F284559

General Info

Members Datasets Scaffolds Average Seq Length
185 161 370 320

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000929|Ga0307513_100009293
Length 358
Sequence VLLTRIGVSRSCGHRSPTTMGQNATMHQVPAKKVVAILALDGVLPFELSVPGQVFGTANLAMPTPHYEVRVCAERRTVTTSADHGSFLLHTPWGLDALTEADTIVIPGHSGFLEPPPNSVLRALSEAALRGARLASVCIGAFTLAATGLLDGHRATTHWQHADELARRHPHIDVDPAVLFIDNGSLITSAGIAAGLDMCLHLVRRDLGADLAAATARRTVMPLQRDGGQAQFIEHADPCVYDTSLQPTLHWMESNLHRPLPLGEIAEHSAMSVRSLNRRFRAQTGTTPLQWLLRARVHRAQQLLETTDIPIDHVADLAGFGSPTTLRHHFARLTGTSPHAYRTAFHSQQTRISAHAME

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
96 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
138 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
139 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
140 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
141 2643221593 Lysobacter sp. Root690 Isolate Unclassified
142 2643221641 Nocardioides sp. Root122 Isolate Unclassified
143 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
144 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
145 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
146 2791355264 Rhizobium sp. S9 Isolate Nodule
147 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
148 2857558681 Duganella sp. R-74565 Isolate Unclassified
149 2858868258 Micromonospora sp. MH33 Isolate Unclassified
150 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
151 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
152 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
153 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
154 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
155 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
156 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
157 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
158 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
159 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
160 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
161 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.03
Metatranscriptomes 0
Isolates 12.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 2.16
Rhizoplane 11.89
Rhizosphere 68.65
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000929 3300031456 Bacteria 42318
2 rootH2_10167645 3300003320 Bacteria 3933
3 JGI25160J50197_1007639 3300003354 Bacteria 4213
4 Ga0070690_100030185 3300005330 Bacteria 3367
5 Ga0070689_100059116 3300005340 Bacteria 2979
6 Ga0070691_10039892 3300005341 Bacteria 2219
7 Ga0070668_100014989 3300005347 Bacteria 5790
8 Ga0070675_100156023 3300005354 Bacteria 1960
9 Ga0070673_100046243 3300005364 Bacteria 3379
10 Ga0070659_100067502 3300005366 Bacteria 2836
11 Ga0070667_100085439 3300005367 Bacteria 2706
12 Ga0070709_10214897 3300005434 Bacteria 1368
13 Ga0070701_10031696 3300005438 Bacteria 2625
14 Ga0070705_100022538 3300005440 Bacteria 3366
15 Ga0070700_100049245 3300005441 Bacteria 2615
16 Ga0070694_100035949 3300005444 Bacteria 3278
17 Ga0070663_100163830 3300005455 Bacteria 1713
18 Ga0070678_100146660 3300005456 Bacteria 1895
19 Ga0070685_10095645 3300005466 Bacteria 1806
20 Ga0070707_100210852 3300005468 Bacteria 1893
21 Ga0070699_100156945 3300005518 Bacteria 2013
22 Ga0068853_100020256 3300005539 Bacteria 5530
23 Ga0070695_100030272 3300005545 Bacteria 3369
24 Ga0068856_100545563 3300005614 Bacteria 1180
25 Ga0068852_100134487 3300005616 Bacteria 2281
26 Ga0068864_100275694 3300005618 Bacteria 1568
27 Ga0068861_100078275 3300005719 Bacteria 2581
28 Ga0068870_10195347 3300005840 Bacteria 1223
29 Ga0068863_100229683 3300005841 Bacteria 1789
30 Ga0068860_100219632 3300005843 Bacteria 1845
31 Ga0081540_1002807 3300005983 Bacteria 14102
32 Ga0081539_10011311 3300005985 Bacteria 7084
33 Ga0075364_10156000 3300006051 Bacteria 1540
34 Ga0075432_10021191 3300006058 Bacteria 2222
35 Ga0070716_100011374 3300006173 Bacteria 4480
36 Ga0097621_100123328 3300006237 Bacteria 2199
37 Ga0075430_100001609 3300006846 Bacteria 18430
38 Ga0075430_100146213 3300006846 Bacteria 1969
39 Ga0075431_100001855 3300006847 Bacteria 20014
40 Ga0075431_100015881 3300006847 Bacteria 7635
41 Ga0075434_100445872 3300006871 Bacteria 1315
42 Ga0075429_100001285 3300006880 Bacteria 20442
43 Ga0068865_100040258 3300006881 Bacteria 3174
44 Ga0075436_100112877 3300006914 Bacteria 1897
45 Ga0111539_10319938 3300009094 Bacteria 1805
46 Ga0105247_10047970 3300009101 Bacteria 2624
47 Ga0114129_10436090 3300009147 Bacteria 1721
48 Ga0105241_10064430 3300009174 Bacteria 2829
49 Ga0105238_10177125 3300009551 Bacteria 2109
50 Ga0105249_10068027 3300009553 Bacteria 3284
51 Ga0105239_10643996 3300010375 Bacteria 1210
52 Ga0157373_10146840 3300013100 Bacteria 1659
53 Ga0157370_10118805 3300013104 Bacteria 2469
54 Ga0157374_10051648 3300013296 Bacteria 3826
55 Ga0157378_10105499 3300013297 Bacteria 2577
56 Ga0163162_10026942 3300013306 Bacteria 5683
57 Ga0157372_10298654 3300013307 Bacteria 1873
58 Ga0157375_10660829 3300013308 Bacteria 1201
59 Ga0157380_10086721 3300014326 Bacteria 2573
60 Ga0157379_10102988 3300014968 Bacteria 2562
61 Ga0163161_10010895 3300017792 Bacteria 6305
62 Ga0207688_10042892 3300025901 Bacteria 2518
63 Ga0207643_10108293 3300025908 Bacteria 1635
64 Ga0207654_10163271 3300025911 Bacteria 1441
65 Ga0207671_10069019 3300025914 Bacteria 2635
66 Ga0207693_10006578 3300025915 Bacteria 9620
67 Ga0207694_10164375 3300025924 Bacteria 1794
68 Ga0207687_10096904 3300025927 Bacteria 2163
69 Ga0207664_10253344 3300025929 Bacteria 1537
70 Ga0207644_10149755 3300025931 Bacteria 1805
71 Ga0207669_10122723 3300025937 Bacteria 1767
72 Ga0207665_10020696 3300025939 Bacteria 4325
73 Ga0207689_10188648 3300025942 Bacteria 1701
74 Ga0207651_10046011 3300025960 Bacteria 2931
75 Ga0207712_10078412 3300025961 Bacteria 2397
76 Ga0207668_10156654 3300025972 Bacteria 1770
77 Ga0207703_10481191 3300026035 Bacteria 1163
78 Ga0207639_10024216 3300026041 Bacteria 4390
79 Ga0207678_10028421 3300026067 Bacteria 4882
80 Ga0207708_10089059 3300026075 Bacteria 2378
81 Ga0207702_10154562 3300026078 Bacteria 2090
82 Ga0207641_10150676 3300026088 Bacteria 2106
83 Ga0207676_10087578 3300026095 Bacteria 2547
84 Ga0207674_10203070 3300026116 Bacteria 1931
85 Ga0207675_100047713 3300026118 Bacteria 3998
86 Ga0207683_10011092 3300026121 Bacteria 7680
87 Ga0268266_10007774 3300028379 Bacteria 9613
88 Ga0268266_10096030 3300028379 Bacteria 2604
89 Ga0307517_10137765 3300028786 Bacteria 1728
90 Ga0307515_10022938 3300028794 Bacteria 10977
91 Ga0307515_10027426 3300028794 Bacteria 9735
92 Ga0307511_10001458 3300030521 Bacteria 24986
93 Ga0307511_10007422 3300030521 Bacteria 11030
94 Ga0307511_10030368 3300030521 Unclassified 4857
95 Ga0307512_10003254 3300030522 Bacteria 19142
96 Ga0307512_10004942 3300030522 Bacteria 14217
97 Ga0307512_10049137 3300030522 Bacteria 3405
98 Ga0265327_10000064 3300031251 Bacteria 231983
99 Ga0265327_10005264 3300031251 Bacteria 10897
100 Ga0307513_10003695 3300031456 Bacteria 20694
101 Ga0307513_10018371 3300031456 Bacteria 8358
102 Ga0307513_10083520 3300031456 Bacteria 3284
103 Ga0307514_10041848 3300031649 Bacteria 3606
104 Ga0265314_10050666 3300031711 Bacteria 2897
105 Ga0307518_10141320 3300031838 Bacteria 1679
106 Ga0307510_10108071 3300033180 Bacteria 2537
107 Ga0373928_0012630 3300035084 Bacteria 1687
108 Ga0373951_0007484 3300035091 Bacteria 2479
109 Ga0373932_0008278 3300035112 Bacteria 2484
110 Ga0373962_0026625 3300035242 Bacteria 1560
111 Ga0373931_0023753 3300035691 Bacteria 3097
112 Ga0373937_0003024 3300036401 Bacteria 14098
113 Ga0451789_0159397 3300041443 Bacteria 1438
114 Ga0466967_0191307 3300045976 Bacteria 1934
115 Ga0495610_0006325 3300046512 Bacteria 8192
116 Ga0495589_0000093 3300046794 Bacteria 85338
117 Ga0496100_0141501 3300048903 Bacteria 1706
118 Ga0496101_0075407 3300048904 Bacteria 2483
119 Ga0496101_0117683 3300048904 Bacteria 2006
120 Ga0496102_0009841 3300048905 Bacteria 8222
121 Ga0496102_0150713 3300048905 Bacteria 2185
122 Ga0496103_0102520 3300048906 Bacteria 1812
123 Ga0496104_0028976 3300048907 Bacteria 5134
124 Ga0496104_0085351 3300048907 Bacteria 3013
125 Ga0496105_0058664 3300048908 Bacteria 3176
126 Ga0496108_0001457 3300048911 Bacteria 18707
127 Ga0496108_0049724 3300048911 Bacteria 3506
128 Ga0496109_0015660 3300048912 Bacteria 6614
129 Ga0496109_0193441 3300048912 Bacteria 1911
130 Ga0496110_0002746 3300048913 Bacteria 13290
131 Ga0496110_0074930 3300048913 Bacteria 3006
132 Ga0496111_0063575 3300048914 Bacteria 2676
133 Ga0496111_0079007 3300048914 Bacteria 2399
134 Ga0496113_0077707 3300048916 Bacteria 2538
135 Ga0496113_0387088 3300048916 Bacteria 1122
136 Ga0496114_0061776 3300048917 Bacteria 3134
137 Ga0496115_0096843 3300048918 Bacteria 2416
138 Ga0496121_0062963 3300048924 Bacteria 3035
139 Ga0501033_0243659 3300049570 Bacteria 1275
140 Ga0501034_0283053 3300049571 Bacteria 1597
141 Ga0501037_0157553 3300049573 Bacteria 1620
142 Ga0501038_0087320 3300049574 Bacteria 2619
143 Ga0501038_0371510 3300049574 Bacteria 1111
144 Ga0501039_0096461 3300049575 Bacteria 2305
145 Ga0501039_0213530 3300049575 Bacteria 1517
146 Ga0501046_0028843 3300049580 Bacteria 4516
147 Ga0501047_0059162 3300049581 Bacteria 3700
148 Ga0501035_0017718 3300049822 Bacteria 6568
149 Ga0501044_0049972 3300049823 Bacteria 4316
150 Ga0501044_0166995 3300049823 Bacteria 2174
151 Ga0501044_0175330 3300049823 Bacteria 2113
152 Ga0501045_0238039 3300049824 Bacteria 1355
153 nmdc:mga05p37_476534_c1 3300050507 Bacteria 1439
154 nmdc:mga0qj67_1806_c1 3300050509 Bacteria 15123
155 nmdc:mga06r32_13404_c1 3300050510 Bacteria 7423
156 nmdc:mga08y16_447900_c1 3300050511 Bacteria 1317
157 nmdc:mga0n895_16398_c1 3300050512 Bacteria 6796
158 nmdc:mga08x19_18138_c1 3300050514 Bacteria 4312
159 nmdc:mga0a205_47198_c1 3300050515 Bacteria 4155
160 Ga0500635_0000059 3300053080 Bacteria 72321
161 Ga0500646_0000113 3300053090 Bacteria 23019
162 2547409515 2547132111 Bacteria 8013147
163 2552109953 2551306166 Bacteria 9731570
164 2558912722 2558860112 Bacteria 9931328
165 2643974721 2643221593 Bacteria 6296053
166 2644231045 2643221641 Bacteria 4490190
167 2689993861 2687453743 Bacteria 8361025
168 2760306039 2758568522 Bacteria 5953541
169 2791910865 2791354901 Bacteria 8322202
170 2793349654 2791355264 Bacteria 6429314
171 2804845265 2802429296 Bacteria 7227771
172 2857562884 2857558681 Bacteria 6617694
173 2858870495 2858868258 Bacteria 7683772
174 2862186087 2862178590 Bacteria 8583590
175 2873315495 2873314349 Bacteria 8512634
176 3006323226 3006321560 Bacteria 8247479
177 8025415481 8025413630 Bacteria 7014048
178 8047713736 8047710418 Bacteria 11023148
179 8054610295 8054609563 Bacteria 5170090
180 8055074121 8055066027 Bacteria 9479577
181 8055173032 8055172936 Bacteria 9305943
182 8055419081 8055412473 Bacteria 6257500
183 8056210305 8056207758 Bacteria 8639239
184 8056581270 8056579771 Bacteria 5840325
185 8056670293 8056667051 Bacteria 6953971
186 Ga0307513_10000929
187 rootH2_10167645
188 JGI25160J50197_1007639
189 Ga0070690_100030185
190 Ga0070689_100059116
191 Ga0070691_10039892
192 Ga0070668_100014989
193 Ga0070675_100156023
194 Ga0070673_100046243
195 Ga0070659_100067502
196 Ga0070667_100085439
197 Ga0070709_10214897
198 Ga0070701_10031696
199 Ga0070705_100022538
200 Ga0070700_100049245
201 Ga0070694_100035949
202 Ga0070663_100163830
203 Ga0070678_100146660
204 Ga0070685_10095645
205 Ga0070707_100210852
206 Ga0070699_100156945
207 Ga0068853_100020256
208 Ga0070695_100030272
209 Ga0068856_100545563
210 Ga0068852_100134487
211 Ga0068864_100275694
212 Ga0068861_100078275
213 Ga0068870_10195347
214 Ga0068863_100229683
215 Ga0068860_100219632
216 Ga0081540_1002807
217 Ga0081539_10011311
218 Ga0075364_10156000
219 Ga0075432_10021191
220 Ga0070716_100011374
221 Ga0097621_100123328
222 Ga0075430_100001609
223 Ga0075430_100146213
224 Ga0075431_100001855
225 Ga0075431_100015881
226 Ga0075434_100445872
227 Ga0075429_100001285
228 Ga0068865_100040258
229 Ga0075436_100112877
230 Ga0111539_10319938
231 Ga0105247_10047970
232 Ga0114129_10436090
233 Ga0105241_10064430
234 Ga0105238_10177125
235 Ga0105249_10068027
236 Ga0105239_10643996
237 Ga0157373_10146840
238 Ga0157370_10118805
239 Ga0157374_10051648
240 Ga0157378_10105499
241 Ga0163162_10026942
242 Ga0157372_10298654
243 Ga0157375_10660829
244 Ga0157380_10086721
245 Ga0157379_10102988
246 Ga0163161_10010895
247 Ga0207688_10042892
248 Ga0207643_10108293
249 Ga0207654_10163271
250 Ga0207671_10069019
251 Ga0207693_10006578
252 Ga0207694_10164375
253 Ga0207687_10096904
254 Ga0207664_10253344
255 Ga0207644_10149755
256 Ga0207669_10122723
257 Ga0207665_10020696
258 Ga0207689_10188648
259 Ga0207651_10046011
260 Ga0207712_10078412
261 Ga0207668_10156654
262 Ga0207703_10481191
263 Ga0207639_10024216
264 Ga0207678_10028421
265 Ga0207708_10089059
266 Ga0207702_10154562
267 Ga0207641_10150676
268 Ga0207676_10087578
269 Ga0207674_10203070
270 Ga0207675_100047713
271 Ga0207683_10011092
272 Ga0268266_10007774
273 Ga0268266_10096030
274 Ga0307517_10137765
275 Ga0307515_10022938
276 Ga0307515_10027426
277 Ga0307511_10001458
278 Ga0307511_10007422
279 Ga0307511_10030368
280 Ga0307512_10003254
281 Ga0307512_10004942
282 Ga0307512_10049137
283 Ga0265327_10000064
284 Ga0265327_10005264
285 Ga0307513_10003695
286 Ga0307513_10018371
287 Ga0307513_10083520
288 Ga0307514_10041848
289 Ga0265314_10050666
290 Ga0307518_10141320
291 Ga0307510_10108071
292 Ga0373928_0012630
293 Ga0373951_0007484
294 Ga0373932_0008278
295 Ga0373962_0026625
296 Ga0373931_0023753
297 Ga0373937_0003024
298 Ga0451789_0159397
299 Ga0466967_0191307
300 Ga0495610_0006325
301 Ga0495589_0000093
302 Ga0496100_0141501
303 Ga0496101_0075407
304 Ga0496101_0117683
305 Ga0496102_0009841
306 Ga0496102_0150713
307 Ga0496103_0102520
308 Ga0496104_0028976
309 Ga0496104_0085351
310 Ga0496105_0058664
311 Ga0496108_0001457
312 Ga0496108_0049724
313 Ga0496109_0015660
314 Ga0496109_0193441
315 Ga0496110_0002746
316 Ga0496110_0074930
317 Ga0496111_0063575
318 Ga0496111_0079007
319 Ga0496113_0077707
320 Ga0496113_0387088
321 Ga0496114_0061776
322 Ga0496115_0096843
323 Ga0496121_0062963
324 Ga0501033_0243659
325 Ga0501034_0283053
326 Ga0501037_0157553
327 Ga0501038_0087320
328 Ga0501038_0371510
329 Ga0501039_0096461
330 Ga0501039_0213530
331 Ga0501046_0028843
332 Ga0501047_0059162
333 Ga0501035_0017718
334 Ga0501044_0049972
335 Ga0501044_0166995
336 Ga0501044_0175330
337 Ga0501045_0238039
338 nmdc:mga05p37_476534_c1
339 nmdc:mga0qj67_1806_c1
340 nmdc:mga06r32_13404_c1
341 nmdc:mga08y16_447900_c1
342 nmdc:mga0n895_16398_c1
343 nmdc:mga08x19_18138_c1
344 nmdc:mga0a205_47198_c1
345 Ga0500635_0000059
346 Ga0500646_0000113
347 2547409515
348 2552109953
349 2558912722
350 2643974721
351 2644231045
352 2689993861
353 2760306039
354 2791910865
355 2793349654
356 2804845265
357 2857562884
358 2858870495
359 2862186087
360 2873315495
361 3006323226
362 8025415481
363 8047713736
364 8054610295
365 8055074121
366 8055173032
367 8055419081
368 8056210305
369 8056581270
370 8056670293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

252

293

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

304

343

0.96

PF12833

HTH_18

Helix-turn-helix domain

265

344

0.96

PF01965

DJ-1_PfpI

DJ-1/PfpI family

32

205

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9577 216 314
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9445 216 323
3lsg-assembly3.cif.gz_E the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9437 216 304
3lsg-assembly2.cif.gz_D the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9315 216 304
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9216 217 316
ID Description Score Start End Superfamily
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9881 266 318 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9849 270 314 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.971 268 315 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9613 270 314 1.10.10.60
5suwA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.961 265 319 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7Y9BDR8-F1-model_v4 AraC family transcriptional regulator 0.9819 216 319 GO:0003700
GO:0043565
AF-A0A258V5V2-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9769 216 318 GO:0003700
GO:0043565
AF-A0A351DIL8-F1-model_v4 deleted 0.9764 216 315
AF-A0A7C6WMJ3-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9751 216 317 GO:0003700
GO:0043565
AF-A0A355RZS5-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9746 216 318 GO:0003700
GO:0043565

Map