F286336

General Info

Members Datasets Scaffolds Average Seq Length
186 158 161 206

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0057589|Ga0395900_0057589_2912_3628
Length 238
Sequence MRGDQETGMSASQNALRQTESEPAAAHESPSRYDYVRDGGAIYARSFAMIRAEADLARWSGAAERVVVRMIHACGMTDLPADVEMSADFAEAGVAALQAGAPILCDVRMVADGVTRARLPADNLVICTLGDPRVPDLAKSLGTTRSAAAMELWREHLPGSVVAVGNAPTALFRLLELLDAGVAPPAAVIGIPVGFVGAAESKEALARDGRVPFVVVHGRRGGSAMTAAAVNALASEVE

Samples

Sample ID Description Type Environment
1 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
5 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
6 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
7 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
8 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
9 2773857925 Microvirga vignae BR3299 Isolate Unclassified
10 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
11 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
14 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
15 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
16 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
17 2902330777 Methylobacterium sp. 2A Isolate Unclassified
18 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
19 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
20 2909042592 Labrys sp. LIt4 Isolate Nodule
21 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
22 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
149 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
150 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
157 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
158 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.56
Metatranscriptomes 0
Isolates 13.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.75
Nodule 3.23
Rhizoplane 4.3
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 14.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1008685 3300003771 Bacteria 5014
2 Ga0055524_1000051 3300003775 Bacteria 146215
3 Ga0070683_100031159 3300005329 Bacteria 4846
4 Ga0070689_100302782 3300005340 Bacteria 1331
5 Ga0070673_100547273 3300005364 Bacteria 1051
6 Ga0070703_10188657 3300005406 Bacteria 801
7 Ga0070708_100908191 3300005445 Bacteria 827
8 Ga0070662_100137894 3300005457 Bacteria 1888
9 Ga0070697_100093180 3300005536 Bacteria 2494
10 Ga0068853_100547330 3300005539 Bacteria 1096
11 Ga0070665_100000949 3300005548 Bacteria 36967
12 Ga0070665_100144434 3300005548 Bacteria 2383
13 Ga0070664_100111960 3300005564 Bacteria 2383
14 Ga0070712_100031496 3300006175 Bacteria 3574
15 Ga0075367_10491848 3300006178 Bacteria 778
16 Ga0075370_10012734 3300006353 Bacteria 4453
17 Ga0075436_100116145 3300006914 Bacteria 1870
18 Ga0105251_10002297 3300009011 Bacteria 15152
19 Ga0105251_10010969 3300009011 Bacteria 5210
20 Ga0105244_10036666 3300009036 Bacteria 2567
21 Ga0105250_10009390 3300009092 Bacteria 4120
22 Ga0105240_10535777 3300009093 Bacteria 1297
23 Ga0105245_10046596 3300009098 Bacteria 3874
24 Ga0105237_10673457 3300009545 Bacteria 1041
25 Ga0105237_10929051 3300009545 Bacteria 877
26 Ga0105238_10781530 3300009551 Bacteria 970
27 Ga0099796_10001652 3300010159 Bacteria 4614
28 Ga0157372_11119035 3300013307 Bacteria 911
29 Ga0182006_1032231 3300015261 Bacteria 2107
30 Ga0213876_10093784 3300021384 Bacteria 1590
31 Ga0213871_10071553 3300021441 Bacteria 981
32 Ga0209565_1024182 3300025263 Bacteria 1239
33 Ga0209673_1022591 3300025273 Bacteria 2166
34 Ga0209675_1000459 3300025291 Bacteria 31303
35 Ga0209564_1000048 3300025295 Bacteria 364806
36 Ga0209256_1000041 3300025299 Bacteria 364827
37 Ga0207426_1095579 3300025302 Bacteria 777
38 Ga0207696_1004845 3300025711 Bacteria 5705
39 Ga0207655_1110895 3300025728 Bacteria 927
40 Ga0207713_1001869 3300025735 Bacteria 16012
41 Ga0207713_1004142 3300025735 Bacteria 9533
42 Ga0207695_10160993 3300025913 Bacteria 2176
43 Ga0207695_10277539 3300025913 Bacteria 1570
44 Ga0207695_10442192 3300025913 Bacteria 1184
45 Ga0207693_10082796 3300025915 Bacteria 2513
46 Ga0207690_10263378 3300025932 Bacteria 1336
47 Ga0207706_10010020 3300025933 Bacteria 8682
48 Ga0207670_10136224 3300025936 Bacteria 1805
49 Ga0207661_11101191 3300025944 Bacteria 731
50 Ga0207679_10029417 3300025945 Bacteria 3825
51 Ga0207702_10086165 3300026078 Bacteria 2739
52 Ga0207641_10990675 3300026088 Bacteria 837
53 Ga0268266_10000275 3300028379 Bacteria 85106
54 Ga0268266_10183066 3300028379 Bacteria 1909
55 Ga0268265_10269910 3300028380 Bacteria 1517
56 Ga0307515_10016726 3300028794 Bacteria 13414
57 Ga0265330_10075965 3300031235 Bacteria 1450
58 Ga0265332_10011852 3300031238 Bacteria 3872
59 Ga0265339_10030962 3300031249 Bacteria 3026
60 Ga0265316_10032140 3300031344 Bacteria 4285
61 Ga0265313_10061203 3300031595 Bacteria 1763
62 Ga0265314_10002092 3300031711 Bacteria 21018
63 Ga0265342_10053775 3300031712 Bacteria 2395
64 Ga0265342_10065179 3300031712 Bacteria 2136
65 Ga0316578_10006190 3300031728 Bacteria 5882
66 Ga0307406_10021990 3300031901 Bacteria 3780
67 Ga0316582_0327202 3300036647 Bacteria 1054
68 Ga0316584_0026324 3300036712 Bacteria 4275
69 Ga0395899_0169319 3300037312 Bacteria 1539
70 Ga0395900_0045220 3300037418 Bacteria 4535
71 Ga0395900_0057589 3300037418 Bacteria 4001
72 Ga0395900_0428141 3300037418 Bacteria 1283
73 Ga0436364_1220295 3300037853 Bacteria 859
74 Ga0436365_0828949 3300039437 Bacteria 1100
75 Ga0436365_1526825 3300039437 Bacteria 1853
76 Ga0436360_0529234 3300039438 Bacteria 1471
77 Ga0436363_1133380 3300039450 Bacteria 852
78 Ga0466960_0180536 3300044901 Bacteria 1144
79 Ga0466967_0148887 3300045976 Bacteria 2186
80 Ga0495653_0078716 3300046463 Bacteria 2444
81 Ga0495653_0310433 3300046463 Bacteria 1026
82 Ga0495664_0193393 3300046477 Bacteria 1233
83 Ga0495606_0000311 3300046507 Bacteria 84114
84 Ga0495620_0000135 3300046515 Bacteria 60578
85 Ga0495628_0002658 3300046516 Bacteria 16009
86 Ga0495632_0000641 3300046519 Bacteria 32057
87 Ga0495643_0000410 3300046522 Bacteria 56258
88 Ga0495643_0001793 3300046522 Bacteria 18375
89 Ga0495642_0004921 3300046528 Bacteria 5150
90 Ga0495652_0185727 3300046529 Bacteria 1591
91 Ga0495654_0113073 3300046530 Bacteria 1237
92 Ga0495645_0351171 3300046543 Bacteria 950
93 Ga0495633_0010147 3300046558 Bacteria 5156
94 Ga0495667_0203779 3300046559 Bacteria 1266
95 Ga0495625_0065103 3300046660 Bacteria 2570
96 Ga0495671_0004776 3300046692 Bacteria 8009
97 Ga0495649_0000487 3300046694 Bacteria 34071
98 Ga0495649_0046701 3300046694 Bacteria 2357
99 Ga0495649_0058889 3300046694 Bacteria 2068
100 Ga0495674_0005904 3300047319 Bacteria 11745
101 Ga0495675_0108830 3300047444 Bacteria 1731
102 Ga0495675_0139342 3300047444 Bacteria 1504
103 Ga0495681_0014630 3300047470 Bacteria 4484
104 Ga0495686_0170397 3300047472 Bacteria 1266
105 Ga0495593_0263515 3300047673 Bacteria 862
106 Ga0496101_0023065 3300048904 Bacteria 4295
107 Ga0496104_0199230 3300048907 Bacteria 1914
108 Ga0496104_0653206 3300048907 Bacteria 961
109 Ga0496106_0109326 3300048909 Bacteria 2151
110 Ga0496107_0103904 3300048910 Bacteria 2085
111 Ga0496107_0832976 3300048910 Bacteria 674
112 Ga0496110_0211687 3300048913 Bacteria 1762
113 Ga0496112_0178793 3300048915 Bacteria 2085
114 Ga0496121_0053316 3300048924 Bacteria 3389
115 Ga0496121_0111331 3300048924 Bacteria 2088
116 Ga0496121_0327923 3300048924 Bacteria 1028
117 Ga0496124_0002578 3300048927 Bacteria 23487
118 Ga0496126_0007707 3300048929 Bacteria 11751
119 Ga0496126_0130265 3300048929 Bacteria 2174
120 Ga0496126_0197969 3300048929 Bacteria 1698
121 Ga0495678_029450 3300049459 Bacteria 2305
122 Ga0501031_0013719 3300049568 Bacteria 5280
123 Ga0501032_0000031 3300049569 Bacteria 130204
124 Ga0501033_0000305 3300049570 Bacteria 46466
125 Ga0501034_0000064 3300049571 Bacteria 189461
126 Ga0501034_0067217 3300049571 Bacteria 3598
127 Ga0501034_0199124 3300049571 Bacteria 1962
128 Ga0501036_0000632 3300049572 Bacteria 25687
129 Ga0501037_0000132 3300049573 Bacteria 69775
130 Ga0501037_0125689 3300049573 Bacteria 1841
131 Ga0501038_0000055 3300049574 Bacteria 93761
132 Ga0501039_0000045 3300049575 Bacteria 104513
133 Ga0501041_0169032 3300049577 Bacteria 1368
134 Ga0501042_0132281 3300049578 Bacteria 1798
135 Ga0501043_0000015 3300049579 Bacteria 175932
136 Ga0501046_0014616 3300049580 Bacteria 6614
137 Ga0501046_0230118 3300049580 Bacteria 1370
138 Ga0501047_0092597 3300049581 Bacteria 2901
139 Ga0501047_0303919 3300049581 Bacteria 1437
140 Ga0501068_0185034 3300049584 Bacteria 1318
141 Ga0501079_0029662 3300049741 Bacteria 4202
142 Ga0501083_0072235 3300049744 Bacteria 2294
143 Ga0501263_003056 3300049760 Bacteria 1759
144 Ga0501035_0000105 3300049822 Bacteria 104877
145 Ga0501044_0008070 3300049823 Bacteria 11564
146 Ga0501045_0173914 3300049824 Bacteria 1604
147 nmdc:mga03n38_490562_c1 3300050490 Bacteria 688
148 nmdc:mga0yw44_508625_c1 3300050492 Bacteria 817
149 nmdc:mga0sz30_292525_c1 3300050516 Bacteria 726
150 Ga0495595_0061815 3300053084 Bacteria 1755
151 Ga0495619_0294114 3300053085 Bacteria 1125
152 Ga0500556_0000229 3300053104 Bacteria 45380
153 Ga0500595_073638 3300053119 Bacteria 1009
154 Ga0500597_137339 3300053120 Bacteria 1054
155 Ga0500564_032263 3300053138 Bacteria 2415
156 Ga0500624_000023 3300053157 Bacteria 114997
157 Ga0500637_0000148 3300053178 Bacteria 25368
158 Ga0500645_026816 3300053730 Bacteria 1751
159 Ga0501084_0004692 3300054114 Bacteria 11162
160 Ga0501084_0264551 3300054114 Bacteria 1452
161 Ga0501082_0527178 3300060353 Bacteria 1033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100116145 Ga0075436_1001161453 190
2 3300009011 Ga0105251_10002297 Ga0105251_1000229711 190
3 3300009011 Ga0105251_10010969 Ga0105251_100109695 190
4 3300009092 Ga0105250_10009390 Ga0105250_100093905 190
5 3300025711 Ga0207696_1004845 Ga0207696_10048455 190
6 3300025735 Ga0207713_1001869 Ga0207713_10018696 190
7 3300025735 Ga0207713_1004142 Ga0207713_10041425 190
8 3300046515 Ga0495620_0000135 Ga0495620_0000135_24957_25583 190
9 3300046519 Ga0495632_0000641 Ga0495632_0000641_20973_21599 190
10 3300046522 Ga0495643_0000410 Ga0495643_0000410_21209_21835 190
11 3300048913 Ga0496110_0211687 Ga0496110_0211687_1115_1741 190
12 3300048927 Ga0496124_0002578 Ga0496124_0002578_6655_7281 190
13 3300049580 Ga0501046_0230118 Ga0501046_0230118_212_844 192
14 3300049741 Ga0501079_0029662 Ga0501079_0029662_735_1367 192
15 3300054114 Ga0501084_0264551 Ga0501084_0264551_287_919 192
16 3300046529 Ga0495652_0185727 Ga0495652_0185727_433_1017 193
17 3300009545 Ga0105237_10673457 Ga0105237_106734572 195
18 3300021384 Ga0213876_10093784 Ga0213876_100937842 195
19 3300039437 Ga0436365_1526825 Ga0436365_1526825_725_1354 195
20 3300049568 Ga0501031_0013719 Ga0501031_0013719_681_1316 195
21 3300049569 Ga0501032_0000031 Ga0501032_0000031_108956_109591 195
22 3300049570 Ga0501033_0000305 Ga0501033_0000305_7078_7713 195
23 3300049571 Ga0501034_0000064 Ga0501034_0000064_79871_80506 195
24 3300049572 Ga0501036_0000632 Ga0501036_0000632_21182_21817 195
25 3300049573 Ga0501037_0000132 Ga0501037_0000132_15741_16376 195
26 3300049574 Ga0501038_0000055 Ga0501038_0000055_54830_55465 195
27 3300049575 Ga0501039_0000045 Ga0501039_0000045_81827_82462 195
28 3300049577 Ga0501041_0169032 Ga0501041_0169032_22_657 195
29 3300049578 Ga0501042_0132281 Ga0501042_0132281_724_1359 195
30 3300049579 Ga0501043_0000015 Ga0501043_0000015_128677_129312 195
31 3300049580 Ga0501046_0014616 Ga0501046_0014616_3845_4480 195
32 3300049581 Ga0501047_0303919 Ga0501047_0303919_204_839 195
33 3300049822 Ga0501035_0000105 Ga0501035_0000105_24389_25024 195
34 3300049823 Ga0501044_0008070 Ga0501044_0008070_701_1336 195
35 3300049824 Ga0501045_0173914 Ga0501045_0173914_722_1357 195
36 3300046558 Ga0495633_0010147 Ga0495633_0010147_2744_3373 198
37 3300048924 Ga0496121_0327923 Ga0496121_0327923_41_670 198
38 3300049584 Ga0501068_0185034 Ga0501068_0185034_624_1229 200
39 3300048907 Ga0496104_0199230 Ga0496104_0199230_303_911 201
40 iso_pu_bacteria 2513237151 2513958908 203
41 iso_pu_bacteria 2738543020 2739286019 203
42 iso_pu_bacteria 2738543021 2739291332 203
43 iso_pu_bacteria 2773857672 2774131559 203
44 iso_pu_bacteria 2811994881 2812368984 203
45 iso_pu_bacteria 2904434214 2904434300 203
46 iso_pu_bacteria 2923519811 2923523063 203
47 iso_pu_bacteria 8055266321 8055269730 203
48 iso_pu_bacteria 8055301274 8055305952 203
49 iso_pu_bacteria 2835312727 2835315382 205
50 iso_pu_bacteria 2909042592 2909042687 205
51 3300005329 Ga0070683_100031159 Ga0070683_1000311592 206
52 3300005340 Ga0070689_100302782 Ga0070689_1003027822 206
53 3300005364 Ga0070673_100547273 Ga0070673_1005472731 206
54 3300005406 Ga0070703_10188657 Ga0070703_101886571 206
55 3300005457 Ga0070662_100137894 Ga0070662_1001378942 206
56 3300005548 Ga0070665_100144434 Ga0070665_1001444343 206
57 3300005564 Ga0070664_100111960 Ga0070664_1001119602 206
58 3300006175 Ga0070712_100031496 Ga0070712_1000314964 206
59 3300009098 Ga0105245_10046596 Ga0105245_100465964 206
60 3300009545 Ga0105237_10929051 Ga0105237_109290511 206
61 3300025915 Ga0207693_10082796 Ga0207693_100827962 206
62 3300025932 Ga0207690_10263378 Ga0207690_102633782 206
63 3300025933 Ga0207706_10010020 Ga0207706_100100208 206
64 3300025936 Ga0207670_10136224 Ga0207670_101362242 206
65 3300025944 Ga0207661_11101191 Ga0207661_111011912 206
66 3300025945 Ga0207679_10029417 Ga0207679_100294174 206
67 3300026078 Ga0207702_10086165 Ga0207702_100861652 206
68 3300026088 Ga0207641_10990675 Ga0207641_109906751 206
69 3300028379 Ga0268266_10183066 Ga0268266_101830662 206
70 3300028380 Ga0268265_10269910 Ga0268265_102699102 206
71 3300045976 Ga0466967_0148887 Ga0466967_0148887_508_1128 206
72 3300048904 Ga0496101_0023065 Ga0496101_0023065_222_842 206
73 3300048915 Ga0496112_0178793 Ga0496112_0178793_1241_1861 206
74 iso_pu_bacteria 2643221734 2644736365 206
75 iso_pu_bacteria 2738541281 2738744514 206
76 iso_pu_bacteria 2738543032 2739353744 206
77 iso_pu_bacteria 2773857925 2774871289 206
78 iso_pu_bacteria 2829745981 2829746676 206
79 iso_pu_bacteria 2842698319 2842700974 206
80 iso_pu_bacteria 2861691609 2861695516 206
81 iso_pu_bacteria 2882456835 2882462438 206
82 iso_pu_bacteria 643348564 643599889 206
83 3300009036 Ga0105244_10036666 Ga0105244_100366662 207
84 3300013307 Ga0157372_11119035 Ga0157372_111190352 207
85 3300015261 Ga0182006_1032231 Ga0182006_10322312 207
86 3300025728 Ga0207655_1110895 Ga0207655_11108951 207
87 3300031728 Ga0316578_10006190 Ga0316578_100061904 207
88 3300036647 Ga0316582_0327202 Ga0316582_0327202_207_863 207
89 3300036712 Ga0316584_0026324 Ga0316584_0026324_1978_2634 207
90 3300046477 Ga0495664_0193393 Ga0495664_0193393_68_694 207
91 3300046507 Ga0495606_0000311 Ga0495606_0000311_42425_43051 207
92 3300046516 Ga0495628_0002658 Ga0495628_0002658_14115_14741 207
93 3300046522 Ga0495643_0001793 Ga0495643_0001793_13081_13707 207
94 3300046528 Ga0495642_0004921 Ga0495642_0004921_4062_4688 207
95 3300046530 Ga0495654_0113073 Ga0495654_0113073_202_828 207
96 3300046543 Ga0495645_0351171 Ga0495645_0351171_261_887 207
97 3300046660 Ga0495625_0065103 Ga0495625_0065103_1446_2072 207
98 3300046692 Ga0495671_0004776 Ga0495671_0004776_4683_5309 207
99 3300046694 Ga0495649_0000487 Ga0495649_0000487_10351_10977 207
100 3300046694 Ga0495649_0046701 Ga0495649_0046701_377_1003 207
101 3300046694 Ga0495649_0058889 Ga0495649_0058889_1355_1981 207
102 3300047319 Ga0495674_0005904 Ga0495674_0005904_8508_9134 207
103 3300047470 Ga0495681_0014630 Ga0495681_0014630_826_1452 207
104 3300047472 Ga0495686_0170397 Ga0495686_0170397_93_719 207
105 3300048910 Ga0496107_0832976 Ga0496107_0832976_18_644 207
106 3300048924 Ga0496121_0053316 Ga0496121_0053316_1074_1700 207
107 3300048924 Ga0496121_0111331 Ga0496121_0111331_1260_1886 207
108 3300049459 Ga0495678_029450 Ga0495678_029450_893_1519 207
109 3300049571 Ga0501034_0067217 Ga0501034_0067217_1683_2309 207
110 3300049573 Ga0501037_0125689 Ga0501037_0125689_806_1432 207
111 3300053138 Ga0500564_032263 Ga0500564_032263_1593_2219 207
112 3300010159 Ga0099796_10001652 Ga0099796_100016522 208
113 3300031235 Ga0265330_10075965 Ga0265330_100759652 208
114 3300031238 Ga0265332_10011852 Ga0265332_100118522 208
115 3300031249 Ga0265339_10030962 Ga0265339_100309623 208
116 3300031344 Ga0265316_10032140 Ga0265316_100321402 208
117 3300031595 Ga0265313_10061203 Ga0265313_100612032 208
118 3300031711 Ga0265314_10002092 Ga0265314_100020923 208
119 3300031712 Ga0265342_10053775 Ga0265342_100537752 208
120 3300031712 Ga0265342_10065179 Ga0265342_100651792 208
121 3300037418 Ga0395900_0045220 Ga0395900_0045220_3789_4418 208
122 3300037418 Ga0395900_0428141 Ga0395900_0428141_459_1088 208
123 3300039437 Ga0436365_0828949 Ga0436365_0828949_407_1036 208
124 3300039450 Ga0436363_1133380 Ga0436363_1133380_188_817 208
125 3300048929 Ga0496126_0007707 Ga0496126_0007707_6123_6752 208
126 3300048929 Ga0496126_0130265 Ga0496126_0130265_192_821 208
127 3300049571 Ga0501034_0199124 Ga0501034_0199124_711_1340 208
128 3300005539 Ga0068853_100547330 Ga0068853_1005473302 209
129 3300006178 Ga0075367_10491848 Ga0075367_104918481 209
130 3300006353 Ga0075370_10012734 Ga0075370_100127344 209
131 3300009551 Ga0105238_10781530 Ga0105238_107815302 209
132 3300021441 Ga0213871_10071553 Ga0213871_100715532 209
133 3300025913 Ga0207695_10277539 Ga0207695_102775392 209
134 3300039438 Ga0436360_0529234 Ga0436360_0529234_254_883 209
135 3300046463 Ga0495653_0078716 Ga0495653_0078716_1227_1859 209
136 3300047444 Ga0495675_0139342 Ga0495675_0139342_534_1166 209
137 3300047673 Ga0495593_0263515 Ga0495593_0263515_20_652 209
138 3300050490 nmdc:mga03n38_490562_c1 nmdc:mga03n38_490562_c1_31_660 209
139 3300050492 nmdc:mga0yw44_508625_c1 nmdc:mga0yw44_508625_c1_26_658 209
140 3300050516 nmdc:mga0sz30_292525_c1 nmdc:mga0sz30_292525_c1_79_708 209
141 3300003771 Ga0055526_1008685 Ga0055526_10086853 210
142 3300003775 Ga0055524_1000051 Ga0055524_100005186 210
143 3300005445 Ga0070708_100908191 Ga0070708_1009081911 210
144 3300005536 Ga0070697_100093180 Ga0070697_1000931802 210
145 3300005548 Ga0070665_100000949 Ga0070665_10000094925 210
146 3300009093 Ga0105240_10535777 Ga0105240_105357772 210
147 3300025263 Ga0209565_1024182 Ga0209565_10241822 210
148 3300025273 Ga0209673_1022591 Ga0209673_10225912 210
149 3300025291 Ga0209675_1000459 Ga0209675_100045921 210
150 3300025295 Ga0209564_1000048 Ga0209564_1000048178 210
151 3300025299 Ga0209256_1000041 Ga0209256_1000041178 210
152 3300025302 Ga0207426_1095579 Ga0207426_10955791 210
153 3300025913 Ga0207695_10160993 Ga0207695_101609932 210
154 3300025913 Ga0207695_10442192 Ga0207695_104421922 210
155 3300028379 Ga0268266_10000275 Ga0268266_1000027562 210
156 3300028794 Ga0307515_10016726 Ga0307515_100167263 210
157 3300031901 Ga0307406_10021990 Ga0307406_100219903 210
158 3300037312 Ga0395899_0169319 Ga0395899_0169319_416_1048 210
159 3300037418 Ga0395900_0057589 Ga0395900_0057589_2912_3628 210
160 3300037853 Ga0436364_1220295 Ga0436364_1220295_185_817 210
161 3300044901 Ga0466960_0180536 Ga0466960_0180536_76_768 210
162 3300046463 Ga0495653_0310433 Ga0495653_0310433_306_938 210
163 3300046559 Ga0495667_0203779 Ga0495667_0203779_377_1009 210
164 3300047444 Ga0495675_0108830 Ga0495675_0108830_573_1205 210
165 3300048907 Ga0496104_0653206 Ga0496104_0653206_141_773 210
166 3300048909 Ga0496106_0109326 Ga0496106_0109326_209_844 210
167 3300048910 Ga0496107_0103904 Ga0496107_0103904_883_1518 210
168 3300048929 Ga0496126_0197969 Ga0496126_0197969_494_1126 210
169 3300049581 Ga0501047_0092597 Ga0501047_0092597_1172_1804 210
170 3300049744 Ga0501083_0072235 Ga0501083_0072235_957_1589 210
171 3300049760 Ga0501263_003056 Ga0501263_003056_479_1117 210
172 3300053084 Ga0495595_0061815 Ga0495595_0061815_830_1462 210
173 3300053085 Ga0495619_0294114 Ga0495619_0294114_177_809 210
174 3300053104 Ga0500556_0000229 Ga0500556_0000229_33083_33715 210
175 3300053119 Ga0500595_073638 Ga0500595_073638_91_723 210
176 3300053120 Ga0500597_137339 Ga0500597_137339_334_972 210
177 3300053157 Ga0500624_000023 Ga0500624_000023_100974_101612 210
178 3300053178 Ga0500637_0000148 Ga0500637_0000148_11352_11990 210
179 3300053730 Ga0500645_026816 Ga0500645_026816_521_1153 210
180 3300054114 Ga0501084_0004692 Ga0501084_0004692_8336_8968 210
181 3300060353 Ga0501082_0527178 Ga0501082_0527178_184_816 210
182 iso_pu_bacteria 2595698237 2596371974 210
183 iso_pu_bacteria 2889306138 2889310755 210
184 iso_pu_bacteria 2902330777 2902333735 210
185 iso_pu_bacteria 2902405164 2902406333 210
186 iso_pu_bacteria 2928125067 2928129028 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02570

CbiC

Precorrin-8X methylmutase

41

236

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9889 5 210
5n0g-assembly1.cif.gz_A-2 crystal structure of cobh t85a (precorrin-8x methyl mutase) complexed with c5 allyl-hba 0.9877 5 210
1f2v-assembly1.cif.gz_A crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis 0.9851 5 207
3e7d-assembly1.cif.gz_A crystal structure of precorrin-8x methyl mutase cbic/cobh from brucella melitensis 0.9805 7 207
4au1-assembly1.cif.gz_A crystal structure of cobh (precorrin-8x methyl mutase) complexed with c5 desmethyl-hba 0.9748 5 210
ID Description Score Start End Superfamily
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9849 7 209 3.40.50.10230
3e7dD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9754 7 209 3.40.50.10230
2afvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9309 5 205 3.40.50.10230
1v9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9106 13 205 3.40.50.10230
af_Q58340_4_210_3.40.50.10230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin biosynthesis CobH/CbiC, precorrin-8X methylmutase 0.9099 7 205 3.40.50.10230
ID Description Score Start End GO Terms
AF-A0A6G3X8A9-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 0.999 63 179 GO:0009236
GO:0016993
AF-A0A564FVM0-F1-model_v4 Precorrin-8X methylmutase (EC 5.4.99.61) 0.9965 1 210 GO:0009236
GO:0016993
AF-A0A511DQT6-F1-model_v4 Precorrin-8X methylmutase 0.9955 43 210 GO:0009236
GO:0016993
AF-A0A259BLJ3-F1-model_v4 Precorrin-8X methylmutase 0.9948 56 207 GO:0009236
GO:0016993
AF-A0A1M6YI70-F1-model_v4 Precorrin-8X methylmutase 0.9933 5 209 GO:0009236
GO:0016993

Feature Viewer

pLDDT pTM Quality
95.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map