F284308

General Info

Members Datasets Scaffolds Average Seq Length
185 124 185 102

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10053657|Ga0105239_100536572
Length 120
Sequence VTIFGRLIWYQNFLKELIMKKAVIATGGKQYLVSEGETLNVELLAGEKGKVVFDALLVLDGDKVSVGAPLVDKVKVNADIVAEDVQADKVTSIRYKAKKRVHTVRGHRQHQTTLKIVSIA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
114 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
115 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
118 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
119 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
120 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
121 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
124 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.97
Nodule 0
Rhizoplane 1.62
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1013566 3300001904 Bacteria 1315
2 JGI25406J46586_10093794 3300003203 Unclassified 902
3 rootH2_10000244 3300003320 Bacteria 697651
4 rootH2_10318553 3300003320 Bacteria 1286
5 rootH2_10326631 3300003320 Bacteria 2221
6 Ga0070658_10074095 3300005327 Unclassified 2792
7 Ga0070658_11093725 3300005327 Bacteria 693
8 Ga0070676_10017908 3300005328 Bacteria 3922
9 Ga0070683_100000092 3300005329 Bacteria 59204
10 Ga0070666_10004544 3300005335 Bacteria 8456
11 Ga0070666_10091071 3300005335 Bacteria 2095
12 Ga0070682_100385742 3300005337 Bacteria 1055
13 Ga0070660_100634603 3300005339 Unclassified 894
14 Ga0070691_10749656 3300005341 Unclassified 590
15 Ga0070687_100565814 3300005343 Bacteria 776
16 Ga0070671_100000001 3300005355 Bacteria 1228151
17 Ga0070671_100092129 3300005355 Bacteria 2539
18 Ga0070667_100007022 3300005367 Bacteria 9360
19 Ga0070714_100000272 3300005435 Bacteria 39469
20 Ga0070710_11456437 3300005437 Unclassified 513
21 Ga0070663_100252071 3300005455 Bacteria 1397
22 Ga0070679_100002396 3300005530 Bacteria 16994
23 Ga0070679_100355582 3300005530 Bacteria 1412
24 Ga0070679_100473734 3300005530 Bacteria 1196
25 Ga0070679_100544436 3300005530 Unclassified 1104
26 Ga0070679_101113486 3300005530 Bacteria 734
27 Ga0070684_100001935 3300005535 Bacteria 15200
28 Ga0068853_100008619 3300005539 Bacteria 8199
29 Ga0070686_101233310 3300005544 Unclassified 622
30 Ga0070696_101202684 3300005546 Bacteria 640
31 Ga0070665_100081393 3300005548 Bacteria 3244
32 Ga0068855_100025575 3300005563 Bacteria 7060
33 Ga0068855_100040488 3300005563 Bacteria 5531
34 Ga0068855_100230906 3300005563 Bacteria 2072
35 Ga0068857_100068932 3300005577 Bacteria 3149
36 Ga0068856_100004168 3300005614 Bacteria 14441
37 Ga0068856_100982820 3300005614 Unclassified 862
38 Ga0068859_100256123 3300005617 Bacteria 1841
39 Ga0068859_100341590 3300005617 Bacteria 1591
40 Ga0068859_100390472 3300005617 Bacteria 1487
41 Ga0068863_100077666 3300005841 Bacteria 3142
42 Ga0068863_101360068 3300005841 Unclassified 717
43 Ga0068858_100326711 3300005842 Bacteria 1467
44 Ga0068860_100015680 3300005843 Bacteria 7399
45 Ga0081539_10201015 3300005985 Unclassified 920
46 Ga0070717_10136484 3300006028 Bacteria 2113
47 Ga0075364_11033493 3300006051 Unclassified 558
48 Ga0075362_10444108 3300006177 Unclassified 658
49 Ga0075366_10000354 3300006195 Bacteria 21047
50 Ga0097621_100000213 3300006237 Bacteria 38241
51 Ga0075370_10041634 3300006353 Bacteria 2593
52 Ga0068871_100000980 3300006358 Bacteria 19120
53 Ga0097620_100256117 3300006931 Bacteria 1841
54 Ga0097620_100341595 3300006931 Bacteria 1591
55 Ga0097620_100390476 3300006931 Bacteria 1487
56 Ga0105240_10382685 3300009093 Bacteria 1589
57 Ga0105240_10804048 3300009093 Bacteria 1018
58 Ga0105245_10000002 3300009098 Bacteria 634374
59 Ga0105245_10005282 3300009098 Bacteria 11343
60 Ga0105245_10099263 3300009098 Bacteria 2691
61 Ga0105247_10425128 3300009101 Bacteria 952
62 Ga0105241_10000007 3300009174 Bacteria 343524
63 Ga0105241_11270607 3300009174 Unclassified 700
64 Ga0105242_10008574 3300009176 Bacteria 7849
65 Ga0105242_10757269 3300009176 Bacteria 957
66 Ga0105242_11841868 3300009176 Bacteria 644
67 Ga0105248_10174045 3300009177 Bacteria 2426
68 Ga0105248_10311636 3300009177 Bacteria 1772
69 Ga0105237_10324111 3300009545 Unclassified 1544
70 Ga0105238_10253788 3300009551 Bacteria 1737
71 Ga0105238_11706495 3300009551 Bacteria 661
72 Ga0105239_10053657 3300010375 Bacteria 4421
73 Ga0105239_11877168 3300010375 Unclassified 695
74 Ga0157369_10000104 3300013105 Bacteria 118133
75 Ga0157369_10017913 3300013105 Bacteria 7950
76 Ga0157374_10000018 3300013296 Bacteria 286683
77 Ga0157374_10034747 3300013296 Bacteria 4607
78 Ga0157374_10230362 3300013296 Bacteria 1820
79 Ga0157374_10723310 3300013296 Bacteria 1009
80 Ga0157374_11371875 3300013296 Bacteria 729
81 Ga0157374_11768227 3300013296 Bacteria 643
82 Ga0157378_10334433 3300013297 Bacteria 1475
83 Ga0157372_10000356 3300013307 Bacteria 50272
84 Ga0157372_11631445 3300013307 Unclassified 742
85 Ga0157375_11588369 3300013308 Unclassified 773
86 Ga0157377_10045699 3300014745 Bacteria 2447
87 Ga0157377_10051304 3300014745 Bacteria 2326
88 Ga0207680_10013338 3300025903 Unclassified 4219
89 Ga0207680_10117189 3300025903 Bacteria 1737
90 Ga0207680_10256250 3300025903 Bacteria 1210
91 Ga0207647_10008895 3300025904 Bacteria 7161
92 Ga0207645_10024344 3300025907 Bacteria 3927
93 Ga0207705_10865649 3300025909 Bacteria 700
94 Ga0207654_10000002 3300025911 Bacteria 1460142
95 Ga0207707_10551673 3300025912 Unclassified 979
96 Ga0207695_11338369 3300025913 Unclassified 596
97 Ga0207671_10246720 3300025914 Unclassified 1403
98 Ga0207660_10109629 3300025917 Unclassified 2075
99 Ga0207662_10475408 3300025918 Bacteria 858
100 Ga0207657_10018032 3300025919 Bacteria 6753
101 Ga0207652_10039906 3300025921 Unclassified 3985
102 Ga0207652_11557474 3300025921 Bacteria 565
103 Ga0207681_10593717 3300025923 Bacteria 914
104 Ga0207694_10166875 3300025924 Bacteria 1781
105 Ga0207650_11059995 3300025925 Unclassified 690
106 Ga0207687_10000001 3300025927 Bacteria 1130810
107 Ga0207687_10000008 3300025927 Bacteria 497738
108 Ga0207687_10003138 3300025927 Bacteria 11208
109 Ga0207664_10000578 3300025929 Bacteria 25609
110 Ga0207644_10000001 3300025931 Bacteria 1243214
111 Ga0207644_10041014 3300025931 Bacteria 3273
112 Ga0207686_11029799 3300025934 Bacteria 669
113 Ga0207711_10029854 3300025941 Bacteria 4599
114 Ga0207711_10724306 3300025941 Bacteria 928
115 Ga0207661_10000083 3300025944 Bacteria 66112
116 Ga0207667_10000008 3300025949 Bacteria 625138
117 Ga0207667_10017167 3300025949 Bacteria 8159
118 Ga0207667_10072243 3300025949 Bacteria 3587
119 Ga0207667_10319892 3300025949 Bacteria 1585
120 Ga0207667_11628149 3300025949 Unclassified 614
121 Ga0207712_11956738 3300025961 Bacteria 525
122 Ga0207658_10017900 3300025986 Bacteria 4884
123 Ga0207703_10705579 3300026035 Unclassified 960
124 Ga0207639_10002872 3300026041 Bacteria 11570
125 Ga0207708_12043289 3300026075 Unclassified 502
126 Ga0207702_10000527 3300026078 Bacteria 42758
127 Ga0207702_10005986 3300026078 Bacteria 10561
128 Ga0207702_10736718 3300026078 Unclassified 972
129 Ga0207641_10046552 3300026088 Bacteria 3656
130 Ga0207641_11845170 3300026088 Unclassified 606
131 Ga0209998_10170509 3300027717 Bacteria 564
132 Ga0268264_10073467 3300028381 Bacteria 2903
133 Ga0265337_1001397 3300028556 Bacteria 11850
134 Ga0265337_1012550 3300028556 Bacteria 2875
135 Ga0265326_10022141 3300028558 Bacteria 1821
136 Ga0265334_10008768 3300028573 Bacteria 4296
137 Ga0265334_10062562 3300028573 Bacteria 1400
138 Ga0265336_10000075 3300028666 Bacteria 81725
139 Ga0265336_10008349 3300028666 Bacteria 3636
140 Ga0265336_10012826 3300028666 Bacteria 2809
141 Ga0265338_10000340 3300028800 Bacteria 85032
142 Ga0265338_10003906 3300028800 Bacteria 20584
143 Ga0265338_10005822 3300028800 Bacteria 15904
144 Ga0265338_10040880 3300028800 Bacteria 4346
145 Ga0265332_10187748 3300031238 Bacteria 860
146 Ga0265320_10157686 3300031240 Bacteria 1023
147 Ga0265325_10006366 3300031241 Bacteria 7170
148 Ga0265325_10332706 3300031241 Bacteria 673
149 Ga0265339_10183708 3300031249 Unclassified 1040
150 Ga0265331_10139129 3300031250 Bacteria 1105
151 Ga0265327_10001541 3300031251 Bacteria 28417
152 Ga0265327_10013938 3300031251 Bacteria 5299
153 Ga0265316_10023987 3300031344 Bacteria 5122
154 Ga0265316_10127050 3300031344 Bacteria 1922
155 Ga0265313_10108787 3300031595 Bacteria 1221
156 Ga0265314_10528845 3300031711 Bacteria 617
157 Ga0265342_10177135 3300031712 Bacteria 1170
158 Ga0307516_10163354 3300031730 Bacteria 1975
159 Ga0395898_0828309 3300037466 Bacteria 865
160 Ga0395905_0864535 3300037471 Unclassified 807
161 Ga0451793_1583586 3300041452 Bacteria 1300
162 Ga0451802_2179146 3300041460 Unclassified 864
163 Ga0451807_2564264 3300041486 Bacteria 680
164 Ga0495609_0288884 3300046538 Unclassified 669
165 Ga0495672_0079745 3300047320 Bacteria 1828
166 nmdc:mga03683_392661_c1 3300050489 Unclassified 661
167 nmdc:mga00v17_906626_c1 3300050491 Unclassified 558
168 nmdc:mga0yw44_43723_c1 3300050492 Bacteria 2676
169 nmdc:mga0k408_58_c2 3300050493 Bacteria 26931
170 nmdc:mga07m45_4918_c4 3300050496 Bacteria 4425
171 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
172 Ga0500610_0000009 3300053079 Bacteria 105876
173 Ga0500643_000010 3300053087 Bacteria 408084
174 Ga0500643_003581 3300053087 Bacteria 7390
175 Ga0500644_0000173 3300053088 Bacteria 41225
176 Ga0500644_0002192 3300053088 Bacteria 4931
177 Ga0500555_000002 3300053103 Bacteria 1314346
178 Ga0500562_028927 3300053108 Bacteria 1457
179 Ga0500594_0000086 3300053118 Bacteria 28032
180 Ga0500628_000005 3300053129 Bacteria 201423
181 Ga0500652_000012 3300053131 Bacteria 155076
182 Ga0500568_0020253 3300053139 Bacteria 2880
183 Ga0500568_0157045 3300053139 Bacteria 840
184 Ga0500604_0061155 3300053151 Bacteria 1183
185 Ga0500570_000055 3300053724 Bacteria 28288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10017913 Ga0157369_100179132 85
2 3300025917 Ga0207660_10109629 Ga0207660_101096292 88
3 3300003320 rootH2_10326631 rootH2_103266312 101
4 3300005335 Ga0070666_10091071 Ga0070666_100910712 101
5 3300005367 Ga0070667_100007022 Ga0070667_1000070223 101
6 3300005435 Ga0070714_100000272 Ga0070714_1000002722 101
7 3300005437 Ga0070710_11456437 Ga0070710_114564371 101
8 3300005530 Ga0070679_100544436 Ga0070679_1005444362 101
9 3300005530 Ga0070679_101113486 Ga0070679_1011134861 101
10 3300005563 Ga0068855_100040488 Ga0068855_1000404882 101
11 3300005617 Ga0068859_100341590 Ga0068859_1003415902 101
12 3300005842 Ga0068858_100326711 Ga0068858_1003267112 101
13 3300005843 Ga0068860_100015680 Ga0068860_1000156803 101
14 3300006177 Ga0075362_10444108 Ga0075362_104441082 101
15 3300006931 Ga0097620_100341595 Ga0097620_1003415951 101
16 3300009101 Ga0105247_10425128 Ga0105247_104251281 101
17 3300009177 Ga0105248_10311636 Ga0105248_103116362 101
18 3300013296 Ga0157374_10230362 Ga0157374_102303623 101
19 3300014745 Ga0157377_10051304 Ga0157377_100513043 101
20 3300025903 Ga0207680_10117189 Ga0207680_101171892 101
21 3300025912 Ga0207707_10551673 Ga0207707_105516731 101
22 3300025923 Ga0207681_10593717 Ga0207681_105937171 101
23 3300025929 Ga0207664_10000578 Ga0207664_1000057822 101
24 3300025941 Ga0207711_10029854 Ga0207711_100298542 101
25 3300025949 Ga0207667_10072243 Ga0207667_100722432 101
26 3300025986 Ga0207658_10017900 Ga0207658_100179002 101
27 3300026035 Ga0207703_10705579 Ga0207703_107055791 101
28 3300028381 Ga0268264_10073467 Ga0268264_100734672 101
29 3300028556 Ga0265337_1001397 Ga0265337_10013972 101
30 3300028556 Ga0265337_1012550 Ga0265337_10125502 101
31 3300028558 Ga0265326_10022141 Ga0265326_100221413 101
32 3300028573 Ga0265334_10008768 Ga0265334_100087682 101
33 3300028573 Ga0265334_10062562 Ga0265334_100625622 101
34 3300028666 Ga0265336_10000075 Ga0265336_1000007525 101
35 3300028666 Ga0265336_10008349 Ga0265336_100083492 101
36 3300028666 Ga0265336_10012826 Ga0265336_100128262 101
37 3300028800 Ga0265338_10000340 Ga0265338_1000034025 101
38 3300028800 Ga0265338_10005822 Ga0265338_100058222 101
39 3300028800 Ga0265338_10040880 Ga0265338_100408802 101
40 3300031238 Ga0265332_10187748 Ga0265332_101877482 101
41 3300031240 Ga0265320_10157686 Ga0265320_101576861 101
42 3300031241 Ga0265325_10006366 Ga0265325_100063662 101
43 3300031241 Ga0265325_10332706 Ga0265325_103327061 101
44 3300031249 Ga0265339_10183708 Ga0265339_101837082 101
45 3300031251 Ga0265327_10013938 Ga0265327_100139384 101
46 3300031344 Ga0265316_10023987 Ga0265316_100239872 101
47 3300031344 Ga0265316_10127050 Ga0265316_101270502 101
48 3300031595 Ga0265313_10108787 Ga0265313_101087871 101
49 3300031711 Ga0265314_10528845 Ga0265314_105288451 101
50 3300031712 Ga0265342_10177135 Ga0265342_101771351 101
51 3300001904 JGI24736J21556_1013566 JGI24736J21556_10135663 102
52 3300003203 JGI25406J46586_10093794 JGI25406J46586_100937942 102
53 3300003320 rootH2_10000244 rootH2_1000024425 102
54 3300003320 rootH2_10318553 rootH2_103185531 102
55 3300005327 Ga0070658_10074095 Ga0070658_100740952 102
56 3300005327 Ga0070658_11093725 Ga0070658_110937252 102
57 3300005328 Ga0070676_10017908 Ga0070676_100179082 102
58 3300005329 Ga0070683_100000092 Ga0070683_10000009224 102
59 3300005335 Ga0070666_10004544 Ga0070666_100045444 102
60 3300005337 Ga0070682_100385742 Ga0070682_1003857422 102
61 3300005339 Ga0070660_100634603 Ga0070660_1006346032 102
62 3300005341 Ga0070691_10749656 Ga0070691_107496561 102
63 3300005343 Ga0070687_100565814 Ga0070687_1005658141 102
64 3300005355 Ga0070671_100000001 Ga0070671_10000000130 102
65 3300005355 Ga0070671_100092129 Ga0070671_1000921292 102
66 3300005455 Ga0070663_100252071 Ga0070663_1002520712 102
67 3300005530 Ga0070679_100002396 Ga0070679_1000023961 102
68 3300005530 Ga0070679_100355582 Ga0070679_1003555821 102
69 3300005530 Ga0070679_100473734 Ga0070679_1004737342 102
70 3300005535 Ga0070684_100001935 Ga0070684_1000019353 102
71 3300005539 Ga0068853_100008619 Ga0068853_1000086193 102
72 3300005544 Ga0070686_101233310 Ga0070686_1012333101 102
73 3300005546 Ga0070696_101202684 Ga0070696_1012026842 102
74 3300005548 Ga0070665_100081393 Ga0070665_1000813931 102
75 3300005563 Ga0068855_100025575 Ga0068855_1000255753 102
76 3300005563 Ga0068855_100230906 Ga0068855_1002309062 102
77 3300005577 Ga0068857_100068932 Ga0068857_1000689323 102
78 3300005614 Ga0068856_100004168 Ga0068856_1000041683 102
79 3300005614 Ga0068856_100982820 Ga0068856_1009828201 102
80 3300005617 Ga0068859_100256123 Ga0068859_1002561232 102
81 3300005617 Ga0068859_100390472 Ga0068859_1003904722 102
82 3300005841 Ga0068863_100077666 Ga0068863_1000776662 102
83 3300005841 Ga0068863_101360068 Ga0068863_1013600681 102
84 3300005985 Ga0081539_10201015 Ga0081539_102010152 102
85 3300006028 Ga0070717_10136484 Ga0070717_101364842 102
86 3300006051 Ga0075364_11033493 Ga0075364_110334931 102
87 3300006195 Ga0075366_10000354 Ga0075366_1000035416 102
88 3300006237 Ga0097621_100000213 Ga0097621_10000021323 102
89 3300006353 Ga0075370_10041634 Ga0075370_100416342 102
90 3300006358 Ga0068871_100000980 Ga0068871_1000009807 102
91 3300006931 Ga0097620_100256117 Ga0097620_1002561172 102
92 3300006931 Ga0097620_100390476 Ga0097620_1003904762 102
93 3300009093 Ga0105240_10382685 Ga0105240_103826852 102
94 3300009093 Ga0105240_10804048 Ga0105240_108040482 102
95 3300009098 Ga0105245_10000002 Ga0105245_10000002643 102
96 3300009098 Ga0105245_10005282 Ga0105245_100052822 102
97 3300009098 Ga0105245_10099263 Ga0105245_100992632 102
98 3300009174 Ga0105241_10000007 Ga0105241_1000000726 102
99 3300009174 Ga0105241_11270607 Ga0105241_112706071 102
100 3300009176 Ga0105242_10008574 Ga0105242_100085745 102
101 3300009176 Ga0105242_10757269 Ga0105242_107572691 102
102 3300009176 Ga0105242_11841868 Ga0105242_118418681 102
103 3300009177 Ga0105248_10174045 Ga0105248_101740453 102
104 3300009545 Ga0105237_10324111 Ga0105237_103241112 102
105 3300009551 Ga0105238_10253788 Ga0105238_102537882 102
106 3300009551 Ga0105238_11706495 Ga0105238_117064951 102
107 3300010375 Ga0105239_10053657 Ga0105239_100536572 102
108 3300010375 Ga0105239_11877168 Ga0105239_118771681 102
109 3300013105 Ga0157369_10000104 Ga0157369_100001042 102
110 3300013296 Ga0157374_10000018 Ga0157374_1000001824 102
111 3300013296 Ga0157374_10034747 Ga0157374_100347473 102
112 3300013296 Ga0157374_10723310 Ga0157374_107233101 102
113 3300013296 Ga0157374_11371875 Ga0157374_113718751 102
114 3300013296 Ga0157374_11768227 Ga0157374_117682271 102
115 3300013297 Ga0157378_10334433 Ga0157378_103344331 102
116 3300013307 Ga0157372_10000356 Ga0157372_1000035640 102
117 3300013307 Ga0157372_11631445 Ga0157372_116314451 102
118 3300013308 Ga0157375_11588369 Ga0157375_115883691 102
119 3300014745 Ga0157377_10045699 Ga0157377_100456992 102
120 3300025903 Ga0207680_10013338 Ga0207680_100133382 102
121 3300025903 Ga0207680_10256250 Ga0207680_102562502 102
122 3300025904 Ga0207647_10008895 Ga0207647_100088954 102
123 3300025907 Ga0207645_10024344 Ga0207645_100243443 102
124 3300025909 Ga0207705_10865649 Ga0207705_108656491 102
125 3300025911 Ga0207654_10000002 Ga0207654_100000021521 102
126 3300025913 Ga0207695_11338369 Ga0207695_113383692 102
127 3300025914 Ga0207671_10246720 Ga0207671_102467201 102
128 3300025918 Ga0207662_10475408 Ga0207662_104754082 102
129 3300025919 Ga0207657_10018032 Ga0207657_100180323 102
130 3300025921 Ga0207652_10039906 Ga0207652_100399061 102
131 3300025921 Ga0207652_11557474 Ga0207652_115574741 102
132 3300025924 Ga0207694_10166875 Ga0207694_101668753 102
133 3300025925 Ga0207650_11059995 Ga0207650_110599952 102
134 3300025927 Ga0207687_10000001 Ga0207687_10000001568 102
135 3300025927 Ga0207687_10000008 Ga0207687_10000008458 102
136 3300025927 Ga0207687_10003138 Ga0207687_100031382 102
137 3300025931 Ga0207644_10000001 Ga0207644_1000000154 102
138 3300025931 Ga0207644_10041014 Ga0207644_100410142 102
139 3300025934 Ga0207686_11029799 Ga0207686_110297992 102
140 3300025941 Ga0207711_10724306 Ga0207711_107243062 102
141 3300025944 Ga0207661_10000083 Ga0207661_1000008323 102
142 3300025949 Ga0207667_10000008 Ga0207667_10000008632 102
143 3300025949 Ga0207667_10017167 Ga0207667_100171673 102
144 3300025949 Ga0207667_10319892 Ga0207667_103198922 102
145 3300025949 Ga0207667_11628149 Ga0207667_116281492 102
146 3300025961 Ga0207712_11956738 Ga0207712_119567381 102
147 3300026041 Ga0207639_10002872 Ga0207639_100028727 102
148 3300026075 Ga0207708_12043289 Ga0207708_120432891 102
149 3300026078 Ga0207702_10000527 Ga0207702_1000052737 102
150 3300026078 Ga0207702_10005986 Ga0207702_100059867 102
151 3300026078 Ga0207702_10736718 Ga0207702_107367181 102
152 3300026088 Ga0207641_10046552 Ga0207641_100465522 102
153 3300026088 Ga0207641_11845170 Ga0207641_118451701 102
154 3300027717 Ga0209998_10170509 Ga0209998_101705091 102
155 3300028800 Ga0265338_10003906 Ga0265338_100039068 102
156 3300031250 Ga0265331_10139129 Ga0265331_101391292 102
157 3300031251 Ga0265327_10001541 Ga0265327_100015412 102
158 3300031730 Ga0307516_10163354 Ga0307516_101633542 102
159 3300037466 Ga0395898_0828309 Ga0395898_0828309_212_520 102
160 3300037471 Ga0395905_0864535 Ga0395905_0864535_93_401 102
161 3300041452 Ga0451793_1583586 Ga0451793_1583586_517_825 102
162 3300041460 Ga0451802_2179146 Ga0451802_2179146_488_796 102
163 3300041486 Ga0451807_2564264 Ga0451807_2564264_144_458 102
164 3300046538 Ga0495609_0288884 Ga0495609_0288884_59_367 102
165 3300047320 Ga0495672_0079745 Ga0495672_0079745_10_318 102
166 3300050489 nmdc:mga03683_392661_c1 nmdc:mga03683_392661_c1_229_537 102
167 3300050491 nmdc:mga00v17_906626_c1 nmdc:mga00v17_906626_c1_78_386 102
168 3300050492 nmdc:mga0yw44_43723_c1 nmdc:mga0yw44_43723_c1_484_792 102
169 3300050493 nmdc:mga0k408_58_c2 nmdc:mga0k408_58_c2_4648_4956 102
170 3300050496 nmdc:mga07m45_4918_c4 nmdc:mga07m45_4918_c4_3059_3367 102
171 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_29260_29568 102
172 3300053079 Ga0500610_0000009 Ga0500610_0000009_89197_89505 102
173 3300053087 Ga0500643_000010 Ga0500643_000010_4732_5040 102
174 3300053087 Ga0500643_003581 Ga0500643_003581_367_675 102
175 3300053088 Ga0500644_0000173 Ga0500644_0000173_25201_25509 102
176 3300053088 Ga0500644_0002192 Ga0500644_0002192_1577_1885 102
177 3300053103 Ga0500555_000002 Ga0500555_000002_23173_23481 102
178 3300053108 Ga0500562_028927 Ga0500562_028927_1019_1327 102
179 3300053118 Ga0500594_0000086 Ga0500594_0000086_25430_25738 102
180 3300053129 Ga0500628_000005 Ga0500628_000005_17360_17668 102
181 3300053131 Ga0500652_000012 Ga0500652_000012_144239_144547 102
182 3300053139 Ga0500568_0020253 Ga0500568_0020253_916_1224 102
183 3300053139 Ga0500568_0157045 Ga0500568_0157045_341_649 102
184 3300053151 Ga0500604_0061155 Ga0500604_0061155_101_409 102
185 3300053724 Ga0500570_000055 Ga0500570_000055_21512_21820 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00829

Ribosomal_L21p

Ribosomal prokaryotic L21 protein

20

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_p large subunit of the chlamydomonas reinhardtii mitoribosome 0.8359 2 101
6eri-assembly1.cif.gz_AR structure of the chloroplast ribosome with chl-rrf and hibernation-promoting factor 0.8322 2 102
4ce4-assembly1.cif.gz_V 39s large subunit of the porcine mitochondrial ribosome 0.8309 3 102
7m4v-assembly1.cif.gz_Q a. baumannii ribosome-eravacycline complex: 50s 0.829 3 102
5x8t-assembly1.cif.gz_S structure of the 50s large subunit of chloroplast ribosome from spinach 0.8251 2 102
ID Description Score Start End Superfamily
af_Q54IF0_61_161_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8374 3 99 2.40.10.190
af_A0A1D6H5B5_111_217_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8353 3 99 2.40.10.190
af_P0AG48_1_101_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8317 3 100 2.40.10.190
af_Q2FXS8_1_100_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8171 3 100 2.40.10.190
af_P9WHC3_3_102_2.40.10.190 Mainly Beta;Beta Barrel;Thrombin, subunit H;translation elongation factor selb, chain A, domain 4 0.8139 3 99 2.40.10.190
ID Description Score Start End GO Terms
AF-A0A660M9Y2-F1-model_v4 50S ribosomal protein L21 0.905 3 67 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A660M9Y2-F1-model_v4 50S ribosomal protein L21 0.88 3 67 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2T2QUX3-F1-model_v4 Large ribosomal subunit protein bL21 0.8723 1 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F7RAY0-F1-model_v4 Large ribosomal subunit protein bL21 0.8708 1 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4P5ULY6-F1-model_v4 Large ribosomal subunit protein bL21 0.8691 3 102 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.23 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map