F284594

General Info

Members Datasets Scaffolds Average Seq Length
185 138 370 175

Family's Representative Sequence

Representative Sequence 3300031838|Ga0307518_10259029|Ga0307518_102590292
Length 200
Sequence VGGVWCGVRPDSILLRPCCSGAQTVAVLIRREGSADVPVVRAVTAAAFARRGTPVPAEVTLLDELRGCEGWLPELSLVAVNEGDEGDEVVGHVICTRGHIGTVPVLGLGPLSVRPDHQRRGVGLALVHTVLGAADALGEPLVALLGSPAYYGRYGFRPSLEYGITAPDPAYGEYFQVRTLSAYEPALCGTFAYATPFDRL

Samples

Sample ID Description Type Environment
1 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
69 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
125 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
126 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
127 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
128 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
129 2867369537 Streptomyces sp. Z26 Isolate Unclassified
130 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
131 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
132 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
133 8002775197 Frankia nepalensis CN7 Isolate Nodule
134 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
135 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
136 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
137 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
138 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.89
Metatranscriptomes 0
Isolates 8.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.27
Nodule 1.08
Rhizoplane 0.54
Rhizosphere 77.84
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307518_10259029 3300031838 Bacteria 1098
2 rootL2_10000147 3300003322 Bacteria 25941
3 Ga0068869_100059539 3300005334 Bacteria 2796
4 Ga0070709_10262848 3300005434 Bacteria 1247
5 Ga0070714_100044035 3300005435 Bacteria 3777
6 Ga0070714_100227357 3300005435 Bacteria 1717
7 Ga0070714_100273293 3300005435 Bacteria 1567
8 Ga0070713_100222572 3300005436 Bacteria 1712
9 Ga0070713_100236180 3300005436 Archaea 1663
10 Ga0070713_100314378 3300005436 Bacteria 1445
11 Ga0070713_100879788 3300005436 Bacteria 861
12 Ga0070710_10121187 3300005437 Bacteria 1584
13 Ga0070710_10330863 3300005437 Bacteria 1003
14 Ga0070711_100355269 3300005439 Archaea 1179
15 Ga0070706_100292027 3300005467 Bacteria 1521
16 Ga0070707_100124769 3300005468 Unclassified 2501
17 Ga0070699_100106616 3300005518 Bacteria 2458
18 Ga0068853_100039827 3300005539 Bacteria 4008
19 Ga0068853_100186398 3300005539 Bacteria 1884
20 Ga0068852_100239022 3300005616 Bacteria 1735
21 Ga0075365_10072085 3300006038 Bacteria 2327
22 Ga0075365_10193644 3300006038 Bacteria 1423
23 Ga0075365_10530793 3300006038 Unclassified 832
24 Ga0075365_10536183 3300006038 Unclassified 828
25 Ga0075368_10313240 3300006042 Bacteria 679
26 Ga0075363_100030238 3300006048 Bacteria 2802
27 Ga0075363_100114437 3300006048 Bacteria 1502
28 Ga0075364_10066987 3300006051 Bacteria 2359
29 Ga0075364_10442345 3300006051 Bacteria 888
30 Ga0070712_100069135 3300006175 Bacteria 2519
31 Ga0070712_100366507 3300006175 Archaea 1183
32 Ga0075362_10037939 3300006177 Bacteria 2115
33 Ga0075367_10097047 3300006178 Bacteria 1798
34 Ga0075367_10198100 3300006178 Bacteria 1254
35 Ga0075428_101064157 3300006844 Bacteria 855
36 Ga0075430_100296329 3300006846 Bacteria 1338
37 Ga0075431_100228994 3300006847 Bacteria 1894
38 Ga0111539_10874459 3300009094 Unclassified 1045
39 Ga0105238_10026705 3300009551 Bacteria 5886
40 Ga0157375_10835877 3300013308 Bacteria 1068
41 Ga0207692_10188806 3300025898 Bacteria 1205
42 Ga0207654_10326136 3300025911 Bacteria 1051
43 Ga0207663_10209110 3300025916 Archaea 1413
44 Ga0207663_10659217 3300025916 Bacteria 826
45 Ga0207646_10490711 3300025922 Bacteria 1107
46 Ga0207694_10020309 3300025924 Bacteria 5023
47 Ga0207700_10015365 3300025928 Bacteria 5048
48 Ga0207700_10270173 3300025928 Bacteria 1459
49 Ga0207700_10428443 3300025928 Bacteria 1163
50 Ga0207664_10007294 3300025929 Bacteria 7667
51 Ga0207664_10226285 3300025929 Bacteria 1624
52 Ga0207664_10297298 3300025929 Bacteria 1420
53 Ga0207664_10527553 3300025929 Unclassified 1058
54 Ga0207689_10024971 3300025942 Bacteria 5009
55 Ga0207639_10037995 3300026041 Bacteria 3579
56 Ga0207639_10178531 3300026041 Bacteria 1804
57 Ga0207702_10589919 3300026078 Bacteria 1090
58 Ga0307512_10030516 3300030522 Bacteria 4687
59 Ga0307512_10116289 3300030522 Bacteria 1738
60 Ga0307513_10018080 3300031456 Bacteria 8436
61 Ga0307508_10148656 3300031616 Bacteria 1947
62 Ga0307508_10328558 3300031616 Unclassified 1121
63 Ga0307516_10029404 3300031730 Bacteria 5556
64 Ga0307405_10054673 3300031731 Bacteria 2494
65 Ga0307413_10052983 3300031824 Bacteria 2454
66 Ga0307518_10207386 3300031838 Bacteria 1294
67 Ga0307410_10392281 3300031852 Bacteria 1120
68 Ga0307406_10348107 3300031901 Bacteria 1157
69 Ga0307407_10140423 3300031903 Bacteria 1558
70 Ga0307407_10301158 3300031903 Bacteria 1118
71 Ga0307409_100123562 3300031995 Bacteria 2197
72 Ga0307411_10690535 3300032005 Bacteria 888
73 Ga0307415_100042181 3300032126 Bacteria 3035
74 Ga0307507_10072617 3300033179 Bacteria 3099
75 Ga0307510_10115766 3300033180 Bacteria 2404
76 Ga0373937_0255755 3300036401 Bacteria 1651
77 Ga0400483_249751 3300039062 Plasmid 3274
78 Ga0466963_0046038 3300044694 Bacteria 2875
79 Ga0466968_0539260 3300044735 Bacteria 584
80 Ga0466970_0582523 3300044765 Bacteria 648
81 Ga0466958_0066690 3300045836 Bacteria 2198
82 Ga0466967_0253355 3300045976 Bacteria 1682
83 Ga0495592_0138060 3300046454 Bacteria 1698
84 Ga0495603_0009634 3300046455 Bacteria 5839
85 Ga0495629_0605545 3300046459 Bacteria 732
86 Ga0495651_0020317 3300046462 Bacteria 5155
87 Ga0495653_0369088 3300046463 Bacteria 919
88 Ga0495580_0476537 3300046472 Bacteria 835
89 Ga0495582_0134555 3300046473 Bacteria 1398
90 Ga0495662_0003524 3300046476 Bacteria 7910
91 Ga0495662_0033245 3300046476 Bacteria 2492
92 Ga0495662_0255807 3300046476 Bacteria 862
93 Ga0495662_0281682 3300046476 Bacteria 818
94 Ga0495664_0001496 3300046477 Bacteria 12380
95 Ga0495594_0011023 3300046499 Bacteria 4695
96 Ga0495630_0247146 3300046517 Bacteria 1363
97 Ga0495587_0104788 3300046536 Bacteria 1627
98 Ga0495645_0098683 3300046543 Bacteria 2079
99 Ga0495634_0010286 3300046642 Bacteria 6857
100 Ga0495635_0014643 3300046663 Bacteria 5486
101 Ga0495588_0008083 3300046674 Bacteria 4811
102 Ga0495588_0023150 3300046674 Bacteria 3073
103 Ga0495657_0003193 3300046675 Bacteria 13494
104 Ga0495657_0004605 3300046675 Bacteria 11009
105 Ga0495646_0007156 3300046680 Bacteria 7087
106 Ga0495658_0230642 3300046683 Bacteria 1161
107 Ga0495613_0004426 3300046689 Bacteria 10521
108 Ga0495613_0026012 3300046689 Bacteria 4360
109 Ga0495613_0062370 3300046689 Bacteria 2728
110 Ga0495624_0271094 3300046690 Bacteria 1025
111 Ga0495600_0001575 3300046809 Bacteria 12690
112 Ga0495581_0026693 3300047315 Bacteria 3348
113 Ga0495581_0256365 3300047315 Bacteria 1023
114 Ga0495674_0227595 3300047319 Bacteria 1540
115 Ga0495676_0013498 3300047321 Bacteria 7342
116 Ga0495675_0053993 3300047444 Bacteria 2550
117 Ga0495675_0262926 3300047444 Bacteria 1033
118 Ga0495593_0009172 3300047673 Bacteria 5735
119 Ga0495602_0253148 3300048088 Bacteria 1311
120 Ga0495614_0004462 3300048089 Bacteria 6310
121 Ga0501031_0449439 3300049568 Bacteria 832
122 Ga0501032_0004693 3300049569 Bacteria 10258
123 Ga0501032_0525360 3300049569 Bacteria 755
124 Ga0501034_0040559 3300049571 Bacteria 4712
125 Ga0501036_0001946 3300049572 Bacteria 16027
126 Ga0501036_0024353 3300049572 Bacteria 5102
127 Ga0501038_0007410 3300049574 Bacteria 10120
128 Ga0501038_0051325 3300049574 Bacteria 3560
129 Ga0501038_0178172 3300049574 Bacteria 1717
130 Ga0501039_0002302 3300049575 Bacteria 14172
131 Ga0501040_0021775 3300049576 Bacteria 4285
132 Ga0501041_0016773 3300049577 Bacteria 4358
133 Ga0501042_0022954 3300049578 Bacteria 4359
134 Ga0501042_0026966 3300049578 Bacteria 4038
135 Ga0501043_0001474 3300049579 Bacteria 20563
136 Ga0501043_0022066 3300049579 Bacteria 4995
137 Ga0501046_0026024 3300049580 Bacteria 4781
138 Ga0501047_0001834 3300049581 Bacteria 20518
139 Ga0501048_0002840 3300049582 Bacteria 13223
140 Ga0501048_0015420 3300049582 Bacteria 5643
141 Ga0501068_0114139 3300049584 Bacteria 1681
142 Ga0501070_0450184 3300049586 Bacteria 1038
143 Ga0501071_0016227 3300049587 Bacteria 5120
144 Ga0501072_0161469 3300049588 Bacteria 1787
145 Ga0501073_0046626 3300049589 Bacteria 3047
146 Ga0501073_0133517 3300049589 Bacteria 1721
147 Ga0501074_0195814 3300049590 Bacteria 1440
148 Ga0501075_0048744 3300049591 Bacteria 3183
149 Ga0501076_0033039 3300049592 Bacteria 4039
150 Ga0501077_0019508 3300049593 Bacteria 4289
151 Ga0501079_0030890 3300049741 Bacteria 4116
152 Ga0501080_0122420 3300049742 Bacteria 2410
153 Ga0501080_1326958 3300049742 Bacteria 615
154 Ga0501081_0149660 3300049743 Bacteria 1676
155 Ga0501083_0136850 3300049744 Bacteria 1605
156 Ga0501044_0081128 3300049823 Bacteria 3284
157 Ga0501044_0833274 3300049823 Bacteria 800
158 Ga0501045_0005008 3300049824 Bacteria 9181
159 nmdc:mga03683_276890_c1 3300050489 Bacteria 783
160 nmdc:mga03n38_37649_c1 3300050490 Viruses 2088
161 nmdc:mga03n38_92515_c1 3300050490 Unclassified 1443
162 nmdc:mga00v17_65596_c1 3300050491 Bacteria 2241
163 nmdc:mga0yw44_5082_c2 3300050492 Bacteria 1610
164 nmdc:mga0yw44_536555_c1 3300050492 Unclassified 794
165 nmdc:mga07m45_453523_c1 3300050496 Unclassified 743
166 nmdc:mga06r32_418660_c1 3300050510 Bacteria 1321
167 Ga0501084_0012345 3300054114 Bacteria 7076
168 Ga0501082_0026940 3300060353 Bacteria 4952
169 Ga0530510_0007935 3300061734 Bacteria 7406
170 Ga0530510_0242935 3300061734 Bacteria 1341
171 2689992048 2687453743 Bacteria 8361025
172 2774391866 2773857762 Bacteria 5971770
173 2809197329 2808606439 Bacteria 5952208
174 2812352219 2811994878 Bacteria 5992952
175 2816511333 2816332139 Bacteria 9138787
176 2867371910 2867369537 Bacteria 6501581
177 2891970093 2891968417 Bacteria 5821697
178 2946026872 2946024296 Bacteria 3508095
179 2997608242 2997600082 Bacteria 9896405
180 8002777073 8002775197 Bacteria 10728764
181 8047899017 8047893842 Bacteria 11723082
182 8048127619 8048127548 Bacteria 11053136
183 8048359903 8048356638 Bacteria 11044339
184 8048375981 8048369669 Bacteria 11666822
185 8048382139 8048379754 Bacteria 11877923
186 Ga0307518_10259029
187 rootL2_10000147
188 Ga0068869_100059539
189 Ga0070709_10262848
190 Ga0070714_100044035
191 Ga0070714_100227357
192 Ga0070714_100273293
193 Ga0070713_100222572
194 Ga0070713_100236180
195 Ga0070713_100314378
196 Ga0070713_100879788
197 Ga0070710_10121187
198 Ga0070710_10330863
199 Ga0070711_100355269
200 Ga0070706_100292027
201 Ga0070707_100124769
202 Ga0070699_100106616
203 Ga0068853_100039827
204 Ga0068853_100186398
205 Ga0068852_100239022
206 Ga0075365_10072085
207 Ga0075365_10193644
208 Ga0075365_10530793
209 Ga0075365_10536183
210 Ga0075368_10313240
211 Ga0075363_100030238
212 Ga0075363_100114437
213 Ga0075364_10066987
214 Ga0075364_10442345
215 Ga0070712_100069135
216 Ga0070712_100366507
217 Ga0075362_10037939
218 Ga0075367_10097047
219 Ga0075367_10198100
220 Ga0075428_101064157
221 Ga0075430_100296329
222 Ga0075431_100228994
223 Ga0111539_10874459
224 Ga0105238_10026705
225 Ga0157375_10835877
226 Ga0207692_10188806
227 Ga0207654_10326136
228 Ga0207663_10209110
229 Ga0207663_10659217
230 Ga0207646_10490711
231 Ga0207694_10020309
232 Ga0207700_10015365
233 Ga0207700_10270173
234 Ga0207700_10428443
235 Ga0207664_10007294
236 Ga0207664_10226285
237 Ga0207664_10297298
238 Ga0207664_10527553
239 Ga0207689_10024971
240 Ga0207639_10037995
241 Ga0207639_10178531
242 Ga0207702_10589919
243 Ga0307512_10030516
244 Ga0307512_10116289
245 Ga0307513_10018080
246 Ga0307508_10148656
247 Ga0307508_10328558
248 Ga0307516_10029404
249 Ga0307405_10054673
250 Ga0307413_10052983
251 Ga0307518_10207386
252 Ga0307410_10392281
253 Ga0307406_10348107
254 Ga0307407_10140423
255 Ga0307407_10301158
256 Ga0307409_100123562
257 Ga0307411_10690535
258 Ga0307415_100042181
259 Ga0307507_10072617
260 Ga0307510_10115766
261 Ga0373937_0255755
262 Ga0400483_249751
263 Ga0466963_0046038
264 Ga0466968_0539260
265 Ga0466970_0582523
266 Ga0466958_0066690
267 Ga0466967_0253355
268 Ga0495592_0138060
269 Ga0495603_0009634
270 Ga0495629_0605545
271 Ga0495651_0020317
272 Ga0495653_0369088
273 Ga0495580_0476537
274 Ga0495582_0134555
275 Ga0495662_0003524
276 Ga0495662_0033245
277 Ga0495662_0255807
278 Ga0495662_0281682
279 Ga0495664_0001496
280 Ga0495594_0011023
281 Ga0495630_0247146
282 Ga0495587_0104788
283 Ga0495645_0098683
284 Ga0495634_0010286
285 Ga0495635_0014643
286 Ga0495588_0008083
287 Ga0495588_0023150
288 Ga0495657_0003193
289 Ga0495657_0004605
290 Ga0495646_0007156
291 Ga0495658_0230642
292 Ga0495613_0004426
293 Ga0495613_0026012
294 Ga0495613_0062370
295 Ga0495624_0271094
296 Ga0495600_0001575
297 Ga0495581_0026693
298 Ga0495581_0256365
299 Ga0495674_0227595
300 Ga0495676_0013498
301 Ga0495675_0053993
302 Ga0495675_0262926
303 Ga0495593_0009172
304 Ga0495602_0253148
305 Ga0495614_0004462
306 Ga0501031_0449439
307 Ga0501032_0004693
308 Ga0501032_0525360
309 Ga0501034_0040559
310 Ga0501036_0001946
311 Ga0501036_0024353
312 Ga0501038_0007410
313 Ga0501038_0051325
314 Ga0501038_0178172
315 Ga0501039_0002302
316 Ga0501040_0021775
317 Ga0501041_0016773
318 Ga0501042_0022954
319 Ga0501042_0026966
320 Ga0501043_0001474
321 Ga0501043_0022066
322 Ga0501046_0026024
323 Ga0501047_0001834
324 Ga0501048_0002840
325 Ga0501048_0015420
326 Ga0501068_0114139
327 Ga0501070_0450184
328 Ga0501071_0016227
329 Ga0501072_0161469
330 Ga0501073_0046626
331 Ga0501073_0133517
332 Ga0501074_0195814
333 Ga0501075_0048744
334 Ga0501076_0033039
335 Ga0501077_0019508
336 Ga0501079_0030890
337 Ga0501080_0122420
338 Ga0501080_1326958
339 Ga0501081_0149660
340 Ga0501083_0136850
341 Ga0501044_0081128
342 Ga0501044_0833274
343 Ga0501045_0005008
344 nmdc:mga03683_276890_c1
345 nmdc:mga03n38_37649_c1
346 nmdc:mga03n38_92515_c1
347 nmdc:mga00v17_65596_c1
348 nmdc:mga0yw44_5082_c2
349 nmdc:mga0yw44_536555_c1
350 nmdc:mga07m45_453523_c1
351 nmdc:mga06r32_418660_c1
352 Ga0501084_0012345
353 Ga0501082_0026940
354 Ga0530510_0007935
355 Ga0530510_0242935
356 2689992048
357 2774391866
358 2809197329
359 2812352219
360 2816511333
361 2867371910
362 2891970093
363 2946026872
364 2997608242
365 8002777073
366 8047899017
367 8048127619
368 8048359903
369 8048375981
370 8048382139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

47

156

0.78

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

29

159

0.73

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

73

158

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.9039 2 181
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.8919 3 185
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.8816 2 181
6yca-assembly1.cif.gz_D crystal structure of eis1 from mycobacterium abscessus 0.861 2 144
3n7z-assembly1.cif.gz_E crystal structure of acetyltransferase from bacillus anthracis 0.8578 4 143
ID Description Score Start End Superfamily
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9181 4 183 3.40.630.30
4zbgA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9037 2 181 3.40.630.30
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.903 4 183 3.40.630.30
af_P39368_4_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8852 1 180 3.40.630.30
4zbgA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8815 2 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2S6GPI6-F1-model_v4 Acetyltransferase 0.9836 113 183
AF-A0A0S7CRU2-F1-model_v4 Uncharacterized N-acetyltransferase YjhQ 0.9712 44 183 GO:0016747
AF-A0A6M1QT75-F1-model_v4 deleted 0.9695 4 183
AF-A0A1B1KBV7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9693 2 183 GO:0016747
AF-A0A1G9QDQ3-F1-model_v4 Putative acetyltransferase 0.9686 68 182 GO:0016747

Map