F286071

General Info

Members Datasets Scaffolds Average Seq Length
186 126 372 257

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10235287|Ga0213876_102352871
Length 285
Sequence MGYDLAGRKVLVTGGSAGIGAALAEGFAARGATVGICGRRTDRLAEVLERLQAHAPGSRSWAVDLADLDAVDDFAARADEELGGIDVLVNNAGIPKRRWAWELTPDVVEQVMAINYLSPVRLTLALLPALVARSGRIVTISSVAARLSPPAESAYSASKAALTAFFEGLAVDLAVAKVDVGVHVVNPGVIDTELFSLPDNDESLADVEALPVTAMVEPVVAMLDAGTFEIYVPDWFTGVVPAKFPDTGAFLQGSADYARQRLVDLGRPTPAPTVAAQAPTGPGGR

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
91 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
123 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
124 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 11.29
Rhizosphere 83.87
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10235287 3300021384 Bacteria 973
2 Ga0070683_100625892 3300005329 Bacteria 1030
3 Ga0070670_100241969 3300005331 Bacteria 1571
4 Ga0068868_100343780 3300005338 Bacteria 1276
5 Ga0070709_10090030 3300005434 Bacteria 2022
6 Ga0070713_100292859 3300005436 Bacteria 1496
7 Ga0070711_100451263 3300005439 Bacteria 1053
8 Ga0070705_100094594 3300005440 Bacteria 1871
9 Ga0070700_100335147 3300005441 Bacteria 1116
10 Ga0070706_100035402 3300005467 Bacteria 4611
11 Ga0070706_100054694 3300005467 Bacteria 3684
12 Ga0070707_100051129 3300005468 Bacteria 3961
13 Ga0070707_100175988 3300005468 Bacteria 2085
14 Ga0070698_100028486 3300005471 Bacteria 5801
15 Ga0070699_100020184 3300005518 Bacteria 5743
16 Ga0070672_100010273 3300005543 Bacteria 6489
17 Ga0070672_100107165 3300005543 Bacteria 2274
18 Ga0070695_100125969 3300005545 Bacteria 1759
19 Ga0070693_100293295 3300005547 Bacteria 1093
20 Ga0070704_100092512 3300005549 Bacteria 2258
21 Ga0068864_100600378 3300005618 Bacteria 1068
22 Ga0081455_10064686 3300005937 Bacteria 3061
23 Ga0081455_10296564 3300005937 Bacteria 1162
24 Ga0075364_10027859 3300006051 Bacteria 3612
25 Ga0070712_100042039 3300006175 Bacteria 3142
26 Ga0075428_100027624 3300006844 Bacteria 6277
27 Ga0075428_100067575 3300006844 Bacteria 3911
28 Ga0075428_100253311 3300006844 Bacteria 1897
29 Ga0075431_100012559 3300006847 Bacteria 8548
30 Ga0075433_10017638 3300006852 Bacteria 5919
31 Ga0075434_100079698 3300006871 Bacteria 3271
32 Ga0075429_100054003 3300006880 Bacteria 3495
33 Ga0075436_100013397 3300006914 Bacteria 5616
34 Ga0105240_10701509 3300009093 Bacteria 1105
35 Ga0105245_10662269 3300009098 Bacteria 1075
36 Ga0105245_10936598 3300009098 Bacteria 909
37 Ga0114129_10039180 3300009147 Bacteria 6682
38 Ga0114129_10128654 3300009147 Bacteria 3480
39 Ga0114129_10129415 3300009147 Bacteria 3469
40 Ga0105243_10394825 3300009148 Bacteria 1283
41 Ga0105242_10046033 3300009176 Bacteria 3538
42 Ga0105242_10409443 3300009176 Bacteria 1268
43 Ga0105248_10433654 3300009177 Bacteria 1480
44 Ga0105237_10418587 3300009545 Bacteria 1345
45 Ga0105249_10311289 3300009553 Bacteria 1583
46 Ga0105249_10380331 3300009553 Bacteria 1438
47 Ga0105246_10110193 3300011119 Bacteria 2021
48 Ga0105246_10206020 3300011119 Bacteria 1532
49 Ga0105246_10307129 3300011119 Bacteria 1283
50 Ga0157375_10313771 3300013308 Bacteria 1732
51 Ga0157375_10917118 3300013308 Bacteria 1019
52 Ga0163163_10827621 3300014325 Bacteria 989
53 Ga0157379_10480950 3300014968 Bacteria 1149
54 Ga0157376_10740845 3300014969 Bacteria 991
55 Ga0207645_10046904 3300025907 Bacteria 2760
56 Ga0207684_10056534 3300025910 Bacteria 3328
57 Ga0207693_10083965 3300025915 Bacteria 2495
58 Ga0207663_10310249 3300025916 Bacteria 1182
59 Ga0207646_10019816 3300025922 Bacteria 6244
60 Ga0207646_10079730 3300025922 Bacteria 2927
61 Ga0207646_10161154 3300025922 Bacteria 2024
62 Ga0207650_10185450 3300025925 Bacteria 1660
63 Ga0207687_10215844 3300025927 Bacteria 1507
64 Ga0207687_10290303 3300025927 Bacteria 1314
65 Ga0207700_10164824 3300025928 Bacteria 1843
66 Ga0207700_10400784 3300025928 Bacteria 1202
67 Ga0207669_10201607 3300025937 Bacteria 1445
68 Ga0207669_10379762 3300025937 Bacteria 1101
69 Ga0207691_10123384 3300025940 Bacteria 2293
70 Ga0207661_10476274 3300025944 Bacteria 1139
71 Ga0207712_10300455 3300025961 Bacteria 1317
72 Ga0207677_10244021 3300026023 Bacteria 1455
73 Ga0207708_10225105 3300026075 Bacteria 1504
74 Ga0207702_10591085 3300026078 Bacteria 1089
75 Ga0207676_10216766 3300026095 Bacteria 1702
76 Ga0207683_10061224 3300026121 Bacteria 3312
77 Ga0207683_10291062 3300026121 Bacteria 1493
78 Ga0207683_10418561 3300026121 Bacteria 1234
79 Ga0265338_10000733 3300028800 Bacteria 56014
80 Ga0265338_10439959 3300028800 Bacteria 924
81 Ga0265325_10003258 3300031241 Bacteria 10680
82 Ga0265327_10004417 3300031251 Bacteria 12464
83 Ga0265327_10016070 3300031251 Bacteria 4781
84 Ga0265316_10373510 3300031344 Bacteria 1029
85 Ga0265313_10002378 3300031595 Bacteria 16338
86 Ga0265314_10041091 3300031711 Bacteria 3313
87 Ga0373931_0050458 3300035691 Bacteria 2214
88 Ga0373931_0369251 3300035691 Unclassified 902
89 Ga0373937_0530219 3300036401 Bacteria 1119
90 Ga0373937_0790840 3300036401 Bacteria 896
91 Ga0395898_0851641 3300037466 Bacteria 851
92 Ga0436365_0145029 3300039437 Bacteria 9702
93 Ga0436365_1325032 3300039437 Bacteria 1759
94 Ga0436365_1790441 3300039437 Bacteria 1856
95 Ga0436363_1055121 3300039450 Bacteria 1796
96 Ga0466967_0945757 3300045976 Bacteria 857
97 Ga0495651_0274420 3300046462 Bacteria 1142
98 Ga0495639_0123526 3300046475 Bacteria 1236
99 Ga0495662_0119240 3300046476 Bacteria 1295
100 Ga0495608_0233200 3300046511 Bacteria 1152
101 Ga0495608_0345719 3300046511 Bacteria 916
102 Ga0495630_0024550 3300046517 Bacteria 4456
103 Ga0495630_0039838 3300046517 Bacteria 3512
104 Ga0495640_0530500 3300046533 Bacteria 715
105 Ga0495635_0196525 3300046663 Bacteria 1369
106 Ga0495657_0235518 3300046675 Bacteria 1106
107 Ga0495658_0090748 3300046683 Bacteria 1809
108 Ga0495658_0110304 3300046683 Bacteria 1654
109 Ga0495658_0223412 3300046683 Bacteria 1180
110 Ga0495658_0314498 3300046683 Bacteria 992
111 Ga0495672_0132179 3300047320 Bacteria 1312
112 Ga0495602_0073437 3300048088 Bacteria 2912
113 Ga0495614_0127673 3300048089 Bacteria 1124
114 Ga0496100_0041572 3300048903 Bacteria 2931
115 Ga0496102_0037701 3300048905 Bacteria 4362
116 Ga0496102_0206529 3300048905 Bacteria 1852
117 Ga0496104_0047961 3300048907 Bacteria 4027
118 Ga0496104_0096336 3300048907 Bacteria 2831
119 Ga0496104_0408453 3300048907 Bacteria 1270
120 Ga0496104_0632771 3300048907 Bacteria 979
121 Ga0496105_0018131 3300048908 Bacteria 5651
122 Ga0496108_0048768 3300048911 Bacteria 3541
123 Ga0496108_0216902 3300048911 Bacteria 1662
124 Ga0496109_0402091 3300048912 Bacteria 1294
125 Ga0496109_0438036 3300048912 Bacteria 1235
126 Ga0496110_0240477 3300048913 Bacteria 1647
127 Ga0496111_0265776 3300048914 Bacteria 1273
128 Ga0496112_0000952 3300048915 Bacteria 21041
129 Ga0496112_0070680 3300048915 Bacteria 3450
130 Ga0496112_0105338 3300048915 Bacteria 2790
131 Ga0496113_0124107 3300048916 Unclassified 2021
132 Ga0496113_0279468 3300048916 Bacteria 1335
133 Ga0496114_0170966 3300048917 Bacteria 1894
134 Ga0496115_0022605 3300048918 Bacteria 4875
135 Ga0496126_0000611 3300048929 Bacteria 67506
136 Ga0501034_0011713 3300049571 Bacteria 9071
137 Ga0501034_0036620 3300049571 Bacteria 4969
138 Ga0501036_0124629 3300049572 Bacteria 2176
139 Ga0501037_0005115 3300049573 Bacteria 9538
140 Ga0501037_0141419 3300049573 Bacteria 1722
141 Ga0501038_0318416 3300049574 Bacteria 1217
142 Ga0501042_0402381 3300049578 Bacteria 992
143 Ga0501046_0013986 3300049580 Bacteria 6779
144 Ga0501047_0055818 3300049581 Bacteria 3819
145 Ga0501068_0153839 3300049584 Bacteria 1447
146 Ga0501070_0007781 3300049586 Bacteria 9084
147 Ga0501071_0010128 3300049587 Bacteria 6306
148 Ga0501072_0028294 3300049588 Bacteria 4376
149 Ga0501072_0063932 3300049588 Bacteria 2902
150 Ga0501073_0015839 3300049589 Bacteria 5463
151 Ga0501073_0269836 3300049589 Bacteria 1174
152 Ga0501074_0152914 3300049590 Bacteria 1649
153 Ga0501074_0215317 3300049590 Bacteria 1368
154 Ga0501074_0540631 3300049590 Bacteria 825
155 Ga0501076_0236103 3300049592 Bacteria 1495
156 Ga0501079_0004281 3300049741 Bacteria 10588
157 Ga0501079_0500142 3300049741 Bacteria 956
158 Ga0501080_0009818 3300049742 Bacteria 8746
159 Ga0501080_0070594 3300049742 Bacteria 3248
160 Ga0501080_0575026 3300049742 Bacteria 1002
161 Ga0501083_0000207 3300049744 Bacteria 38121
162 Ga0501035_0306785 3300049822 Bacteria 1336
163 nmdc:mga05p37_34295_c1 3300050507 Bacteria 6216
164 nmdc:mga05p37_368312_c1 3300050507 Bacteria 1687
165 nmdc:mga09592_4842_c1 3300050508 Bacteria 10901
166 nmdc:mga0qj67_47806_c1 3300050509 Bacteria 3380
167 nmdc:mga06r32_5196_c1 3300050510 Bacteria 11698
168 nmdc:mga06r32_737540_c1 3300050510 Bacteria 949
169 nmdc:mga0n895_21834_c1 3300050512 Bacteria 5993
170 nmdc:mga0n895_256583_c1 3300050512 Bacteria 1774
171 nmdc:mga0rr50_619699_c1 3300050513 Bacteria 923
172 nmdc:mga0a205_4625_c1 3300050515 Bacteria 7811
173 Ga0495612_0067676 3300053078 Bacteria 1486
174 Ga0495595_0057407 3300053084 Bacteria 1816
175 Ga0495595_0139113 3300053084 Bacteria 1190
176 Ga0495595_0187668 3300053084 Bacteria 1027
177 Ga0495619_0080565 3300053085 Bacteria 2191
178 Ga0495619_0135653 3300053085 Bacteria 1693
179 Ga0495619_0422923 3300053085 Bacteria 919
180 Ga0500568_0000013 3300053139 Bacteria 224760
181 Ga0500616_0005364 3300053153 Bacteria 8728
182 Ga0501084_0000082 3300054114 Bacteria 69523
183 Ga0501084_0000208 3300054114 Bacteria 45672
184 Ga0501084_0064935 3300054114 Bacteria 3054
185 Ga0501084_0139828 3300054114 Bacteria 2039
186 Ga0501082_0206553 3300060353 Bacteria 1709
187 Ga0213876_10235287
188 Ga0070683_100625892
189 Ga0070670_100241969
190 Ga0068868_100343780
191 Ga0070709_10090030
192 Ga0070713_100292859
193 Ga0070711_100451263
194 Ga0070705_100094594
195 Ga0070700_100335147
196 Ga0070706_100035402
197 Ga0070706_100054694
198 Ga0070707_100051129
199 Ga0070707_100175988
200 Ga0070698_100028486
201 Ga0070699_100020184
202 Ga0070672_100010273
203 Ga0070672_100107165
204 Ga0070695_100125969
205 Ga0070693_100293295
206 Ga0070704_100092512
207 Ga0068864_100600378
208 Ga0081455_10064686
209 Ga0081455_10296564
210 Ga0075364_10027859
211 Ga0070712_100042039
212 Ga0075428_100027624
213 Ga0075428_100067575
214 Ga0075428_100253311
215 Ga0075431_100012559
216 Ga0075433_10017638
217 Ga0075434_100079698
218 Ga0075429_100054003
219 Ga0075436_100013397
220 Ga0105240_10701509
221 Ga0105245_10662269
222 Ga0105245_10936598
223 Ga0114129_10039180
224 Ga0114129_10128654
225 Ga0114129_10129415
226 Ga0105243_10394825
227 Ga0105242_10046033
228 Ga0105242_10409443
229 Ga0105248_10433654
230 Ga0105237_10418587
231 Ga0105249_10311289
232 Ga0105249_10380331
233 Ga0105246_10110193
234 Ga0105246_10206020
235 Ga0105246_10307129
236 Ga0157375_10313771
237 Ga0157375_10917118
238 Ga0163163_10827621
239 Ga0157379_10480950
240 Ga0157376_10740845
241 Ga0207645_10046904
242 Ga0207684_10056534
243 Ga0207693_10083965
244 Ga0207663_10310249
245 Ga0207646_10019816
246 Ga0207646_10079730
247 Ga0207646_10161154
248 Ga0207650_10185450
249 Ga0207687_10215844
250 Ga0207687_10290303
251 Ga0207700_10164824
252 Ga0207700_10400784
253 Ga0207669_10201607
254 Ga0207669_10379762
255 Ga0207691_10123384
256 Ga0207661_10476274
257 Ga0207712_10300455
258 Ga0207677_10244021
259 Ga0207708_10225105
260 Ga0207702_10591085
261 Ga0207676_10216766
262 Ga0207683_10061224
263 Ga0207683_10291062
264 Ga0207683_10418561
265 Ga0265338_10000733
266 Ga0265338_10439959
267 Ga0265325_10003258
268 Ga0265327_10004417
269 Ga0265327_10016070
270 Ga0265316_10373510
271 Ga0265313_10002378
272 Ga0265314_10041091
273 Ga0373931_0050458
274 Ga0373931_0369251
275 Ga0373937_0530219
276 Ga0373937_0790840
277 Ga0395898_0851641
278 Ga0436365_0145029
279 Ga0436365_1325032
280 Ga0436365_1790441
281 Ga0436363_1055121
282 Ga0466967_0945757
283 Ga0495651_0274420
284 Ga0495639_0123526
285 Ga0495662_0119240
286 Ga0495608_0233200
287 Ga0495608_0345719
288 Ga0495630_0024550
289 Ga0495630_0039838
290 Ga0495640_0530500
291 Ga0495635_0196525
292 Ga0495657_0235518
293 Ga0495658_0090748
294 Ga0495658_0110304
295 Ga0495658_0223412
296 Ga0495658_0314498
297 Ga0495672_0132179
298 Ga0495602_0073437
299 Ga0495614_0127673
300 Ga0496100_0041572
301 Ga0496102_0037701
302 Ga0496102_0206529
303 Ga0496104_0047961
304 Ga0496104_0096336
305 Ga0496104_0408453
306 Ga0496104_0632771
307 Ga0496105_0018131
308 Ga0496108_0048768
309 Ga0496108_0216902
310 Ga0496109_0402091
311 Ga0496109_0438036
312 Ga0496110_0240477
313 Ga0496111_0265776
314 Ga0496112_0000952
315 Ga0496112_0070680
316 Ga0496112_0105338
317 Ga0496113_0124107
318 Ga0496113_0279468
319 Ga0496114_0170966
320 Ga0496115_0022605
321 Ga0496126_0000611
322 Ga0501034_0011713
323 Ga0501034_0036620
324 Ga0501036_0124629
325 Ga0501037_0005115
326 Ga0501037_0141419
327 Ga0501038_0318416
328 Ga0501042_0402381
329 Ga0501046_0013986
330 Ga0501047_0055818
331 Ga0501068_0153839
332 Ga0501070_0007781
333 Ga0501071_0010128
334 Ga0501072_0028294
335 Ga0501072_0063932
336 Ga0501073_0015839
337 Ga0501073_0269836
338 Ga0501074_0152914
339 Ga0501074_0215317
340 Ga0501074_0540631
341 Ga0501076_0236103
342 Ga0501079_0004281
343 Ga0501079_0500142
344 Ga0501080_0009818
345 Ga0501080_0070594
346 Ga0501080_0575026
347 Ga0501083_0000207
348 Ga0501035_0306785
349 nmdc:mga05p37_34295_c1
350 nmdc:mga05p37_368312_c1
351 nmdc:mga09592_4842_c1
352 nmdc:mga0qj67_47806_c1
353 nmdc:mga06r32_5196_c1
354 nmdc:mga06r32_737540_c1
355 nmdc:mga0n895_21834_c1
356 nmdc:mga0n895_256583_c1
357 nmdc:mga0rr50_619699_c1
358 nmdc:mga0a205_4625_c1
359 Ga0495612_0067676
360 Ga0495595_0057407
361 Ga0495595_0139113
362 Ga0495595_0187668
363 Ga0495619_0080565
364 Ga0495619_0135653
365 Ga0495619_0422923
366 Ga0500568_0000013
367 Ga0500616_0005364
368 Ga0501084_0000082
369 Ga0501084_0000208
370 Ga0501084_0064935
371 Ga0501084_0139828
372 Ga0501082_0206553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

202

0.97

PF08659

KR

KR domain

9

182

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

14

219

0.9

PF23441

2

230

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ztm-assembly1.cif.gz_A t190s mutant of d-3-hydroxybutyrate dehydrogenase 0.942 47 177
2ztu-assembly1.cif.gz_B t190a mutant of d-3-hydroxybutyrate dehydrogenase complexed with nad+ 0.9389 47 172
4cqm-assembly2.cif.gz_B crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9387 47 173
4cqm-assembly3.cif.gz_O crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9318 47 176
4rf4-assembly1.cif.gz_A crystal structure of ketoreductase from lactobacillus kefir 0.9306 46 178
ID Description Score Start End Superfamily
2ztuB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9389 47 172 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9242 49 167 3.40.50.720
af_Q7K3N4_96_372_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9097 46 171 3.40.50.720
4fd3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9063 68 173 3.40.50.720
5wuwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9018 46 172 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E3RH89-F1-model_v4 Short-chain dehydrogenase 0.9492 47 177 GO:0016491
AF-A0A7L2FK79-F1-model_v4 11-beta-hydroxysteroid dehydrogenase 1 (EC 1.1.1.146) (EC 1.1.1.201) (7-oxosteroid reductase) (Corticosteroid 11-beta-dehydrogenase isozyme 1) 0.9388 30 176 GO:0005496
GO:0005789
GO:0006706
GO:0070524
AF-A0A2K6T9Q5-F1-model_v4 Hydroxysteroid 11-beta-dehydrogenase 1-like protein (11-beta-hydroxysteroid dehydrogenase type 3) 0.9296 32 174 GO:0005576
GO:0005654
GO:0016491
AF-A0A1D7QXP3-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.9204 47 176 GO:0004316
AF-A0A850U2N1-F1-model_v4 Hydroxysteroid 11-beta-dehydrogenase 1-like protein (11-beta-hydroxysteroid dehydrogenase type 3) 0.9146 32 223 GO:0005576
GO:0016491
GO:0043231

Map