F284629

General Info

Members Datasets Scaffolds Average Seq Length
185 122 185 191

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0001444|Ga0373923_0001444_4715_5401
Length 219
Sequence VFGEEWPFLCASDKIGMEQGVENGDTSMNQTNDQEDTTIYKVLMNHEEQYSIWPDYKEIPRGWTHVGKAGPKSECLAYIKEVWTDMRPLSLRKKMEEFAKNPSEPEKSLVDRLCEGNHAVEAGLRPERTAKRLKEAVDRDYVHVKFTETKGGTELGFRLDRASSDLSAADFENGKGTIHLEGNLTFDYVRVKCVADIDLSTLTGTGHLVKIEAKETSVA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
72 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
109 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 2.7
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10094640 3300001990 Unclassified 886
2 JGI25406J46586_10025208 3300003203 Bacteria 2313
3 Ga0065715_10088973 3300005293 Bacteria 18924
4 Ga0070682_100008768 3300005337 Bacteria 5708
5 Ga0070692_10042611 3300005345 Bacteria 2331
6 Ga0070675_100106296 3300005354 Bacteria 2369
7 Ga0070709_10057270 3300005434 Bacteria 2468
8 Ga0070714_100068772 3300005435 Unclassified 3056
9 Ga0070713_100060977 3300005436 Bacteria 3155
10 Ga0070713_100105789 3300005436 Unclassified 2445
11 Ga0070713_100277588 3300005436 Bacteria 1536
12 Ga0070711_100190392 3300005439 Bacteria 1576
13 Ga0070711_100233064 3300005439 Bacteria 1436
14 Ga0070705_100026451 3300005440 Unclassified 3158
15 Ga0070700_100004918 3300005441 Bacteria 7026
16 Ga0070700_100442111 3300005441 Bacteria 987
17 Ga0070694_100719797 3300005444 Bacteria 813
18 Ga0070708_101292976 3300005445 Bacteria 681
19 Ga0070681_10007073 3300005458 Bacteria 10924
20 Ga0070698_100184155 3300005471 Bacteria 2026
21 Ga0070679_100325965 3300005530 Bacteria 1485
22 Ga0070684_100280956 3300005535 Bacteria 1525
23 Ga0068853_100013370 3300005539 Bacteria 6700
24 Ga0070693_100054056 3300005547 Bacteria 2307
25 Ga0070693_100098766 3300005547 Bacteria 1775
26 Ga0070693_100250505 3300005547 Bacteria 1174
27 Ga0070702_100001373 3300005615 Bacteria 9928
28 Ga0068858_100090333 3300005842 Bacteria 2850
29 Ga0068860_100006732 3300005843 Bacteria 11527
30 Ga0068862_100571085 3300005844 Bacteria 1082
31 Ga0081455_10071625 3300005937 Bacteria 2873
32 Ga0081455_10189116 3300005937 Bacteria 1552
33 Ga0081539_10001129 3300005985 Bacteria 48420
34 Ga0081539_10001818 3300005985 Bacteria 33680
35 Ga0070717_10023730 3300006028 Unclassified 4863
36 Ga0070716_100204800 3300006173 Bacteria 1314
37 Ga0070712_100092674 3300006175 Unclassified 2216
38 Ga0075367_10234918 3300006178 Bacteria 1148
39 Ga0097621_100003545 3300006237 Bacteria 10775
40 Ga0068871_100002492 3300006358 Bacteria 12563
41 Ga0075428_100084683 3300006844 Unclassified 3459
42 Ga0075428_100858875 3300006844 Bacteria 963
43 Ga0075431_100018853 3300006847 Bacteria 7028
44 Ga0075431_100051653 3300006847 Bacteria 4239
45 Ga0075431_100054157 3300006847 Bacteria 4137
46 Ga0075431_100122816 3300006847 Bacteria 2679
47 Ga0075431_100143711 3300006847 Bacteria 2459
48 Ga0075431_100164915 3300006847 Bacteria 2277
49 Ga0075431_100171341 3300006847 Bacteria 2230
50 Ga0075431_100184942 3300006847 Bacteria 2137
51 Ga0075431_100522669 3300006847 Bacteria 1176
52 Ga0075434_100334849 3300006871 Bacteria 1534
53 Ga0075434_100915917 3300006871 Bacteria 891
54 Ga0075429_100202954 3300006880 Bacteria 1737
55 Ga0075429_100205618 3300006880 Bacteria 1725
56 Ga0075429_100428229 3300006880 Bacteria 1159
57 Ga0068865_100183602 3300006881 Bacteria 1612
58 Ga0111539_10000997 3300009094 Bacteria 37088
59 Ga0111539_10007005 3300009094 Bacteria 14466
60 Ga0105245_10001446 3300009098 Bacteria 21541
61 Ga0105245_10001919 3300009098 Bacteria 18877
62 Ga0105245_11003706 3300009098 Bacteria 879
63 Ga0114129_10003332 3300009147 Bacteria 22578
64 Ga0114129_10031555 3300009147 Bacteria 7489
65 Ga0114129_10039505 3300009147 Bacteria 6653
66 Ga0114129_10048059 3300009147 Bacteria 5995
67 Ga0114129_10123850 3300009147 Bacteria 3555
68 Ga0114129_10518908 3300009147 Bacteria 1553
69 Ga0114129_10714343 3300009147 Bacteria 1287
70 Ga0114129_10888709 3300009147 Bacteria 1130
71 Ga0105243_10691500 3300009148 Unclassified 993
72 Ga0105237_10535248 3300009545 Bacteria 1178
73 Ga0105238_10012540 3300009551 Bacteria 8555
74 Ga0105238_10586084 3300009551 Bacteria 1122
75 Ga0105249_10001994 3300009553 Bacteria 17732
76 Ga0105239_10856635 3300010375 Bacteria 1042
77 Ga0157373_10164373 3300013100 Bacteria 1562
78 Ga0157369_10079705 3300013105 Bacteria 3507
79 Ga0157374_10286197 3300013296 Bacteria 1628
80 Ga0163162_10004830 3300013306 Bacteria 13005
81 Ga0157372_10027083 3300013307 Bacteria 6240
82 Ga0157379_10131980 3300014968 Bacteria 2249
83 Ga0213875_10000017 3300021388 Bacteria 239813
84 Ga0207692_10059412 3300025898 Bacteria 1974
85 Ga0207647_10001127 3300025904 Bacteria 20564
86 Ga0207654_10007350 3300025911 Bacteria 5546
87 Ga0207687_10000274 3300025927 Bacteria 35375
88 Ga0207687_10003026 3300025927 Bacteria 11400
89 Ga0207700_10501543 3300025928 Bacteria 1074
90 Ga0207700_10518467 3300025928 Bacteria 1056
91 Ga0207664_10121168 3300025929 Bacteria 2189
92 Ga0207665_10063448 3300025939 Bacteria 2509
93 Ga0207665_10149736 3300025939 Bacteria 1671
94 Ga0207661_10097626 3300025944 Bacteria 2461
95 Ga0207679_10097742 3300025945 Bacteria 2288
96 Ga0207712_10000792 3300025961 Bacteria 23455
97 Ga0207703_10052297 3300026035 Bacteria 3316
98 Ga0207639_10154766 3300026041 Bacteria 1924
99 Ga0207708_10008166 3300026075 Bacteria 7751
100 Ga0207674_10386960 3300026116 Bacteria 1352
101 Ga0207428_10001629 3300027907 Bacteria 23316
102 Ga0207428_10002613 3300027907 Bacteria 17982
103 Ga0268264_10035676 3300028381 Unclassified 4094
104 Ga0307405_10046970 3300031731 Bacteria 2656
105 Ga0307410_10348532 3300031852 Bacteria 1183
106 Ga0373926_0003699 3300035083 Bacteria 4972
107 Ga0373944_0017764 3300035089 Bacteria 2024
108 Ga0373923_0000521 3300035111 Bacteria 9325
109 Ga0373923_0001444 3300035111 Bacteria 6816
110 Ga0373936_0006695 3300035113 Bacteria 4338
111 Ga0373936_0075103 3300035113 Unclassified 1399
112 Ga0373945_0000203 3300035116 Bacteria 16202
113 Ga0373945_0000994 3300035116 Bacteria 8463
114 Ga0373957_0313178 3300035120 Unclassified 667
115 Ga0373943_0097440 3300035170 Unclassified 1532
116 Ga0373946_0047148 3300035171 Bacteria 1789
117 Ga0373924_0000036 3300035410 Bacteria 33897
118 Ga0373924_0000119 3300035410 Bacteria 22599
119 Ga0373935_0000004 3300035692 Bacteria 143479
120 Ga0373935_0007244 3300035692 Bacteria 6628
121 Ga0373935_0174472 3300035692 Bacteria 1472
122 Ga0373927_0007123 3300035695 Bacteria 7589
123 Ga0373927_0153373 3300035695 Unclassified 1508
124 Ga0373947_0001192 3300035725 Bacteria 16011
125 Ga0373947_0002455 3300035725 Bacteria 11163
126 Ga0373925_0003566 3300037068 Bacteria 11998
127 Ga0373925_0116380 3300037068 Bacteria 2070
128 Ga0436364_0339530 3300037853 Bacteria 240640
129 Ga0495580_0096048 3300046472 Bacteria 2061
130 Ga0495582_0061838 3300046473 Bacteria 2068
131 Ga0495639_0035616 3300046475 Bacteria 2227
132 Ga0495594_0316376 3300046499 Unclassified 889
133 Ga0495608_0220303 3300046511 Unclassified 1191
134 Ga0495628_0079427 3300046516 Bacteria 2551
135 Ga0495630_0044643 3300046517 Bacteria 3312
136 Ga0495665_0007308 3300046531 Bacteria 5966
137 Ga0495665_0072094 3300046531 Bacteria 1819
138 Ga0495586_0084427 3300046535 Bacteria 1748
139 Ga0495667_0093228 3300046559 Bacteria 1950
140 Ga0495667_0169506 3300046559 Unclassified 1403
141 Ga0495635_0103962 3300046663 Bacteria 1941
142 Ga0495657_0178896 3300046675 Bacteria 1303
143 Ga0495669_0206913 3300046684 Unclassified 939
144 Ga0495624_0189063 3300046690 Unclassified 1253
145 Ga0495581_0063140 3300047315 Bacteria 2140
146 Ga0495581_0231289 3300047315 Unclassified 1081
147 Ga0495674_0525645 3300047319 Unclassified 944
148 Ga0495674_0988906 3300047319 Bacteria 645
149 Ga0496104_0140666 3300048907 Bacteria 2318
150 Ga0496108_0835066 3300048911 Bacteria 793
151 Ga0496109_0007977 3300048912 Bacteria 8975
152 Ga0496112_0000574 3300048915 Bacteria 25247
153 Ga0496113_0000760 3300048916 Bacteria 16575
154 Ga0501296_000810 3300049519 Bacteria 3095
155 Ga0501235_004428 3300049669 Bacteria 3034
156 Ga0501249_023832 3300049679 Bacteria 1346
157 Ga0501225_0057302 3300049705 Bacteria 1092
158 Ga0501081_0221259 3300049743 Bacteria 1377
159 Ga0501081_0415171 3300049743 Unclassified 997
160 Ga0501273_006811 3300049770 Bacteria 1332
161 nmdc:mga06z11_192102_c1 3300050494 Bacteria 1182
162 nmdc:mga05p37_13997_c1 3300050507 Bacteria 9620
163 nmdc:mga05p37_1646_c1 3300050507 Bacteria 25911
164 nmdc:mga05p37_22029_c1 3300050507 Bacteria 7721
165 nmdc:mga05p37_50226_c1 3300050507 Bacteria 5129
166 nmdc:mga05p37_7601_c1 3300050507 Bacteria 12787
167 nmdc:mga05p37_767921_c1 3300050507 Bacteria 1060
168 nmdc:mga09592_221256_c1 3300050508 Bacteria 1640
169 nmdc:mga09592_229197_c1 3300050508 Bacteria 1609
170 nmdc:mga06r32_161350_c1 3300050510 Bacteria 2224
171 nmdc:mga06r32_29482_c1 3300050510 Bacteria 5143
172 nmdc:mga06r32_3092_c1 3300050510 Bacteria 14896
173 nmdc:mga06r32_31276_c1 3300050510 Bacteria 4997
174 nmdc:mga08y16_3068_c1 3300050511 Bacteria 17268
175 nmdc:mga08y16_3464_c1 3300050511 Bacteria 16382
176 nmdc:mga08y16_927255_c1 3300050511 Bacteria 855
177 nmdc:mga0n895_1208922_c1 3300050512 Unclassified 729
178 nmdc:mga0n895_800490_c1 3300050512 Bacteria 933
179 Ga0495619_0145864 3300053085 Bacteria 1632
180 Ga0500641_0022039 3300053096 Bacteria 2435
181 Ga0501084_0043619 3300054114 Bacteria 3752
182 Ga0501084_0159191 3300054114 Bacteria 1905
183 Ga0587111_0113202 3300060346 Bacteria 690
184 Ga0501082_0369082 3300060353 Bacteria 1252
185 Ga0501082_0504180 3300060353 Bacteria 1058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035120 Ga0373957_0313178 Ga0373957_0313178_68_628 169
2 3300047319 Ga0495674_0988906 Ga0495674_0988906_69_626 172
3 3300013296 Ga0157374_10286197 Ga0157374_102861972 178
4 3300005547 Ga0070693_100054056 Ga0070693_1000540562 179
5 3300005547 Ga0070693_100250505 Ga0070693_1002505052 179
6 3300006847 Ga0075431_100122816 Ga0075431_1001228162 179
7 3300013100 Ga0157373_10164373 Ga0157373_101643732 179
8 3300025911 Ga0207654_10007350 Ga0207654_100073504 179
9 3300046516 Ga0495628_0079427 Ga0495628_0079427_1259_1852 179
10 3300048911 Ga0496108_0835066 Ga0496108_0835066_110_703 179
11 3300050510 nmdc:mga06r32_161350_c1 nmdc:mga06r32_161350_c1_278_865 179
12 3300060346 Ga0587111_0113202 Ga0587111_0113202_29_622 179
13 3300005937 Ga0081455_10071625 Ga0081455_100716252 180
14 3300006173 Ga0070716_100204800 Ga0070716_1002048002 180
15 3300025939 Ga0207665_10149736 Ga0207665_101497362 180
16 3300031731 Ga0307405_10046970 Ga0307405_100469702 180
17 3300031852 Ga0307410_10348532 Ga0307410_103485322 180
18 3300049519 Ga0501296_000810 Ga0501296_000810_2412_3008 180
19 3300049669 Ga0501235_004428 Ga0501235_004428_138_734 180
20 3300049679 Ga0501249_023832 Ga0501249_023832_360_956 180
21 3300049705 Ga0501225_0057302 Ga0501225_0057302_248_844 180
22 3300049770 Ga0501273_006811 Ga0501273_006811_339_935 180
23 3300005547 Ga0070693_100098766 Ga0070693_1000987662 181
24 3300006847 Ga0075431_100184942 Ga0075431_1001849423 181
25 3300006871 Ga0075434_100915917 Ga0075434_1009159173 181
26 3300009553 Ga0105249_10001994 Ga0105249_1000199417 181
27 3300025961 Ga0207712_10000792 Ga0207712_100007924 181
28 3300050512 nmdc:mga0n895_800490_c1 nmdc:mga0n895_800490_c1_266_847 181
29 3300053096 Ga0500641_0022039 Ga0500641_0022039_1638_2228 181
30 3300003203 JGI25406J46586_10025208 JGI25406J46586_100252082 182
31 3300005354 Ga0070675_100106296 Ga0070675_1001062963 182
32 3300005441 Ga0070700_100442111 Ga0070700_1004421112 182
33 3300005844 Ga0068862_100571085 Ga0068862_1005710851 182
34 3300005985 Ga0081539_10001129 Ga0081539_100011294 182
35 3300006847 Ga0075431_100051653 Ga0075431_1000516533 182
36 3300006847 Ga0075431_100143711 Ga0075431_1001437112 182
37 3300006880 Ga0075429_100202954 Ga0075429_1002029542 182
38 3300009094 Ga0111539_10000997 Ga0111539_1000099732 182
39 3300009147 Ga0114129_10039505 Ga0114129_100395054 182
40 3300009147 Ga0114129_10518908 Ga0114129_105189082 182
41 3300013306 Ga0163162_10004830 Ga0163162_100048306 182
42 3300014968 Ga0157379_10131980 Ga0157379_101319802 182
43 3300026116 Ga0207674_10386960 Ga0207674_103869602 182
44 3300027907 Ga0207428_10001629 Ga0207428_100016296 182
45 3300050507 nmdc:mga05p37_22029_c1 nmdc:mga05p37_22029_c1_1500_2087 182
46 3300050507 nmdc:mga05p37_50226_c1 nmdc:mga05p37_50226_c1_301_888 182
47 3300050508 nmdc:mga09592_229197_c1 nmdc:mga09592_229197_c1_180_767 182
48 3300050510 nmdc:mga06r32_29482_c1 nmdc:mga06r32_29482_c1_2431_3045 182
49 3300050511 nmdc:mga08y16_3068_c1 nmdc:mga08y16_3068_c1_15615_16202 182
50 3300054114 Ga0501084_0159191 Ga0501084_0159191_1065_1667 182
51 3300049743 Ga0501081_0221259 Ga0501081_0221259_35_640 183
52 3300049743 Ga0501081_0415171 Ga0501081_0415171_269_868 183
53 3300050512 nmdc:mga0n895_1208922_c1 nmdc:mga0n895_1208922_c1_35_631 183
54 3300005445 Ga0070708_101292976 Ga0070708_1012929761 184
55 3300005471 Ga0070698_100184155 Ga0070698_1001841552 184
56 3300005985 Ga0081539_10001818 Ga0081539_100018181 184
57 3300006178 Ga0075367_10234918 Ga0075367_102349182 184
58 3300006847 Ga0075431_100171341 Ga0075431_1001713412 184
59 3300009551 Ga0105238_10586084 Ga0105238_105860842 184
60 3300010375 Ga0105239_10856635 Ga0105239_108566352 184
61 3300046684 Ga0495669_0206913 Ga0495669_0206913_207_815 184
62 3300050494 nmdc:mga06z11_192102_c1 nmdc:mga06z11_192102_c1_70_663 184
63 3300050511 nmdc:mga08y16_927255_c1 nmdc:mga08y16_927255_c1_133_726 184
64 3300054114 Ga0501084_0043619 Ga0501084_0043619_2295_2900 184
65 3300060353 Ga0501082_0504180 Ga0501082_0504180_347_952 184
66 3300005458 Ga0070681_10007073 Ga0070681_100070732 185
67 3300005530 Ga0070679_100325965 Ga0070679_1003259652 185
68 3300005535 Ga0070684_100280956 Ga0070684_1002809561 185
69 3300009147 Ga0114129_10123850 Ga0114129_101238502 185
70 3300013105 Ga0157369_10079705 Ga0157369_100797052 185
71 3300013307 Ga0157372_10027083 Ga0157372_100270832 185
72 3300025944 Ga0207661_10097626 Ga0207661_100976262 185
73 3300006175 Ga0070712_100092674 Ga0070712_1000926743 186
74 3300006871 Ga0075434_100334849 Ga0075434_1003348492 186
75 3300006880 Ga0075429_100205618 Ga0075429_1002056183 186
76 3300009147 Ga0114129_10003332 Ga0114129_100033325 186
77 3300009545 Ga0105237_10535248 Ga0105237_105352481 186
78 3300025945 Ga0207679_10097742 Ga0207679_100977422 186
79 3300035083 Ga0373926_0003699 Ga0373926_0003699_4212_4823 186
80 3300035089 Ga0373944_0017764 Ga0373944_0017764_1067_1678 186
81 3300035111 Ga0373923_0000521 Ga0373923_0000521_502_1113 186
82 3300035113 Ga0373936_0006695 Ga0373936_0006695_3208_3819 186
83 3300035116 Ga0373945_0000994 Ga0373945_0000994_1946_2557 186
84 3300035170 Ga0373943_0097440 Ga0373943_0097440_886_1497 186
85 3300035171 Ga0373946_0047148 Ga0373946_0047148_482_1093 186
86 3300035692 Ga0373935_0007244 Ga0373935_0007244_676_1287 186
87 3300035695 Ga0373927_0153373 Ga0373927_0153373_665_1276 186
88 3300037068 Ga0373925_0116380 Ga0373925_0116380_498_1109 186
89 3300046472 Ga0495580_0096048 Ga0495580_0096048_1243_1854 186
90 3300046473 Ga0495582_0061838 Ga0495582_0061838_237_848 186
91 3300046475 Ga0495639_0035616 Ga0495639_0035616_758_1369 186
92 3300046511 Ga0495608_0220303 Ga0495608_0220303_282_893 186
93 3300046517 Ga0495630_0044643 Ga0495630_0044643_734_1345 186
94 3300046531 Ga0495665_0072094 Ga0495665_0072094_641_1252 186
95 3300046535 Ga0495586_0084427 Ga0495586_0084427_1028_1639 186
96 3300046559 Ga0495667_0093228 Ga0495667_0093228_854_1465 186
97 3300046663 Ga0495635_0103962 Ga0495635_0103962_164_775 186
98 3300046675 Ga0495657_0178896 Ga0495657_0178896_623_1234 186
99 3300046690 Ga0495624_0189063 Ga0495624_0189063_184_795 186
100 3300047319 Ga0495674_0525645 Ga0495674_0525645_301_912 186
101 3300048907 Ga0496104_0140666 Ga0496104_0140666_310_921 186
102 3300048912 Ga0496109_0007977 Ga0496109_0007977_783_1382 186
103 3300048915 Ga0496112_0000574 Ga0496112_0000574_4665_5276 186
104 3300048916 Ga0496113_0000760 Ga0496113_0000760_4218_4829 186
105 3300050507 nmdc:mga05p37_1646_c1 nmdc:mga05p37_1646_c1_18654_19259 186
106 3300006847 Ga0075431_100522669 Ga0075431_1005226692 187
107 3300009147 Ga0114129_10048059 Ga0114129_100480592 187
108 3300035410 Ga0373924_0000119 Ga0373924_0000119_7874_8485 187
109 3300047315 Ga0495581_0063140 Ga0495581_0063140_440_1051 187
110 3300050507 nmdc:mga05p37_7601_c1 nmdc:mga05p37_7601_c1_405_1001 187
111 3300005439 Ga0070711_100233064 Ga0070711_1002330642 188
112 3300005937 Ga0081455_10189116 Ga0081455_101891162 188
113 3300006844 Ga0075428_100084683 Ga0075428_1000846835 188
114 3300006847 Ga0075431_100018853 Ga0075431_1000188535 188
115 3300006880 Ga0075429_100428229 Ga0075429_1004282292 188
116 3300009094 Ga0111539_10007005 Ga0111539_1000700510 188
117 3300009147 Ga0114129_10031555 Ga0114129_100315552 188
118 3300009147 Ga0114129_10714343 Ga0114129_107143431 188
119 3300009147 Ga0114129_10888709 Ga0114129_108887091 188
120 3300027907 Ga0207428_10002613 Ga0207428_100026138 188
121 3300035111 Ga0373923_0001444 Ga0373923_0001444_4715_5401 188
122 3300035113 Ga0373936_0075103 Ga0373936_0075103_432_1118 188
123 3300035692 Ga0373935_0000004 Ga0373935_0000004_134826_135512 188
124 3300035692 Ga0373935_0174472 Ga0373935_0174472_426_1040 188
125 3300035695 Ga0373927_0007123 Ga0373927_0007123_6557_7243 188
126 3300035725 Ga0373947_0001192 Ga0373947_0001192_11211_11897 188
127 3300037068 Ga0373925_0003566 Ga0373925_0003566_7959_8645 188
128 3300046499 Ga0495594_0316376 Ga0495594_0316376_196_843 188
129 3300046531 Ga0495665_0007308 Ga0495665_0007308_1249_1935 188
130 3300046559 Ga0495667_0169506 Ga0495667_0169506_644_1330 188
131 3300047315 Ga0495581_0231289 Ga0495581_0231289_308_994 188
132 3300050507 nmdc:mga05p37_13997_c1 nmdc:mga05p37_13997_c1_2709_3314 188
133 3300050507 nmdc:mga05p37_767921_c1 nmdc:mga05p37_767921_c1_52_657 188
134 3300050508 nmdc:mga09592_221256_c1 nmdc:mga09592_221256_c1_545_1150 188
135 3300050510 nmdc:mga06r32_3092_c1 nmdc:mga06r32_3092_c1_13818_14423 188
136 3300050511 nmdc:mga08y16_3464_c1 nmdc:mga08y16_3464_c1_6573_7178 188
137 3300001990 JGI24737J22298_10094640 JGI24737J22298_100946402 189
138 3300005293 Ga0065715_10088973 Ga0065715_1008897312 189
139 3300005337 Ga0070682_100008768 Ga0070682_1000087683 189
140 3300005345 Ga0070692_10042611 Ga0070692_100426112 189
141 3300005434 Ga0070709_10057270 Ga0070709_100572702 189
142 3300005435 Ga0070714_100068772 Ga0070714_1000687723 189
143 3300005436 Ga0070713_100060977 Ga0070713_1000609772 189
144 3300005436 Ga0070713_100105789 Ga0070713_1001057895 189
145 3300005436 Ga0070713_100277588 Ga0070713_1002775881 189
146 3300005439 Ga0070711_100190392 Ga0070711_1001903921 189
147 3300005440 Ga0070705_100026451 Ga0070705_1000264512 189
148 3300005441 Ga0070700_100004918 Ga0070700_1000049183 189
149 3300005444 Ga0070694_100719797 Ga0070694_1007197971 189
150 3300005539 Ga0068853_100013370 Ga0068853_1000133702 189
151 3300005615 Ga0070702_100001373 Ga0070702_1000013734 189
152 3300005842 Ga0068858_100090333 Ga0068858_1000903332 189
153 3300005843 Ga0068860_100006732 Ga0068860_1000067325 189
154 3300006028 Ga0070717_10023730 Ga0070717_100237301 189
155 3300006237 Ga0097621_100003545 Ga0097621_1000035456 189
156 3300006358 Ga0068871_100002492 Ga0068871_1000024929 189
157 3300006844 Ga0075428_100858875 Ga0075428_1008588752 189
158 3300006847 Ga0075431_100054157 Ga0075431_1000541573 189
159 3300006847 Ga0075431_100164915 Ga0075431_1001649154 189
160 3300006881 Ga0068865_100183602 Ga0068865_1001836022 189
161 3300009098 Ga0105245_10001446 Ga0105245_100014469 189
162 3300009098 Ga0105245_10001919 Ga0105245_1000191915 189
163 3300009098 Ga0105245_11003706 Ga0105245_110037061 189
164 3300009148 Ga0105243_10691500 Ga0105243_106915001 189
165 3300009551 Ga0105238_10012540 Ga0105238_100125402 189
166 3300021388 Ga0213875_10000017 Ga0213875_100000179 189
167 3300025898 Ga0207692_10059412 Ga0207692_100594123 189
168 3300025904 Ga0207647_10001127 Ga0207647_1000112713 189
169 3300025927 Ga0207687_10000274 Ga0207687_1000027423 189
170 3300025927 Ga0207687_10003026 Ga0207687_100030262 189
171 3300025928 Ga0207700_10501543 Ga0207700_105015432 189
172 3300025928 Ga0207700_10518467 Ga0207700_105184672 189
173 3300025929 Ga0207664_10121168 Ga0207664_101211681 189
174 3300025939 Ga0207665_10063448 Ga0207665_100634482 189
175 3300026035 Ga0207703_10052297 Ga0207703_100522972 189
176 3300026041 Ga0207639_10154766 Ga0207639_101547662 189
177 3300026075 Ga0207708_10008166 Ga0207708_100081668 189
178 3300028381 Ga0268264_10035676 Ga0268264_100356763 189
179 3300035116 Ga0373945_0000203 Ga0373945_0000203_12878_13495 189
180 3300035410 Ga0373924_0000036 Ga0373924_0000036_2856_3473 189
181 3300035725 Ga0373947_0002455 Ga0373947_0002455_9276_9887 189
182 3300037853 Ga0436364_0339530 Ga0436364_0339530_226807_227451 189
183 3300050510 nmdc:mga06r32_31276_c1 nmdc:mga06r32_31276_c1_97_714 189
184 3300053085 Ga0495619_0145864 Ga0495619_0145864_524_1126 189
185 3300060353 Ga0501082_0369082 Ga0501082_0369082_595_1212 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03621

MbtH

MbtH-like protein

28

81

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pst-assembly1.cif.gz_X 1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa 0.969 10 69
4gr4-assembly2.cif.gz_B crystal structure of slgn1deltaasub 0.941 14 62
2pst-assembly1.cif.gz_X 1.8a crystal structure of the pa2412 protein from pseudomonas aeruginosa 0.9387 10 69
4gr4-assembly3.cif.gz_C crystal structure of slgn1deltaasub 0.9373 14 63
4gr4-assembly4.cif.gz_D crystal structure of slgn1deltaasub 0.9369 14 62
ID Description Score Start End Superfamily
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.969 10 69 3.90.820.10
2pstX00 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.9387 10 69 3.90.820.10
4gr5B01 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.8825 8 62 3.90.820.10
af_P9WIP5_1_71_3.90.820.10 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.8285 1 71 3.90.820.10
af_P9WIP5_1_71_3.90.820.10 Alpha Beta;Alpha-Beta Complex;Rubredoxin-like;Structural Genomics, Unknown Function 30-nov-00 1gh9 Mol_id 0.807 1 71 3.90.820.10
ID Description Score Start End GO Terms
AF-A0A1I6D286-F1-model_v4 MbtH protein 0.9966 13 66 GO:0005829
GO:0019290
AF-A0A250KQ06-F1-model_v4 MbtH domain protein 0.9955 78 182
AF-A0A553ZRQ2-F1-model_v4 MbtH family protein 0.9955 14 70 GO:0005829
GO:0019290
AF-A0A1I4H7G8-F1-model_v4 MbtH protein 0.9942 12 65 GO:0005829
GO:0019290
AF-A0A7W0HV23-F1-model_v4 MbtH protein 0.9921 12 65 GO:0005829
GO:0019290

Feature Viewer

pLDDT pTM Quality
89.36 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map