F284835

General Info

Members Datasets Scaffolds Average Seq Length
185 142 354 355

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0408639|Ga0466967_0408639_79_1305
Length 394
Sequence MAWTVAVPSSLHRFLFLIKELKMNKKLLCAALLCGLGVAQAASAQTFDDRWYVTGSAGMNMQDNDRLTDNAPFLAVGVGKYLTPNWSIDAELNYQNPNFNNGAVCLTGPTEGFCSPEDLNWSQYGISLDARYHFVNEARNWNPYLLMGLGYQRSEEEFDNFPNPDSPAVRKHGNIAGKLGLGVEGKLGSSARVRGEVAYRIDADNGSNAALISDPDHDDGPDWFGDVLASVGVVIPLGPEPDMDSDGDGVNDCNDKCPGSQAGQTIGPDGCPVPVSIDLKGVNFDFDKSTLRPDAVEILNQAVDILKRYPDLKVEVAGHTDSVGSDAYNQKLSERRAKAVYDYLTSNGVDAARLVGPNGYGESRPIAPNTNPDGSDNPEGRAQNRRTELNVQNQ

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
23 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
24 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
25 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
30 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
31 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
61 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
62 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
83 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
88 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
111 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
129 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
136 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
137 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
138 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
139 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
140 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
141 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
142 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.19
Metatranscriptomes 5.41
Isolates 5.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.3
Nodule 0
Rhizoplane 5.41
Rhizosphere 70.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0408639 3300045976 Bacteria 1322
2 JGI25151J46595_10037615 3300003187 Bacteria 1812
3 rootH2_10200615 3300003320 Bacteria 3615
4 Ga0055524_1024130 3300003775 Bacteria 1939
5 Ga0055536_1003148 3300003781 Bacteria 8951
6 Ga0055530_10002195 3300003791 Bacteria 12908
7 Ga0055531_10006731 3300003794 Bacteria 6432
8 Ga0055531_10028569 3300003794 Bacteria 1920
9 Ga0065714_10014484 3300005288 Bacteria 2521
10 Ga0065704_10070660 3300005289 Bacteria 18154
11 Ga0070670_100170852 3300005331 Bacteria 1885
12 Ga0070660_100051945 3300005339 Bacteria 3158
13 Ga0070669_100058011 3300005353 Bacteria 2841
14 Ga0070671_100117186 3300005355 Bacteria 2239
15 Ga0070673_100156288 3300005364 Bacteria 1936
16 Ga0070659_100089666 3300005366 Bacteria 2463
17 Ga0070667_100045333 3300005367 Bacteria 3696
18 Ga0070679_100129931 3300005530 Bacteria 2500
19 Ga0068864_100129564 3300005618 Bacteria 2264
20 Ga0068861_100128550 3300005719 Bacteria 2053
21 Ga0105251_10010172 3300009011 Bacteria 5482
22 Ga0105248_10297893 3300009177 Bacteria 1816
23 Ga0105148_101085 3300009978 Bacteria 1946
24 Ga0105028_100358 3300009993 Bacteria 4895
25 Ga0157316_1000686 3300012510 Bacteria 1860
26 Ga0157327_1000221 3300012512 Bacteria 2863
27 Ga0157370_10266362 3300013104 Bacteria 1583
28 Ga0157369_10022655 3300013105 Bacteria 7006
29 Ga0157375_10154946 3300013308 Bacteria 2429
30 Ga0183360_10001 3300015689 Bacteria 3943671
31 Ga0207425_1011319 3300025245 Bacteria 2134
32 Ga0209565_1000005 3300025263 Bacteria 947317
33 Ga0209673_1000011 3300025273 Bacteria 586604
34 Ga0209130_1019822 3300025284 Bacteria 1551
35 Ga0209675_1000004 3300025291 Bacteria 947166
36 Ga0209676_1000110 3300025292 Bacteria 214083
37 Ga0209676_1000156 3300025292 Bacteria 163255
38 Ga0209676_1002441 3300025292 Bacteria 13208
39 Ga0209025_1000036 3300025294 Bacteria 404113
40 Ga0209025_1058341 3300025294 Bacteria 1467
41 Ga0209564_1000018 3300025295 Bacteria 586913
42 Ga0209758_1009045 3300025297 Bacteria 6287
43 Ga0209050_1000917 3300025298 Bacteria 38818
44 Ga0209256_1000021 3300025299 Bacteria 537097
45 Ga0209256_1020813 3300025299 Bacteria 2035
46 Ga0209051_1005656 3300025303 Bacteria 7234
47 Ga0209257_1000129 3300025304 Bacteria 214155
48 Ga0209257_1000278 3300025304 Bacteria 114707
49 Ga0209257_1000920 3300025304 Bacteria 40982
50 Ga0209257_1008432 3300025304 Bacteria 5862
51 Ga0207713_1017959 3300025735 Bacteria 3519
52 Ga0207705_10013395 3300025909 Bacteria 5915
53 Ga0207657_10021855 3300025919 Bacteria 6008
54 Ga0207652_10138384 3300025921 Bacteria 2175
55 Ga0207644_10050421 3300025931 Bacteria 2983
56 Ga0207711_10237787 3300025941 Bacteria 1670
57 Ga0207676_10087331 3300026095 Bacteria 2550
58 Ga0207675_100218089 3300026118 Bacteria 1837
59 Ga0209967_1000448 3300027364 Bacteria 5410
60 Ga0209984_1010606 3300027424 Bacteria 1184
61 Ga0209995_1003095 3300027471 Bacteria 2639
62 Ga0209999_1003019 3300027543 Bacteria 2993
63 Ga0209982_1002084 3300027552 Bacteria 2777
64 Ga0209970_1001524 3300027614 Bacteria 4039
65 Ga0209983_1005999 3300027665 Bacteria 2505
66 Ga0209971_1003724 3300027682 Bacteria 3606
67 Ga0268265_10301726 3300028380 Bacteria 1442
68 Ga0268265_10462823 3300028380 Bacteria 1187
69 Ga0316177_1045714 3300030731 Bacteria 1384
70 Ga0316177_1180583 3300030731 Bacteria 4110
71 Ga0314311_1086748 3300030733 Bacteria 4780
72 Ga0314311_1190278 3300030733 Bacteria 2277
73 Ga0316178_1152384 3300030735 Bacteria 2390
74 Ga0307413_10026653 3300031824 Bacteria 3189
75 Ga0307406_10005343 3300031901 Bacteria 7031
76 Ga0307406_10096593 3300031901 Bacteria 2002
77 Ga0307412_10077959 3300031911 Bacteria 2280
78 Ga0307409_100084963 3300031995 Bacteria 2571
79 Ga0307416_100112528 3300032002 Bacteria 2402
80 Ga0307414_10058997 3300032004 Bacteria 2707
81 Ga0307414_10082487 3300032004 Bacteria 2357
82 Ga0307414_10091002 3300032004 Bacteria 2266
83 Ga0307414_10119071 3300032004 Bacteria 2026
84 Ga0307414_10129447 3300032004 Bacteria 1956
85 Ga0307414_10271759 3300032004 Bacteria 1420
86 Ga0307411_10031515 3300032005 Bacteria 3263
87 Ga0307411_10217956 3300032005 Bacteria 1478
88 Ga0307415_100156555 3300032126 Bacteria 1760
89 Ga0395898_0072147 3300037466 Bacteria 3336
90 Ga0237816_00009 3300039145 Bacteria 12381
91 Ga0439436_0020486 3300041404 Bacteria 1969
92 Ga0439439_0022177 3300041406 Bacteria 1585
93 Ga0439439_0043066 3300041406 Bacteria 1174
94 Ga0439447_007027 3300041407 Bacteria 3605
95 Ga0439466_0069035 3300041411 Bacteria 1128
96 Ga0451795_1090558 3300041456 Bacteria 1243
97 Ga0439432_043603 3300042006 Bacteria 1415
98 Ga0439449_0002782 3300042007 Bacteria 6799
99 Ga0439449_0019276 3300042007 Bacteria 2557
100 Ga0439449_0040034 3300042007 Bacteria 1742
101 Ga0439457_005972 3300042014 Bacteria 3009
102 Ga0439462_0015890 3300042015 Bacteria 1943
103 Ga0450918_012322 3300042531 Bacteria 1491
104 Ga0495607_0042788 3300046501 Bacteria 2682
105 Ga0495621_0000072 3300046539 Bacteria 20088
106 Ga0495656_0003754 3300046615 Bacteria 5157
107 Ga0495656_0004328 3300046615 Bacteria 4855
108 Ga0495668_0001221 3300046616 Bacteria 25971
109 Ga0495668_0037890 3300046616 Bacteria 2696
110 Ga0495670_0206790 3300046691 Bacteria 1040
111 Ga0495660_0012385 3300046810 Bacteria 4949
112 Ga0495636_0003488 3300047318 Bacteria 6106
113 Ga0495636_0006433 3300047318 Bacteria 4616
114 Ga0495672_0002391 3300047320 Bacteria 17338
115 Ga0495672_0094004 3300047320 Bacteria 1640
116 Ga0495681_0080751 3300047470 Bacteria 1452
117 Ga0496101_0054425 3300048904 Bacteria 2889
118 Ga0496103_0209527 3300048906 Bacteria 1253
119 Ga0496106_0131890 3300048909 Bacteria 1960
120 Ga0496107_0031473 3300048910 Bacteria 3786
121 Ga0496108_0102216 3300048911 Bacteria 2445
122 Ga0496110_0097487 3300048913 Bacteria 2634
123 Ga0496111_0040582 3300048914 Bacteria 3338
124 Ga0496113_0059699 3300048916 Bacteria 2873
125 Ga0496114_0047337 3300048917 Bacteria 3577
126 Ga0496121_0010673 3300048924 Bacteria 10312
127 Ga0496122_0008501 3300048925 Bacteria 11052
128 Ga0496123_0021031 3300048926 Bacteria 5084
129 Ga0496124_0000018 3300048927 Bacteria 442940
130 Ga0496124_0004674 3300048927 Bacteria 15824
131 Ga0496126_0033159 3300048929 Bacteria 4860
132 Ga0501306_010414 3300049127 Bacteria 1170
133 Ga0501304_002862 3300049160 Bacteria 1228
134 Ga0501305_008804 3300049161 Bacteria 1313
135 Ga0501307_007808 3300049162 Bacteria 1188
136 Ga0501300_003453 3300049523 Bacteria 2363
137 Ga0501311_005246 3300049527 Bacteria 1413
138 Ga0501316_006118 3300049532 Bacteria 1272
139 Ga0501320_005092 3300049536 Bacteria 1185
140 Ga0501323_006107 3300049539 Bacteria 1340
141 Ga0501031_0009850 3300049568 Bacteria 6222
142 Ga0501032_0012870 3300049569 Bacteria 5963
143 Ga0501033_0011656 3300049570 Bacteria 6723
144 Ga0501033_0077322 3300049570 Bacteria 2442
145 Ga0501034_0000894 3300049571 Bacteria 43670
146 Ga0501034_0000903 3300049571 Bacteria 43233
147 Ga0501034_0009753 3300049571 Bacteria 10041
148 Ga0501034_0024653 3300049571 Bacteria 6117
149 Ga0501036_0018070 3300049572 Bacteria 5903
150 Ga0501037_0022264 3300049573 Bacteria 4688
151 Ga0501038_0022651 3300049574 Bacteria 5624
152 Ga0501038_0134091 3300049574 Bacteria 2030
153 Ga0501039_0070955 3300049575 Bacteria 2706
154 Ga0501043_0023017 3300049579 Bacteria 4886
155 Ga0501043_0029321 3300049579 Bacteria 4322
156 Ga0501047_0028174 3300049581 Bacteria 5413
157 Ga0501070_0019700 3300049586 Bacteria 5658
158 Ga0501073_0014488 3300049589 Bacteria 5730
159 Ga0501080_0018914 3300049742 Bacteria 6379
160 Ga0501265_000380 3300049762 Bacteria 4591
161 Ga0501265_005406 3300049762 Bacteria 1472
162 Ga0501275_000741 3300049772 Bacteria 3569
163 Ga0501035_0016080 3300049822 Bacteria 6904
164 Ga0501044_0019947 3300049823 Bacteria 7160
165 Ga0501045_0228265 3300049824 Bacteria 1386
166 Ga0587066_008835 3300059490 Bacteria 1411
167 Ga0587090_006847 3300059510 Bacteria 1479
168 2572256454 2571042365 Bacteria 3289345
169 2643906255 2643221579 Bacteria 4443405
170 2643915275 2643221581 Bacteria 3893603
171 2842781608 2842780639 Bacteria 4337790
172 2923519175 2923516293 Bacteria 3716336
173 2941491966 2941489479 Bacteria 6313767
174 2941491967 2941489479 Bacteria 6313767
175 2995952831 2995948881 Bacteria 6358104
176 2995952832 2995948881 Bacteria 6358104
177 8003014947 8003014200 Bacteria 4059994
178 Ga0466967_0408639
179 JGI25151J46595_10037615
180 rootH2_10200615
181 Ga0055524_1024130
182 Ga0055536_1003148
183 Ga0055530_10002195
184 Ga0055531_10006731
185 Ga0055531_10028569
186 Ga0065714_10014484
187 Ga0065704_10070660
188 Ga0070670_100170852
189 Ga0070660_100051945
190 Ga0070669_100058011
191 Ga0070671_100117186
192 Ga0070673_100156288
193 Ga0070659_100089666
194 Ga0070667_100045333
195 Ga0070679_100129931
196 Ga0068864_100129564
197 Ga0068861_100128550
198 Ga0105251_10010172
199 Ga0105248_10297893
200 Ga0105148_101085
201 Ga0105028_100358
202 Ga0157316_1000686
203 Ga0157327_1000221
204 Ga0157370_10266362
205 Ga0157369_10022655
206 Ga0157375_10154946
207 Ga0183360_10001
208 Ga0207425_1011319
209 Ga0209565_1000005
210 Ga0209673_1000011
211 Ga0209130_1019822
212 Ga0209675_1000004
213 Ga0209676_1000110
214 Ga0209676_1000156
215 Ga0209676_1002441
216 Ga0209025_1000036
217 Ga0209025_1058341
218 Ga0209564_1000018
219 Ga0209758_1009045
220 Ga0209050_1000917
221 Ga0209256_1000021
222 Ga0209256_1020813
223 Ga0209051_1005656
224 Ga0209257_1000129
225 Ga0209257_1000278
226 Ga0209257_1000920
227 Ga0209257_1008432
228 Ga0207713_1017959
229 Ga0207705_10013395
230 Ga0207657_10021855
231 Ga0207652_10138384
232 Ga0207644_10050421
233 Ga0207711_10237787
234 Ga0207676_10087331
235 Ga0207675_100218089
236 Ga0209967_1000448
237 Ga0209984_1010606
238 Ga0209995_1003095
239 Ga0209999_1003019
240 Ga0209982_1002084
241 Ga0209970_1001524
242 Ga0209983_1005999
243 Ga0209971_1003724
244 Ga0268265_10301726
245 Ga0268265_10462823
246 Ga0316177_1045714
247 Ga0316177_1180583
248 Ga0314311_1086748
249 Ga0314311_1190278
250 Ga0316178_1152384
251 Ga0307413_10026653
252 Ga0307406_10005343
253 Ga0307406_10096593
254 Ga0307412_10077959
255 Ga0307409_100084963
256 Ga0307416_100112528
257 Ga0307414_10058997
258 Ga0307414_10082487
259 Ga0307414_10091002
260 Ga0307414_10119071
261 Ga0307414_10129447
262 Ga0307414_10271759
263 Ga0307411_10031515
264 Ga0307411_10217956
265 Ga0307415_100156555
266 Ga0395898_0072147
267 Ga0237816_00009
268 Ga0439436_0020486
269 Ga0439439_0022177
270 Ga0439439_0043066
271 Ga0439447_007027
272 Ga0439466_0069035
273 Ga0451795_1090558
274 Ga0439432_043603
275 Ga0439449_0002782
276 Ga0439449_0019276
277 Ga0439449_0040034
278 Ga0439457_005972
279 Ga0439462_0015890
280 Ga0450918_012322
281 Ga0495607_0042788
282 Ga0495621_0000072
283 Ga0495656_0003754
284 Ga0495656_0004328
285 Ga0495668_0001221
286 Ga0495668_0037890
287 Ga0495670_0206790
288 Ga0495660_0012385
289 Ga0495636_0003488
290 Ga0495636_0006433
291 Ga0495672_0002391
292 Ga0495672_0094004
293 Ga0495681_0080751
294 Ga0496101_0054425
295 Ga0496103_0209527
296 Ga0496106_0131890
297 Ga0496107_0031473
298 Ga0496108_0102216
299 Ga0496110_0097487
300 Ga0496111_0040582
301 Ga0496113_0059699
302 Ga0496114_0047337
303 Ga0496121_0010673
304 Ga0496122_0008501
305 Ga0496123_0021031
306 Ga0496124_0000018
307 Ga0496124_0004674
308 Ga0496126_0033159
309 Ga0501306_010414
310 Ga0501304_002862
311 Ga0501305_008804
312 Ga0501307_007808
313 Ga0501300_003453
314 Ga0501311_005246
315 Ga0501316_006118
316 Ga0501320_005092
317 Ga0501323_006107
318 Ga0501031_0009850
319 Ga0501032_0012870
320 Ga0501033_0011656
321 Ga0501033_0077322
322 Ga0501034_0000894
323 Ga0501034_0000903
324 Ga0501034_0009753
325 Ga0501034_0024653
326 Ga0501036_0018070
327 Ga0501037_0022264
328 Ga0501038_0022651
329 Ga0501038_0134091
330 Ga0501039_0070955
331 Ga0501043_0023017
332 Ga0501043_0029321
333 Ga0501047_0028174
334 Ga0501070_0019700
335 Ga0501073_0014488
336 Ga0501080_0018914
337 Ga0501265_000380
338 Ga0501265_005406
339 Ga0501275_000741
340 Ga0501035_0016080
341 Ga0501044_0019947
342 Ga0501045_0228265
343 Ga0587066_008835
344 Ga0587090_006847
345 2572256454
346 2643906255
347 2643915275
348 2842781608
349 2923519175
350 2941491966
351 2941491967
352 2995952831
353 2995952832
354 8003014947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

283

378

0.95

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

30

233

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lbt-assembly1.cif.gz_A solution structure of the c domain of rv0899(d236a) from mycobacterium tuberculosis 0.8306 256 360
4b5c-assembly3.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei 0.8281 256 361
4zhw-assembly1.cif.gz_A crystal structure of a bacterial signalling protein (n-terminal truncation) 0.8189 261 358
2hqs-assembly1.cif.gz_H crystal structure of tolb/pal complex 0.8185 256 358
4g4x-assembly1.cif.gz_A crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii 0.8136 248 360
ID Description Score Start End Superfamily
4pwtC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8273 256 359 3.30.1330.60
4zhwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8189 261 358 3.30.1330.60
6jfwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8063 254 361 3.30.1330.60
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8055 248 361 3.30.1330.60
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.7934 29 202 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A3A4XG70-F1-model_v4 OmpA family protein 0.8596 248 362 GO:0009279
AF-A0A1V4MJK7-F1-model_v4 Peptidoglycan-associated protein 0.848 256 360 GO:0009279
GO:0051301
AF-A0A366MR58-F1-model_v4 OmpA-like domain-containing protein 0.8464 261 362 GO:0009279
AF-A0A1F9SD01-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8459 21 210
AF-A0A563E6K7-F1-model_v4 OmpA family protein 0.8453 256 362 GO:0009279

Map