1423
142 Ga0207674_10383445 3300026116 Bacteria 1359
143 Ga0207674_10759005 3300026116 Bacteria 936
144 Ga0207675_100004640 3300026118 Bacteria 13242
145 Ga0207675_100047920 3300026118 Bacteria 3989
146 Ga0207675_100093484 3300026118 Bacteria 2828
147 Ga0207683_10074212 3300026121 Bacteria 3009
148 Ga0209995_1036045 3300027471 Bacteria 832
149 Ga0209968_1021189 3300027526 Bacteria 1054
150 Ga0268265_10403534 3300028380 Bacteria 1264
151 Ga0268265_10532740 3300028380 Bacteria 1112
152 Ga0268265_11507911 3300028380 Bacteria 676
153 Ga0268264_10030851 3300028381 Bacteria 4394
154 Ga0307516_10142564 3300031730 Bacteria 2164
155 Ga0307416_100739186 3300032002 Unclassified 1076
156 Ga0373937_0902043 3300036401 Bacteria 833
157 Ga0436365_1798470 3300039437 Bacteria 2728
158 Ga0439447_078774 3300041407 Bacteria 762
159 Ga0451798_0395789 3300041458 Bacteria 576
160 Ga0451800_1170976 3300041459 Bacteria 874
161 Ga0451807_2568202 3300041486 Bacteria 663
162 Ga0450923_009750 3300042125 Bacteria 1688
163 Ga0466961_0206181 3300044693 Bacteria 1215
164 Ga0466957_0176973 3300044842 Bacteria 1392
165 Ga0495638_0046870 3300046460 Bacteria 2713
166 Ga0495598_0035040 3300046537 Bacteria 1435
167 Ga0495672_0021433 3300047320 Bacteria 4215
168 Ga0495672_0026077 3300047320 Bacteria 3733
169 Ga0495686_0029981 3300047472 Bacteria 3535
170 Ga0496101_0033227 3300048904 Bacteria 3637
171 Ga0496102_0379473 3300048905 Bacteria 1330
172 Ga0496104_1614306 3300048907 Unclassified 551
173 Ga0496105_0926994 3300048908 Unclassified 655
174 Ga0496114_0090978 3300048917 Bacteria 2591
175 nmdc:mga0k408_262776_c1 3300050493 Bacteria 1031
176 nmdc:mga05p37_8275_c1 3300050507 Bacteria 12298
177 nmdc:mga09592_1022893_c1 3300050508 Bacteria 690
178 nmdc:mga09592_44696_c1 3300050508 Bacteria 3730
179 nmdc:mga09592_764990_c1 3300050508 Bacteria 819
180 nmdc:mga0qj67_25551_c1 3300050509 Bacteria 4565
181 nmdc:mga06r32_37183_c1 3300050510 Bacteria 4605
182 nmdc:mga08y16_485267_c1 3300050511 Unclassified 1257
183 Ga0500641_0067727 3300053096 Bacteria 1497
184 Ga0500650_0517286 3300053098 Unclassified 506
185 Ga0500608_331334 3300053122 Unclassified 549
186 Ga0500637_0065492 3300053178 Bacteria 2085
187 Ga0500611_000060 3300053727 Bacteria 47744
188 Ga0065704_10128691
189 Ga0065704_10128520
190 Ga0068869_100175228
191 Ga0070682_100030181
192 Ga0070682_100117535
193 Ga0068868_101540151
194 Ga0070691_10238180
195 Ga0070687_100498208
196 Ga0070669_100081536
197 Ga0070675_100628841
198 Ga0070675_101315381
199 Ga0070671_100009797
200 Ga0070674_100990534
201 Ga0070673_100665757
202 Ga0070667_100143806
203 Ga0070667_100410677
204 Ga0070663_101067943
205 Ga0070678_100114975
206 Ga0068867_100319265
207 Ga0068867_101059972
208 Ga0070698_100007114
209 Ga0070698_100041323
210 Ga0070679_100474219
211 Ga0070697_100211758
212 Ga0068853_100049921
213 Ga0068853_100130066
214 Ga0068853_100178809
215 Ga0070686_100423991
216 Ga0070665_100644888
217 Ga0068855_100083133
218 Ga0068855_100721007
219 Ga0068857_100012449
220 Ga0068857_100326497
221 Ga0068857_100361399
222 Ga0068854_100033493
223 Ga0068854_100062420
224 Ga0070702_100333650
225 Ga0068852_100025691
226 Ga0068852_100905035
227 Ga0068859_100005138
228 Ga0068859_100956455
229 Ga0068864_100014426
230 Ga0068864_100070488
231 Ga0068864_100642857
232 Ga0068861_100055486
233 Ga0068861_100186315
234 Ga0068861_100192329
235 Ga0068863_100030630
236 Ga0068863_100859615
237 Ga0068863_101576187
238 Ga0068858_100785051
239 Ga0068860_100037273
240 Ga0068862_100373442
241 Ga0075366_10007392
242 Ga0075366_10147765
243 Ga0097621_100000710
244 Ga0068871_100001042
245 Ga0068871_101850442
246 Ga0075428_100009099
247 Ga0075428_100145832
248 Ga0075430_100103137
249 Ga0075431_100101125
250 Ga0075429_100029307
251 Ga0075429_100697912
252 Ga0068865_101208363
253 Ga0097620_100005138
254 Ga0097620_100956447
255 Ga0105240_10012537
256 Ga0105240_10118285
257 Ga0111539_10508678
258 Ga0111539_12519138
259 Ga0105247_10002367
260 Ga0114129_10004777
261 Ga0114129_10018262
262 Ga0114129_10136819
263 Ga0114129_12127912
264 Ga0105241_10086762
265 Ga0105241_10404047
266 Ga0105241_10553895
267 Ga0105242_10052137
268 Ga0105248_10100235
269 Ga0105248_12747447
270 Ga0105237_10018756
271 Ga0105249_10000623
272 Ga0105249_10001375
273 Ga0105249_11012149
274 Ga0105249_11053497
275 Ga0105239_10015130
276 Ga0105239_10065548
277 Ga0105246_10210164
278 Ga0157373_10004255
279 Ga0157371_10097184
280 Ga0157370_10025275
281 Ga0157370_11201474
282 Ga0157369_10008966
283 Ga0157378_10017916
284 Ga0163162_10030853
285 Ga0157372_10245594
286 Ga0157375_10000850
287 Ga0157375_10307629
288 Ga0157375_11335012
289 Ga0163163_10000825
290 Ga0163163_10017061
291 Ga0157379_10987553
292 Ga0157379_11672042
293 Ga0157376_10003419
294 Ga0157376_10116834
295 Ga0163161_10009574
296 Ga0163161_11950996
297 Ga0207642_10180796
298 Ga0207710_10003661
299 Ga0207705_10463684
300 Ga0207654_10034923
301 Ga0207654_10725421
302 Ga0207695_10009898
303 Ga0207695_10018827
304 Ga0207671_10069000
305 Ga0207644_10053533
306 Ga0207686_10048174
307 Ga0207704_11639239
308 Ga0207667_10009488
309 Ga0207712_10002336
310 Ga0207712_10003285
311 Ga0207712_10711648
312 Ga0207668_10399964
313 Ga0207640_10050509
314 Ga0207640_10091455
315 Ga0207658_10188109
316 Ga0207677_10409739
317 Ga0207677_10825574
318 Ga0207639_10013099
319 Ga0207639_10376087
320 Ga0207639_10580117
321 Ga0207641_10652754
322 Ga0207648_10024478
323 Ga0207648_10798883
324 Ga0207648_10963632
325 Ga0207676_10011174
326 Ga0207676_10666293
327 Ga0207674_10022575
328 Ga0207674_10352211
329 Ga0207674_10383445
330 Ga0207674_10759005
331 Ga0207675_100004640
332 Ga0207675_100047920
333 Ga0207675_100093484
334 Ga0207683_10074212
335 Ga0209995_1036045
336 Ga0209968_1021189
337 Ga0268265_10403534
338 Ga0268265_10532740
339 Ga0268265_11507911
340 Ga0268264_10030851
341 Ga0307516_10142564
342 Ga0307416_100739186
343 Ga0373937_0902043
344 Ga0436365_1798470
345 Ga0439447_078774
346 Ga0451798_0395789
347 Ga0451800_1170976
348 Ga0451807_2568202
349 Ga0450923_009750
350 Ga0466961_0206181
351 Ga0466957_0176973
352 Ga0495638_0046870
353 Ga0495598_0035040
354 Ga0495672_0021433
355 Ga0495672_0026077
356 Ga0495686_0029981
357 Ga0496101_0033227
358 Ga0496102_0379473
359 Ga0496104_1614306
360 Ga0496105_0926994
361 Ga0496114_0090978
362 nmdc:mga0k408_262776_c1
363 nmdc:mga05p37_8275_c1
364 nmdc:mga09592_1022893_c1
365 nmdc:mga09592_44696_c1
366 nmdc:mga09592_764990_c1
367 nmdc:mga0qj67_25551_c1
368 nmdc:mga06r32_37183_c1
369 nmdc:mga08y16_485267_c1
370 Ga0500641_0067727
371 Ga0500650_0517286
372 Ga0500608_331334
373 Ga0500637_0065492
374 Ga0500611_000060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

7

138

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d1r-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein at 2.0 angstrom 0.8461 14 130
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.8232 9 131
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.812 9 131
1nz0-assembly11.cif.gz_B rnase p protein from thermotoga maritima 0.8014 14 129
6d1r-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein at 2.0 angstrom 0.797 14 130
ID Description Score Start End Superfamily
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8461 14 130 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.812 9 131 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.797 14 130 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.779 9 131 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7712 9 134 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A433WCP8-F1-model_v4 deleted 0.9973 57 133
AF-A0A521MKF9-F1-model_v4 Ribonuclease P protein component 0.9917 56 133 GO:0000049
GO:0004526
GO:0008033
AF-A0A1C4F5T9-F1-model_v4 Uncharacterized protein 0.9902 57 136 GO:0000049
GO:0004526
GO:0008033
AF-A0A7G5XHE5-F1-model_v4 Ribonuclease P protein component (EC 3.1.26.5) 0.9867 16 138 GO:0000049
GO:0004526
GO:0008033
AF-A0A069S7W2-F1-model_v4 deleted 0.9867 57 133

Map