F284308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 124 | 185 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10053657|Ga0105239_100536572 |
| Length | 120 |
| Sequence | VTIFGRLIWYQNFLKELIMKKAVIATGGKQYLVSEGETLNVELLAGEKGKVVFDALLVLDGDKVSVGAPLVDKVKVNADIVAEDVQADKVTSIRYKAKKRVHTVRGHRQHQTTLKIVSIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 34 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 35 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 87 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 93 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 98 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 106 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 109 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 110 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 111 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 112 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 113 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 114 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 115 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 116 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 117 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 118 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 119 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 120 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 121 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 122 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 123 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 124 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.97 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1013566 | 3300001904 | Bacteria | 1315 |
| 2 | JGI25406J46586_10093794 | 3300003203 | Unclassified | 902 |
| 3 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 4 | rootH2_10318553 | 3300003320 | Bacteria | 1286 |
| 5 | rootH2_10326631 | 3300003320 | Bacteria | 2221 |
| 6 | Ga0070658_10074095 | 3300005327 | Unclassified | 2792 |
| 7 | Ga0070658_11093725 | 3300005327 | Bacteria | 693 |
| 8 | Ga0070676_10017908 | 3300005328 | Bacteria | 3922 |
| 9 | Ga0070683_100000092 | 3300005329 | Bacteria | 59204 |
| 10 | Ga0070666_10004544 | 3300005335 | Bacteria | 8456 |
| 11 | Ga0070666_10091071 | 3300005335 | Bacteria | 2095 |
| 12 | Ga0070682_100385742 | 3300005337 | Bacteria | 1055 |
| 13 | Ga0070660_100634603 | 3300005339 | Unclassified | 894 |
| 14 | Ga0070691_10749656 | 3300005341 | Unclassified | 590 |
| 15 | Ga0070687_100565814 | 3300005343 | Bacteria | 776 |
| 16 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 17 | Ga0070671_100092129 | 3300005355 | Bacteria | 2539 |
| 18 | Ga0070667_100007022 | 3300005367 | Bacteria | 9360 |
| 19 | Ga0070714_100000272 | 3300005435 | Bacteria | 39469 |
| 20 | Ga0070710_11456437 | 3300005437 | Unclassified | 513 |
| 21 | Ga0070663_100252071 | 3300005455 | Bacteria | 1397 |
| 22 | Ga0070679_100002396 | 3300005530 | Bacteria | 16994 |
| 23 | Ga0070679_100355582 | 3300005530 | Bacteria | 1412 |
| 24 | Ga0070679_100473734 | 3300005530 | Bacteria | 1196 |
| 25 | Ga0070679_100544436 | 3300005530 | Unclassified | 1104 |
| 26 | Ga0070679_101113486 | 3300005530 | Bacteria | 734 |
| 27 | Ga0070684_100001935 | 3300005535 | Bacteria | 15200 |
| 28 | Ga0068853_100008619 | 3300005539 | Bacteria | 8199 |
| 29 | Ga0070686_101233310 | 3300005544 | Unclassified | 622 |
| 30 | Ga0070696_101202684 | 3300005546 | Bacteria | 640 |
| 31 | Ga0070665_100081393 | 3300005548 | Bacteria | 3244 |
| 32 | Ga0068855_100025575 | 3300005563 | Bacteria | 7060 |
| 33 | Ga0068855_100040488 | 3300005563 | Bacteria | 5531 |
| 34 | Ga0068855_100230906 | 3300005563 | Bacteria | 2072 |
| 35 | Ga0068857_100068932 | 3300005577 | Bacteria | 3149 |
| 36 | Ga0068856_100004168 | 3300005614 | Bacteria | 14441 |
| 37 | Ga0068856_100982820 | 3300005614 | Unclassified | 862 |
| 38 | Ga0068859_100256123 | 3300005617 | Bacteria | 1841 |
| 39 | Ga0068859_100341590 | 3300005617 | Bacteria | 1591 |
| 40 | Ga0068859_100390472 | 3300005617 | Bacteria | 1487 |
| 41 | Ga0068863_100077666 | 3300005841 | Bacteria | 3142 |
| 42 | Ga0068863_101360068 | 3300005841 | Unclassified | 717 |
| 43 | Ga0068858_100326711 | 3300005842 | Bacteria | 1467 |
| 44 | Ga0068860_100015680 | 3300005843 | Bacteria | 7399 |
| 45 | Ga0081539_10201015 | 3300005985 | Unclassified | 920 |
| 46 | Ga0070717_10136484 | 3300006028 | Bacteria | 2113 |
| 47 | Ga0075364_11033493 | 3300006051 | Unclassified | 558 |
| 48 | Ga0075362_10444108 | 3300006177 | Unclassified | 658 |
| 49 | Ga0075366_10000354 | 3300006195 | Bacteria | 21047 |
| 50 | Ga0097621_100000213 | 3300006237 | Bacteria | 38241 |
| 51 | Ga0075370_10041634 | 3300006353 | Bacteria | 2593 |
| 52 | Ga0068871_100000980 | 3300006358 | Bacteria | 19120 |
| 53 | Ga0097620_100256117 | 3300006931 | Bacteria | 1841 |
| 54 | Ga0097620_100341595 | 3300006931 | Bacteria | 1591 |
| 55 | Ga0097620_100390476 | 3300006931 | Bacteria | 1487 |
| 56 | Ga0105240_10382685 | 3300009093 | Bacteria | 1589 |
| 57 | Ga0105240_10804048 | 3300009093 | Bacteria | 1018 |
| 58 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 59 | Ga0105245_10005282 | 3300009098 | Bacteria | 11343 |
| 60 | Ga0105245_10099263 | 3300009098 | Bacteria | 2691 |
| 61 | Ga0105247_10425128 | 3300009101 | Bacteria | 952 |
| 62 | Ga0105241_10000007 | 3300009174 | Bacteria | 343524 |
| 63 | Ga0105241_11270607 | 3300009174 | Unclassified | 700 |
| 64 | Ga0105242_10008574 | 3300009176 | Bacteria | 7849 |
| 65 | Ga0105242_10757269 | 3300009176 | Bacteria | 957 |
| 66 | Ga0105242_11841868 | 3300009176 | Bacteria | 644 |
| 67 | Ga0105248_10174045 | 3300009177 | Bacteria | 2426 |
| 68 | Ga0105248_10311636 | 3300009177 | Bacteria | 1772 |
| 69 | Ga0105237_10324111 | 3300009545 | Unclassified | 1544 |
| 70 | Ga0105238_10253788 | 3300009551 | Bacteria | 1737 |
| 71 | Ga0105238_11706495 | 3300009551 | Bacteria | 661 |
| 72 | Ga0105239_10053657 | 3300010375 | Bacteria | 4421 |
| 73 | Ga0105239_11877168 | 3300010375 | Unclassified | 695 |
| 74 | Ga0157369_10000104 | 3300013105 | Bacteria | 118133 |
| 75 | Ga0157369_10017913 | 3300013105 | Bacteria | 7950 |
| 76 | Ga0157374_10000018 | 3300013296 | Bacteria | 286683 |
| 77 | Ga0157374_10034747 | 3300013296 | Bacteria | 4607 |
| 78 | Ga0157374_10230362 | 3300013296 | Bacteria | 1820 |
| 79 | Ga0157374_10723310 | 3300013296 | Bacteria | 1009 |
| 80 | Ga0157374_11371875 | 3300013296 | Bacteria | 729 |
| 81 | Ga0157374_11768227 | 3300013296 | Bacteria | 643 |
| 82 | Ga0157378_10334433 | 3300013297 | Bacteria | 1475 |
| 83 | Ga0157372_10000356 | 3300013307 | Bacteria | 50272 |
| 84 | Ga0157372_11631445 | 3300013307 | Unclassified | 742 |
| 85 | Ga0157375_11588369 | 3300013308 | Unclassified | 773 |
| 86 | Ga0157377_10045699 | 3300014745 | Bacteria | 2447 |
| 87 | Ga0157377_10051304 | 3300014745 | Bacteria | 2326 |
| 88 | Ga0207680_10013338 | 3300025903 | Unclassified | 4219 |
| 89 | Ga0207680_10117189 | 3300025903 | Bacteria | 1737 |
| 90 | Ga0207680_10256250 | 3300025903 | Bacteria | 1210 |
| 91 | Ga0207647_10008895 | 3300025904 | Bacteria | 7161 |
| 92 | Ga0207645_10024344 | 3300025907 | Bacteria | 3927 |
| 93 | Ga0207705_10865649 | 3300025909 | Bacteria | 700 |
| 94 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 95 | Ga0207707_10551673 | 3300025912 | Unclassified | 979 |
| 96 | Ga0207695_11338369 | 3300025913 | Unclassified | 596 |
| 97 | Ga0207671_10246720 | 3300025914 | Unclassified | 1403 |
| 98 | Ga0207660_10109629 | 3300025917 | Unclassified | 2075 |
| 99 | Ga0207662_10475408 | 3300025918 | Bacteria | 858 |
| 100 | Ga0207657_10018032 | 3300025919 | Bacteria | 6753 |
| 101 | Ga0207652_10039906 | 3300025921 | Unclassified | 3985 |
| 102 | Ga0207652_11557474 | 3300025921 | Bacteria | 565 |
| 103 | Ga0207681_10593717 | 3300025923 | Bacteria | 914 |
| 104 | Ga0207694_10166875 | 3300025924 | Bacteria | 1781 |
| 105 | Ga0207650_11059995 | 3300025925 | Unclassified | 690 |
| 106 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 107 | Ga0207687_10000008 | 3300025927 | Bacteria | 497738 |
| 108 | Ga0207687_10003138 | 3300025927 | Bacteria | 11208 |
| 109 | Ga0207664_10000578 | 3300025929 | Bacteria | 25609 |
| 110 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 111 | Ga0207644_10041014 | 3300025931 | Bacteria | 3273 |
| 112 | Ga0207686_11029799 | 3300025934 | Bacteria | 669 |
| 113 | Ga0207711_10029854 | 3300025941 | Bacteria | 4599 |
| 114 | Ga0207711_10724306 | 3300025941 | Bacteria | 928 |
| 115 | Ga0207661_10000083 | 3300025944 | Bacteria | 66112 |
| 116 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 117 | Ga0207667_10017167 | 3300025949 | Bacteria | 8159 |
| 118 | Ga0207667_10072243 | 3300025949 | Bacteria | 3587 |
| 119 | Ga0207667_10319892 | 3300025949 | Bacteria | 1585 |
| 120 | Ga0207667_11628149 | 3300025949 | Unclassified | 614 |
| 121 | Ga0207712_11956738 | 3300025961 | Bacteria | 525 |
| 122 | Ga0207658_10017900 | 3300025986 | Bacteria | 4884 |
| 123 | Ga0207703_10705579 | 3300026035 | Unclassified | 960 |
| 124 | Ga0207639_10002872 | 3300026041 | Bacteria | 11570 |
| 125 | Ga0207708_12043289 | 3300026075 | Unclassified | 502 |
| 126 | Ga0207702_10000527 | 3300026078 | Bacteria | 42758 |
| 127 | Ga0207702_10005986 | 3300026078 | Bacteria | 10561 |
| 128 | Ga0207702_10736718 | 3300026078 | Unclassified | 972 |
| 129 | Ga0207641_10046552 | 3300026088 | Bacteria | 3656 |
| 130 | Ga0207641_11845170 | 3300026088 | Unclassified | 606 |
| 131 | Ga0209998_10170509 | 3300027717 | Bacteria | 564 |
| 132 | Ga0268264_10073467 | 3300028381 | Bacteria | 2903 |
| 133 | Ga0265337_1001397 | 3300028556 | Bacteria | 11850 |
| 134 | Ga0265337_1012550 | 3300028556 | Bacteria | 2875 |
| 135 | Ga0265326_10022141 | 3300028558 | Bacteria | 1821 |
| 136 | Ga0265334_10008768 | 3300028573 | Bacteria | 4296 |
| 137 | Ga0265334_10062562 | 3300028573 | Bacteria | 1400 |
| 138 | Ga0265336_10000075 | 3300028666 | Bacteria | 81725 |
| 139 | Ga0265336_10008349 | 3300028666 | Bacteria | 3636 |
| 140 | Ga0265336_10012826 | 3300028666 | Bacteria | 2809 |
| 141 | Ga0265338_10000340 | 3300028800 | Bacteria | 85032 |
| 142 | Ga0265338_10003906 | 3300028800 | Bacteria | 20584 |
| 143 | Ga0265338_10005822 | 3300028800 | Bacteria | 15904 |
| 144 | Ga0265338_10040880 | 3300028800 | Bacteria | 4346 |
| 145 | Ga0265332_10187748 | 3300031238 | Bacteria | 860 |
| 146 | Ga0265320_10157686 | 3300031240 | Bacteria | 1023 |
| 147 | Ga0265325_10006366 | 3300031241 | Bacteria | 7170 |
| 148 | Ga0265325_10332706 | 3300031241 | Bacteria | 673 |
| 149 | Ga0265339_10183708 | 3300031249 | Unclassified | 1040 |
| 150 | Ga0265331_10139129 | 3300031250 | Bacteria | 1105 |
| 151 | Ga0265327_10001541 | 3300031251 | Bacteria | 28417 |
| 152 | Ga0265327_10013938 | 3300031251 | Bacteria | 5299 |
| 153 | Ga0265316_10023987 | 3300031344 | Bacteria | 5122 |
| 154 | Ga0265316_10127050 | 3300031344 | Bacteria | 1922 |
| 155 | Ga0265313_10108787 | 3300031595 | Bacteria | 1221 |
| 156 | Ga0265314_10528845 | 3300031711 | Bacteria | 617 |
| 157 | Ga0265342_10177135 | 3300031712 | Bacteria | 1170 |
| 158 | Ga0307516_10163354 | 3300031730 | Bacteria | 1975 |
| 159 | Ga0395898_0828309 | 3300037466 | Bacteria | 865 |
| 160 | Ga0395905_0864535 | 3300037471 | Unclassified | 807 |
| 161 | Ga0451793_1583586 | 3300041452 | Bacteria | 1300 |
| 162 | Ga0451802_2179146 | 3300041460 | Unclassified | 864 |
| 163 | Ga0451807_2564264 | 3300041486 | Bacteria | 680 |
| 164 | Ga0495609_0288884 | 3300046538 | Unclassified | 669 |
| 165 | Ga0495672_0079745 | 3300047320 | Bacteria | 1828 |
| 166 | nmdc:mga03683_392661_c1 | 3300050489 | Unclassified | 661 |
| 167 | nmdc:mga00v17_906626_c1 | 3300050491 | Unclassified | 558 |
| 168 | nmdc:mga0yw44_43723_c1 | 3300050492 | Bacteria | 2676 |
| 169 | nmdc:mga0k408_58_c2 | 3300050493 | Bacteria | 26931 |
| 170 | nmdc:mga07m45_4918_c4 | 3300050496 | Bacteria | 4425 |
| 171 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 172 | Ga0500610_0000009 | 3300053079 | Bacteria | 105876 |
| 173 | Ga0500643_000010 | 3300053087 | Bacteria | 408084 |
| 174 | Ga0500643_003581 | 3300053087 | Bacteria | 7390 |
| 175 | Ga0500644_0000173 | 3300053088 | Bacteria | 41225 |
| 176 | Ga0500644_0002192 | 3300053088 | Bacteria | 4931 |
| 177 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 178 | Ga0500562_028927 | 3300053108 | Bacteria | 1457 |
| 179 | Ga0500594_0000086 | 3300053118 | Bacteria | 28032 |
| 180 | Ga0500628_000005 | 3300053129 | Bacteria | 201423 |
| 181 | Ga0500652_000012 | 3300053131 | Bacteria | 155076 |
| 182 | Ga0500568_0020253 | 3300053139 | Bacteria | 2880 |
| 183 | Ga0500568_0157045 | 3300053139 | Bacteria | 840 |
| 184 | Ga0500604_0061155 | 3300053151 | Bacteria | 1183 |
| 185 | Ga0500570_000055 | 3300053724 | Bacteria | 28288 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10017913 | Ga0157369_100179132 | 85 |
| 2 | 3300025917 | Ga0207660_10109629 | Ga0207660_101096292 | 88 |
| 3 | 3300003320 | rootH2_10326631 | rootH2_103266312 | 101 |
| 4 | 3300005335 | Ga0070666_10091071 | Ga0070666_100910712 | 101 |
| 5 | 3300005367 | Ga0070667_100007022 | Ga0070667_1000070223 | 101 |
| 6 | 3300005435 | Ga0070714_100000272 | Ga0070714_1000002722 | 101 |
| 7 | 3300005437 | Ga0070710_11456437 | Ga0070710_114564371 | 101 |
| 8 | 3300005530 | Ga0070679_100544436 | Ga0070679_1005444362 | 101 |
| 9 | 3300005530 | Ga0070679_101113486 | Ga0070679_1011134861 | 101 |
| 10 | 3300005563 | Ga0068855_100040488 | Ga0068855_1000404882 | 101 |
| 11 | 3300005617 | Ga0068859_100341590 | Ga0068859_1003415902 | 101 |
| 12 | 3300005842 | Ga0068858_100326711 | Ga0068858_1003267112 | 101 |
| 13 | 3300005843 | Ga0068860_100015680 | Ga0068860_1000156803 | 101 |
| 14 | 3300006177 | Ga0075362_10444108 | Ga0075362_104441082 | 101 |
| 15 | 3300006931 | Ga0097620_100341595 | Ga0097620_1003415951 | 101 |
| 16 | 3300009101 | Ga0105247_10425128 | Ga0105247_104251281 | 101 |
| 17 | 3300009177 | Ga0105248_10311636 | Ga0105248_103116362 | 101 |
| 18 | 3300013296 | Ga0157374_10230362 | Ga0157374_102303623 | 101 |
| 19 | 3300014745 | Ga0157377_10051304 | Ga0157377_100513043 | 101 |
| 20 | 3300025903 | Ga0207680_10117189 | Ga0207680_101171892 | 101 |
| 21 | 3300025912 | Ga0207707_10551673 | Ga0207707_105516731 | 101 |
| 22 | 3300025923 | Ga0207681_10593717 | Ga0207681_105937171 | 101 |
| 23 | 3300025929 | Ga0207664_10000578 | Ga0207664_1000057822 | 101 |
| 24 | 3300025941 | Ga0207711_10029854 | Ga0207711_100298542 | 101 |
| 25 | 3300025949 | Ga0207667_10072243 | Ga0207667_100722432 | 101 |
| 26 | 3300025986 | Ga0207658_10017900 | Ga0207658_100179002 | 101 |
| 27 | 3300026035 | Ga0207703_10705579 | Ga0207703_107055791 | 101 |
| 28 | 3300028381 | Ga0268264_10073467 | Ga0268264_100734672 | 101 |
| 29 | 3300028556 | Ga0265337_1001397 | Ga0265337_10013972 | 101 |
| 30 | 3300028556 | Ga0265337_1012550 | Ga0265337_10125502 | 101 |
| 31 | 3300028558 | Ga0265326_10022141 | Ga0265326_100221413 | 101 |
| 32 | 3300028573 | Ga0265334_10008768 | Ga0265334_100087682 | 101 |
| 33 | 3300028573 | Ga0265334_10062562 | Ga0265334_100625622 | 101 |
| 34 | 3300028666 | Ga0265336_10000075 | Ga0265336_1000007525 | 101 |
| 35 | 3300028666 | Ga0265336_10008349 | Ga0265336_100083492 | 101 |
| 36 | 3300028666 | Ga0265336_10012826 | Ga0265336_100128262 | 101 |
| 37 | 3300028800 | Ga0265338_10000340 | Ga0265338_1000034025 | 101 |
| 38 | 3300028800 | Ga0265338_10005822 | Ga0265338_100058222 | 101 |
| 39 | 3300028800 | Ga0265338_10040880 | Ga0265338_100408802 | 101 |
| 40 | 3300031238 | Ga0265332_10187748 | Ga0265332_101877482 | 101 |
| 41 | 3300031240 | Ga0265320_10157686 | Ga0265320_101576861 | 101 |
| 42 | 3300031241 | Ga0265325_10006366 | Ga0265325_100063662 | 101 |
| 43 | 3300031241 | Ga0265325_10332706 | Ga0265325_103327061 | 101 |
| 44 | 3300031249 | Ga0265339_10183708 | Ga0265339_101837082 | 101 |
| 45 | 3300031251 | Ga0265327_10013938 | Ga0265327_100139384 | 101 |
| 46 | 3300031344 | Ga0265316_10023987 | Ga0265316_100239872 | 101 |
| 47 | 3300031344 | Ga0265316_10127050 | Ga0265316_101270502 | 101 |
| 48 | 3300031595 | Ga0265313_10108787 | Ga0265313_101087871 | 101 |
| 49 | 3300031711 | Ga0265314_10528845 | Ga0265314_105288451 | 101 |
| 50 | 3300031712 | Ga0265342_10177135 | Ga0265342_101771351 | 101 |
| 51 | 3300001904 | JGI24736J21556_1013566 | JGI24736J21556_10135663 | 102 |
| 52 | 3300003203 | JGI25406J46586_10093794 | JGI25406J46586_100937942 | 102 |
| 53 | 3300003320 | rootH2_10000244 | rootH2_1000024425 | 102 |
| 54 | 3300003320 | rootH2_10318553 | rootH2_103185531 | 102 |
| 55 | 3300005327 | Ga0070658_10074095 | Ga0070658_100740952 | 102 |
| 56 | 3300005327 | Ga0070658_11093725 | Ga0070658_110937252 | 102 |
| 57 | 3300005328 | Ga0070676_10017908 | Ga0070676_100179082 | 102 |
| 58 | 3300005329 | Ga0070683_100000092 | Ga0070683_10000009224 | 102 |
| 59 | 3300005335 | Ga0070666_10004544 | Ga0070666_100045444 | 102 |
| 60 | 3300005337 | Ga0070682_100385742 | Ga0070682_1003857422 | 102 |
| 61 | 3300005339 | Ga0070660_100634603 | Ga0070660_1006346032 | 102 |
| 62 | 3300005341 | Ga0070691_10749656 | Ga0070691_107496561 | 102 |
| 63 | 3300005343 | Ga0070687_100565814 | Ga0070687_1005658141 | 102 |
| 64 | 3300005355 | Ga0070671_100000001 | Ga0070671_10000000130 | 102 |
| 65 | 3300005355 | Ga0070671_100092129 | Ga0070671_1000921292 | 102 |
| 66 | 3300005455 | Ga0070663_100252071 | Ga0070663_1002520712 | 102 |
| 67 | 3300005530 | Ga0070679_100002396 | Ga0070679_1000023961 | 102 |
| 68 | 3300005530 | Ga0070679_100355582 | Ga0070679_1003555821 | 102 |
| 69 | 3300005530 | Ga0070679_100473734 | Ga0070679_1004737342 | 102 |
| 70 | 3300005535 | Ga0070684_100001935 | Ga0070684_1000019353 | 102 |
| 71 | 3300005539 | Ga0068853_100008619 | Ga0068853_1000086193 | 102 |
| 72 | 3300005544 | Ga0070686_101233310 | Ga0070686_1012333101 | 102 |
| 73 | 3300005546 | Ga0070696_101202684 | Ga0070696_1012026842 | 102 |
| 74 | 3300005548 | Ga0070665_100081393 | Ga0070665_1000813931 | 102 |
| 75 | 3300005563 | Ga0068855_100025575 | Ga0068855_1000255753 | 102 |
| 76 | 3300005563 | Ga0068855_100230906 | Ga0068855_1002309062 | 102 |
| 77 | 3300005577 | Ga0068857_100068932 | Ga0068857_1000689323 | 102 |
| 78 | 3300005614 | Ga0068856_100004168 | Ga0068856_1000041683 | 102 |
| 79 | 3300005614 | Ga0068856_100982820 | Ga0068856_1009828201 | 102 |
| 80 | 3300005617 | Ga0068859_100256123 | Ga0068859_1002561232 | 102 |
| 81 | 3300005617 | Ga0068859_100390472 | Ga0068859_1003904722 | 102 |
| 82 | 3300005841 | Ga0068863_100077666 | Ga0068863_1000776662 | 102 |
| 83 | 3300005841 | Ga0068863_101360068 | Ga0068863_1013600681 | 102 |
| 84 | 3300005985 | Ga0081539_10201015 | Ga0081539_102010152 | 102 |
| 85 | 3300006028 | Ga0070717_10136484 | Ga0070717_101364842 | 102 |
| 86 | 3300006051 | Ga0075364_11033493 | Ga0075364_110334931 | 102 |
| 87 | 3300006195 | Ga0075366_10000354 | Ga0075366_1000035416 | 102 |
| 88 | 3300006237 | Ga0097621_100000213 | Ga0097621_10000021323 | 102 |
| 89 | 3300006353 | Ga0075370_10041634 | Ga0075370_100416342 | 102 |
| 90 | 3300006358 | Ga0068871_100000980 | Ga0068871_1000009807 | 102 |
| 91 | 3300006931 | Ga0097620_100256117 | Ga0097620_1002561172 | 102 |
| 92 | 3300006931 | Ga0097620_100390476 | Ga0097620_1003904762 | 102 |
| 93 | 3300009093 | Ga0105240_10382685 | Ga0105240_103826852 | 102 |
| 94 | 3300009093 | Ga0105240_10804048 | Ga0105240_108040482 | 102 |
| 95 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002643 | 102 |
| 96 | 3300009098 | Ga0105245_10005282 | Ga0105245_100052822 | 102 |
| 97 | 3300009098 | Ga0105245_10099263 | Ga0105245_100992632 | 102 |
| 98 | 3300009174 | Ga0105241_10000007 | Ga0105241_1000000726 | 102 |
| 99 | 3300009174 | Ga0105241_11270607 | Ga0105241_112706071 | 102 |
| 100 | 3300009176 | Ga0105242_10008574 | Ga0105242_100085745 | 102 |
| 101 | 3300009176 | Ga0105242_10757269 | Ga0105242_107572691 | 102 |
| 102 | 3300009176 | Ga0105242_11841868 | Ga0105242_118418681 | 102 |
| 103 | 3300009177 | Ga0105248_10174045 | Ga0105248_101740453 | 102 |
| 104 | 3300009545 | Ga0105237_10324111 | Ga0105237_103241112 | 102 |
| 105 | 3300009551 | Ga0105238_10253788 | Ga0105238_102537882 | 102 |
| 106 | 3300009551 | Ga0105238_11706495 | Ga0105238_117064951 | 102 |
| 107 | 3300010375 | Ga0105239_10053657 | Ga0105239_100536572 | 102 |
| 108 | 3300010375 | Ga0105239_11877168 | Ga0105239_118771681 | 102 |
| 109 | 3300013105 | Ga0157369_10000104 | Ga0157369_100001042 | 102 |
| 110 | 3300013296 | Ga0157374_10000018 | Ga0157374_1000001824 | 102 |
| 111 | 3300013296 | Ga0157374_10034747 | Ga0157374_100347473 | 102 |
| 112 | 3300013296 | Ga0157374_10723310 | Ga0157374_107233101 | 102 |
| 113 | 3300013296 | Ga0157374_11371875 | Ga0157374_113718751 | 102 |
| 114 | 3300013296 | Ga0157374_11768227 | Ga0157374_117682271 | 102 |
| 115 | 3300013297 | Ga0157378_10334433 | Ga0157378_103344331 | 102 |
| 116 | 3300013307 | Ga0157372_10000356 | Ga0157372_1000035640 | 102 |
| 117 | 3300013307 | Ga0157372_11631445 | Ga0157372_116314451 | 102 |
| 118 | 3300013308 | Ga0157375_11588369 | Ga0157375_115883691 | 102 |
| 119 | 3300014745 | Ga0157377_10045699 | Ga0157377_100456992 | 102 |
| 120 | 3300025903 | Ga0207680_10013338 | Ga0207680_100133382 | 102 |
| 121 | 3300025903 | Ga0207680_10256250 | Ga0207680_102562502 | 102 |
| 122 | 3300025904 | Ga0207647_10008895 | Ga0207647_100088954 | 102 |
| 123 | 3300025907 | Ga0207645_10024344 | Ga0207645_100243443 | 102 |
| 124 | 3300025909 | Ga0207705_10865649 | Ga0207705_108656491 | 102 |
| 125 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021521 | 102 |
| 126 | 3300025913 | Ga0207695_11338369 | Ga0207695_113383692 | 102 |
| 127 | 3300025914 | Ga0207671_10246720 | Ga0207671_102467201 | 102 |
| 128 | 3300025918 | Ga0207662_10475408 | Ga0207662_104754082 | 102 |
| 129 | 3300025919 | Ga0207657_10018032 | Ga0207657_100180323 | 102 |
| 130 | 3300025921 | Ga0207652_10039906 | Ga0207652_100399061 | 102 |
| 131 | 3300025921 | Ga0207652_11557474 | Ga0207652_115574741 | 102 |
| 132 | 3300025924 | Ga0207694_10166875 | Ga0207694_101668753 | 102 |
| 133 | 3300025925 | Ga0207650_11059995 | Ga0207650_110599952 | 102 |
| 134 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001568 | 102 |
| 135 | 3300025927 | Ga0207687_10000008 | Ga0207687_10000008458 | 102 |
| 136 | 3300025927 | Ga0207687_10003138 | Ga0207687_100031382 | 102 |
| 137 | 3300025931 | Ga0207644_10000001 | Ga0207644_1000000154 | 102 |
| 138 | 3300025931 | Ga0207644_10041014 | Ga0207644_100410142 | 102 |
| 139 | 3300025934 | Ga0207686_11029799 | Ga0207686_110297992 | 102 |
| 140 | 3300025941 | Ga0207711_10724306 | Ga0207711_107243062 | 102 |
| 141 | 3300025944 | Ga0207661_10000083 | Ga0207661_1000008323 | 102 |
| 142 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008632 | 102 |
| 143 | 3300025949 | Ga0207667_10017167 | Ga0207667_100171673 | 102 |
| 144 | 3300025949 | Ga0207667_10319892 | Ga0207667_103198922 | 102 |
| 145 | 3300025949 | Ga0207667_11628149 | Ga0207667_116281492 | 102 |
| 146 | 3300025961 | Ga0207712_11956738 | Ga0207712_119567381 | 102 |
| 147 | 3300026041 | Ga0207639_10002872 | Ga0207639_100028727 | 102 |
| 148 | 3300026075 | Ga0207708_12043289 | Ga0207708_120432891 | 102 |
| 149 | 3300026078 | Ga0207702_10000527 | Ga0207702_1000052737 | 102 |
| 150 | 3300026078 | Ga0207702_10005986 | Ga0207702_100059867 | 102 |
| 151 | 3300026078 | Ga0207702_10736718 | Ga0207702_107367181 | 102 |
| 152 | 3300026088 | Ga0207641_10046552 | Ga0207641_100465522 | 102 |
| 153 | 3300026088 | Ga0207641_11845170 | Ga0207641_118451701 | 102 |
| 154 | 3300027717 | Ga0209998_10170509 | Ga0209998_101705091 | 102 |
| 155 | 3300028800 | Ga0265338_10003906 | Ga0265338_100039068 | 102 |
| 156 | 3300031250 | Ga0265331_10139129 | Ga0265331_101391292 | 102 |
| 157 | 3300031251 | Ga0265327_10001541 | Ga0265327_100015412 | 102 |
| 158 | 3300031730 | Ga0307516_10163354 | Ga0307516_101633542 | 102 |
| 159 | 3300037466 | Ga0395898_0828309 | Ga0395898_0828309_212_520 | 102 |
| 160 | 3300037471 | Ga0395905_0864535 | Ga0395905_0864535_93_401 | 102 |
| 161 | 3300041452 | Ga0451793_1583586 | Ga0451793_1583586_517_825 | 102 |
| 162 | 3300041460 | Ga0451802_2179146 | Ga0451802_2179146_488_796 | 102 |
| 163 | 3300041486 | Ga0451807_2564264 | Ga0451807_2564264_144_458 | 102 |
| 164 | 3300046538 | Ga0495609_0288884 | Ga0495609_0288884_59_367 | 102 |
| 165 | 3300047320 | Ga0495672_0079745 | Ga0495672_0079745_10_318 | 102 |
| 166 | 3300050489 | nmdc:mga03683_392661_c1 | nmdc:mga03683_392661_c1_229_537 | 102 |
| 167 | 3300050491 | nmdc:mga00v17_906626_c1 | nmdc:mga00v17_906626_c1_78_386 | 102 |
| 168 | 3300050492 | nmdc:mga0yw44_43723_c1 | nmdc:mga0yw44_43723_c1_484_792 | 102 |
| 169 | 3300050493 | nmdc:mga0k408_58_c2 | nmdc:mga0k408_58_c2_4648_4956 | 102 |
| 170 | 3300050496 | nmdc:mga07m45_4918_c4 | nmdc:mga07m45_4918_c4_3059_3367 | 102 |
| 171 | 3300050516 | nmdc:mga0sz30_2_c1 | nmdc:mga0sz30_2_c1_29260_29568 | 102 |
| 172 | 3300053079 | Ga0500610_0000009 | Ga0500610_0000009_89197_89505 | 102 |
| 173 | 3300053087 | Ga0500643_000010 | Ga0500643_000010_4732_5040 | 102 |
| 174 | 3300053087 | Ga0500643_003581 | Ga0500643_003581_367_675 | 102 |
| 175 | 3300053088 | Ga0500644_0000173 | Ga0500644_0000173_25201_25509 | 102 |
| 176 | 3300053088 | Ga0500644_0002192 | Ga0500644_0002192_1577_1885 | 102 |
| 177 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_23173_23481 | 102 |
| 178 | 3300053108 | Ga0500562_028927 | Ga0500562_028927_1019_1327 | 102 |
| 179 | 3300053118 | Ga0500594_0000086 | Ga0500594_0000086_25430_25738 | 102 |
| 180 | 3300053129 | Ga0500628_000005 | Ga0500628_000005_17360_17668 | 102 |
| 181 | 3300053131 | Ga0500652_000012 | Ga0500652_000012_144239_144547 | 102 |
| 182 | 3300053139 | Ga0500568_0020253 | Ga0500568_0020253_916_1224 | 102 |
| 183 | 3300053139 | Ga0500568_0157045 | Ga0500568_0157045_341_649 | 102 |
| 184 | 3300053151 | Ga0500604_0061155 | Ga0500604_0061155_101_409 | 102 |
| 185 | 3300053724 | Ga0500570_000055 | Ga0500570_000055_21512_21820 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_p | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8359 | 2 | 101 |
| 6eri-assembly1.cif.gz_AR | structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor | 0.8322 | 2 | 102 |
| 4ce4-assembly1.cif.gz_V | 39s large subunit of the porcine mitochondrial ribosome | 0.8309 | 3 | 102 |
| 7m4v-assembly1.cif.gz_Q | a. baumannii ribosome-eravacycline complex: 50s | 0.829 | 3 | 102 |
| 5x8t-assembly1.cif.gz_S | structure of the 50s large subunit of chloroplast ribosome from spinach | 0.8251 | 2 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54IF0_61_161_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8374 | 3 | 99 | 2.40.10.190 |
| af_A0A1D6H5B5_111_217_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8353 | 3 | 99 | 2.40.10.190 |
| af_P0AG48_1_101_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8317 | 3 | 100 | 2.40.10.190 |
| af_Q2FXS8_1_100_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8171 | 3 | 100 | 2.40.10.190 |
| af_P9WHC3_3_102_2.40.10.190 | Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 | 0.8139 | 3 | 99 | 2.40.10.190 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660M9Y2-F1-model_v4 | 50S ribosomal protein L21 | 0.905 | 3 | 67 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A660M9Y2-F1-model_v4 | 50S ribosomal protein L21 | 0.88 | 3 | 67 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2T2QUX3-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.8723 | 1 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F7RAY0-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.8708 | 1 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A4P5ULY6-F1-model_v4 | Large ribosomal subunit protein bL21 | 0.8691 | 3 | 102 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar