F284285

General Info

Members Datasets Scaffolds Average Seq Length
185 121 370 188

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10751522|Ga0105248_107515222
Length 209
Sequence MYLVQARPFMLLVGWERKMKVSKNETPFITDVEELRSRARKSINNGAVTPAYQADVKQTIEILQSVLATEIVCVLRYTMNAVAAAGISSDSVKEEFDEHAKEEQGHARAVAERINQLGGKPNFNPEGLASRSASQYVDAANLIDMIKENLIAERIACEHYRELIRYFGDKDSTTRVMMEGILANEEEHANDMHDLLVAHEGDPMLPDHS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
119 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
120 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
121 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.43
Metatranscriptomes 7.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0
Rhizoplane 0
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 20.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10751522 3300009177 Bacteria 1100
2 Ga0058861_11799717 3300004800 Unclassified 704
3 Ga0058862_10057365 3300004803 Unclassified 780
4 Ga0070658_10025995 3300005327 Bacteria 4696
5 Ga0068868_100025476 3300005338 Bacteria 4500
6 Ga0070671_100523448 3300005355 Bacteria 1021
7 Ga0070667_101398452 3300005367 Bacteria 656
8 Ga0070709_10053065 3300005434 Bacteria 2551
9 Ga0070714_100079939 3300005435 Bacteria 2844
10 Ga0070714_100790110 3300005435 Bacteria 919
11 Ga0070713_100086755 3300005436 Bacteria 2684
12 Ga0070713_101043227 3300005436 Bacteria 789
13 Ga0070711_100043594 3300005439 Bacteria 3039
14 Ga0068857_100503173 3300005577 Bacteria 1137
15 Ga0068856_100119227 3300005614 Bacteria 2640
16 Ga0068852_100384806 3300005616 Bacteria 1377
17 Ga0068852_100421741 3300005616 Bacteria 1316
18 Ga0068852_100817998 3300005616 Unclassified 946
19 Ga0068864_100346396 3300005618 Bacteria 1401
20 Ga0068863_100055730 3300005841 Bacteria 3743
21 Ga0068863_100928822 3300005841 Bacteria 871
22 Ga0070717_10013375 3300006028 Bacteria 6287
23 Ga0070717_10180231 3300006028 Bacteria 1841
24 Ga0070717_10186881 3300006028 Bacteria 1809
25 Ga0070712_100090807 3300006175 Bacteria 2237
26 Ga0075366_10030412 3300006195 Bacteria 3174
27 Ga0068871_100501490 3300006358 Bacteria 1094
28 Ga0068871_101039221 3300006358 Bacteria 764
29 Ga0075431_100002844 3300006847 Bacteria 16745
30 Ga0068865_100055594 3300006881 Bacteria 2754
31 Ga0105240_10000651 3300009093 Bacteria 64114
32 Ga0105240_10001187 3300009093 Bacteria 45557
33 Ga0105240_10015615 3300009093 Bacteria 10313
34 Ga0105240_10028611 3300009093 Bacteria 7275
35 Ga0105240_10033395 3300009093 Bacteria 6647
36 Ga0105240_10308184 3300009093 Bacteria 1809
37 Ga0105241_10374025 3300009174 Unclassified 1243
38 Ga0105241_10679498 3300009174 Bacteria 938
39 Ga0105242_10470934 3300009176 Bacteria 1188
40 Ga0105248_10116132 3300009177 Bacteria 3018
41 Ga0105248_10147897 3300009177 Unclassified 2651
42 Ga0105248_10596103 3300009177 Bacteria 1247
43 Ga0105237_10001552 3300009545 Bacteria 29969
44 Ga0105237_10034282 3300009545 Bacteria 5141
45 Ga0105237_10524899 3300009545 Bacteria 1191
46 Ga0105237_10527914 3300009545 Bacteria 1187
47 Ga0105238_10062562 3300009551 Bacteria 3722
48 Ga0105239_10031212 3300010375 Bacteria 5861
49 Ga0105239_10690768 3300010375 Bacteria 1167
50 Ga0157370_10002024 3300013104 Bacteria 24900
51 Ga0157370_10035999 3300013104 Bacteria 4807
52 Ga0157369_10006847 3300013105 Bacteria 13152
53 Ga0157369_10022815 3300013105 Bacteria 6979
54 Ga0157374_10548263 3300013296 Bacteria 1164
55 Ga0157374_10694137 3300013296 Bacteria 1031
56 Ga0157372_10245924 3300013307 Bacteria 2076
57 Ga0157372_10490855 3300013307 Bacteria 1432
58 Ga0157375_10142835 3300013308 Bacteria 2522
59 Ga0163163_10012505 3300014325 Bacteria 7737
60 Ga0157376_10461410 3300014969 Bacteria 1241
61 Ga0157376_10753603 3300014969 Bacteria 983
62 Ga0197907_10618575 3300020069 Unclassified 854
63 Ga0197907_11342963 3300020069 Unclassified 940
64 Ga0197907_11445851 3300020069 Bacteria 751
65 Ga0206356_11381259 3300020070 Bacteria 758
66 Ga0206356_11651477 3300020070 Bacteria 882
67 Ga0206352_10058863 3300020078 Bacteria 874
68 Ga0206352_10442877 3300020078 Unclassified 1231
69 Ga0206352_10928590 3300020078 Bacteria 982
70 Ga0206350_10033851 3300020080 Unclassified 775
71 Ga0206350_10349996 3300020080 Bacteria 952
72 Ga0213872_10041042 3300021361 Bacteria 2112
73 Ga0213876_10306654 3300021384 Bacteria 844
74 Ga0213875_10000017 3300021388 Bacteria 239813
75 Ga0213875_10004059 3300021388 Bacteria 8141
76 Ga0224712_10156129 3300022467 Bacteria 1015
77 Ga0224712_10300021 3300022467 Unclassified 751
78 Ga0207699_10127198 3300025906 Bacteria 1656
79 Ga0207643_10078464 3300025908 Bacteria 1910
80 Ga0207705_10156032 3300025909 Bacteria 1712
81 Ga0207654_10497333 3300025911 Unclassified 860
82 Ga0207695_10003715 3300025913 Bacteria 21248
83 Ga0207695_10025610 3300025913 Bacteria 6599
84 Ga0207695_10206101 3300025913 Bacteria 1879
85 Ga0207695_10362297 3300025913 Bacteria 1336
86 Ga0207695_10390425 3300025913 Unclassified 1277
87 Ga0207671_10075439 3300025914 Unclassified 2522
88 Ga0207671_10141435 3300025914 Bacteria 1854
89 Ga0207671_10526139 3300025914 Bacteria 943
90 Ga0207693_10183358 3300025915 Bacteria 1648
91 Ga0207663_10041670 3300025916 Bacteria 2800
92 Ga0207646_10083105 3300025922 Bacteria 2864
93 Ga0207694_10352903 3300025924 Bacteria 1218
94 Ga0207700_10000800 3300025928 Bacteria 18150
95 Ga0207700_11327693 3300025928 Bacteria 640
96 Ga0207664_10000368 3300025929 Bacteria 32985
97 Ga0207664_10687874 3300025929 Bacteria 920
98 Ga0207644_10635665 3300025931 Bacteria 888
99 Ga0207670_10142582 3300025936 Bacteria 1768
100 Ga0207704_10155741 3300025938 Bacteria 1619
101 Ga0207691_10006566 3300025940 Bacteria 11235
102 Ga0207711_10038181 3300025941 Bacteria 4082
103 Ga0207711_10121563 3300025941 Unclassified 2332
104 Ga0207711_10373441 3300025941 Bacteria 1322
105 Ga0207677_10790818 3300026023 Bacteria 849
106 Ga0207702_10397543 3300026078 Bacteria 1328
107 Ga0207702_10740967 3300026078 Unclassified 970
108 Ga0207676_10407127 3300026095 Bacteria 1273
109 Ga0207698_10348785 3300026142 Bacteria 1397
110 Ga0265338_10104586 3300028800 Unclassified 2297
111 Ga0265331_10126540 3300031250 Bacteria 1167
112 Ga0265314_10072952 3300031711 Bacteria 2291
113 Ga0265342_10318264 3300031712 Bacteria 816
114 Ga0373945_0182277 3300035116 Unclassified 865
115 Ga0373955_0395497 3300035172 Bacteria 839
116 Ga0373935_0017116 3300035692 Bacteria 4392
117 Ga0373935_0077549 3300035692 Bacteria 2154
118 Ga0373927_0016185 3300035695 Bacteria 4921
119 Ga0373927_0085862 3300035695 Bacteria 2043
120 Ga0373933_0484415 3300035724 Bacteria 810
121 Ga0373947_0056796 3300035725 Bacteria 2367
122 Ga0373947_0121920 3300035725 Unclassified 1657
123 Ga0373947_0337181 3300035725 Bacteria 1010
124 Ga0373937_0019203 3300036401 Bacteria 6119
125 Ga0373937_0114304 3300036401 Bacteria 2513
126 Ga0395900_1058066 3300037418 Unclassified 730
127 Ga0395898_0046907 3300037466 Unclassified 4243
128 Ga0436364_0339530 3300037853 Bacteria 240640
129 Ga0436364_0504129 3300037853 Bacteria 1955
130 Ga0436364_0834003 3300037853 Bacteria 6495
131 Ga0436365_1109302 3300039437 Bacteria 1238
132 Ga0436365_1362022 3300039437 Unclassified 1719
133 Ga0436361_0725075 3300039447 Bacteria 2580
134 Ga0436362_1169701 3300039453 Bacteria 1889
135 Ga0466966_0488243 3300044684 Bacteria 741
136 Ga0495580_0021650 3300046472 Bacteria 4741
137 Ga0495580_0051651 3300046472 Unclassified 2906
138 Ga0495639_0143808 3300046475 Bacteria 1148
139 Ga0495664_0708380 3300046477 Unclassified 595
140 Ga0495628_0306399 3300046516 Bacteria 1175
141 Ga0495630_0438579 3300046517 Unclassified 1001
142 Ga0495630_0643035 3300046517 Bacteria 812
143 Ga0495666_0276312 3300046526 Bacteria 762
144 Ga0495654_0098705 3300046530 Bacteria 1347
145 Ga0495587_0109275 3300046536 Unclassified 1589
146 Ga0495621_0000259 3300046539 Bacteria 12600
147 Ga0495597_0040132 3300046542 Bacteria 2093
148 Ga0495633_0106057 3300046558 Unclassified 1304
149 Ga0495633_0461319 3300046558 Unclassified 574
150 Ga0495667_0082147 3300046559 Bacteria 2094
151 Ga0495625_0000088 3300046660 Bacteria 150352
152 Ga0495588_0302616 3300046674 Bacteria 842
153 Ga0495623_0099006 3300046679 Bacteria 1779
154 Ga0495647_0005006 3300046681 Bacteria 4338
155 Ga0495658_0003285 3300046683 Bacteria 8037
156 Ga0495613_0188012 3300046689 Bacteria 1461
157 Ga0495670_0081156 3300046691 Unclassified 1652
158 Ga0495674_0023963 3300047319 Bacteria 5615
159 Ga0495674_0139468 3300047319 Bacteria 2039
160 Ga0495674_0387012 3300047319 Bacteria 1131
161 Ga0495674_0577897 3300047319 Unclassified 892
162 Ga0495675_0054424 3300047444 Bacteria 2539
163 Ga0495681_0004370 3300047470 Bacteria 9658
164 Ga0495684_0024739 3300047471 Bacteria 4618
165 Ga0501032_0218208 3300049569 Unclassified 1242
166 Ga0501033_0196436 3300049570 Unclassified 1442
167 Ga0501034_0563585 3300049571 Bacteria 1048
168 Ga0501038_0482263 3300049574 Unclassified 950
169 Ga0501047_0038811 3300049581 Bacteria 4607
170 Ga0501047_0279467 3300049581 Unclassified 1514
171 Ga0501047_0526126 3300049581 Bacteria 1008
172 Ga0501070_0033580 3300049586 Bacteria 4294
173 Ga0501080_0329617 3300049742 Unclassified 1381
174 Ga0501035_0081524 3300049822 Unclassified 2855
175 Ga0501035_0265523 3300049822 Bacteria 1454
176 Ga0501044_0001789 3300049823 Bacteria 25105
177 Ga0501044_0030938 3300049823 Bacteria 5636
178 Ga0501044_0344691 3300049823 Unclassified 1410
179 nmdc:mga0k408_577384_c1 3300050493 Bacteria 664
180 nmdc:mga06r32_45256_c1 3300050510 Unclassified 4194
181 Ga0500652_000040 3300053131 Bacteria 68826
182 Ga0500655_000163 3300053133 Bacteria 16343
183 Ga0500573_0159897 3300053140 Unclassified 1227
184 Ga0500589_177275 3300053147 Bacteria 841
185 Ga0500570_000071 3300053724 Bacteria 26578
186 Ga0105248_10751522
187 Ga0058861_11799717
188 Ga0058862_10057365
189 Ga0070658_10025995
190 Ga0068868_100025476
191 Ga0070671_100523448
192 Ga0070667_101398452
193 Ga0070709_10053065
194 Ga0070714_100079939
195 Ga0070714_100790110
196 Ga0070713_100086755
197 Ga0070713_101043227
198 Ga0070711_100043594
199 Ga0068857_100503173
200 Ga0068856_100119227
201 Ga0068852_100384806
202 Ga0068852_100421741
203 Ga0068852_100817998
204 Ga0068864_100346396
205 Ga0068863_100055730
206 Ga0068863_100928822
207 Ga0070717_10013375
208 Ga0070717_10180231
209 Ga0070717_10186881
210 Ga0070712_100090807
211 Ga0075366_10030412
212 Ga0068871_100501490
213 Ga0068871_101039221
214 Ga0075431_100002844
215 Ga0068865_100055594
216 Ga0105240_10000651
217 Ga0105240_10001187
218 Ga0105240_10015615
219 Ga0105240_10028611
220 Ga0105240_10033395
221 Ga0105240_10308184
222 Ga0105241_10374025
223 Ga0105241_10679498
224 Ga0105242_10470934
225 Ga0105248_10116132
226 Ga0105248_10147897
227 Ga0105248_10596103
228 Ga0105237_10001552
229 Ga0105237_10034282
230 Ga0105237_10524899
231 Ga0105237_10527914
232 Ga0105238_10062562
233 Ga0105239_10031212
234 Ga0105239_10690768
235 Ga0157370_10002024
236 Ga0157370_10035999
237 Ga0157369_10006847
238 Ga0157369_10022815
239 Ga0157374_10548263
240 Ga0157374_10694137
241 Ga0157372_10245924
242 Ga0157372_10490855
243 Ga0157375_10142835
244 Ga0163163_10012505
245 Ga0157376_10461410
246 Ga0157376_10753603
247 Ga0197907_10618575
248 Ga0197907_11342963
249 Ga0197907_11445851
250 Ga0206356_11381259
251 Ga0206356_11651477
252 Ga0206352_10058863
253 Ga0206352_10442877
254 Ga0206352_10928590
255 Ga0206350_10033851
256 Ga0206350_10349996
257 Ga0213872_10041042
258 Ga0213876_10306654
259 Ga0213875_10000017
260 Ga0213875_10004059
261 Ga0224712_10156129
262 Ga0224712_10300021
263 Ga0207699_10127198
264 Ga0207643_10078464
265 Ga0207705_10156032
266 Ga0207654_10497333
267 Ga0207695_10003715
268 Ga0207695_10025610
269 Ga0207695_10206101
270 Ga0207695_10362297
271 Ga0207695_10390425
272 Ga0207671_10075439
273 Ga0207671_10141435
274 Ga0207671_10526139
275 Ga0207693_10183358
276 Ga0207663_10041670
277 Ga0207646_10083105
278 Ga0207694_10352903
279 Ga0207700_10000800
280 Ga0207700_11327693
281 Ga0207664_10000368
282 Ga0207664_10687874
283 Ga0207644_10635665
284 Ga0207670_10142582
285 Ga0207704_10155741
286 Ga0207691_10006566
287 Ga0207711_10038181
288 Ga0207711_10121563
289 Ga0207711_10373441
290 Ga0207677_10790818
291 Ga0207702_10397543
292 Ga0207702_10740967
293 Ga0207676_10407127
294 Ga0207698_10348785
295 Ga0265338_10104586
296 Ga0265331_10126540
297 Ga0265314_10072952
298 Ga0265342_10318264
299 Ga0373945_0182277
300 Ga0373955_0395497
301 Ga0373935_0017116
302 Ga0373935_0077549
303 Ga0373927_0016185
304 Ga0373927_0085862
305 Ga0373933_0484415
306 Ga0373947_0056796
307 Ga0373947_0121920
308 Ga0373947_0337181
309 Ga0373937_0019203
310 Ga0373937_0114304
311 Ga0395900_1058066
312 Ga0395898_0046907
313 Ga0436364_0339530
314 Ga0436364_0504129
315 Ga0436364_0834003
316 Ga0436365_1109302
317 Ga0436365_1362022
318 Ga0436361_0725075
319 Ga0436362_1169701
320 Ga0466966_0488243
321 Ga0495580_0021650
322 Ga0495580_0051651
323 Ga0495639_0143808
324 Ga0495664_0708380
325 Ga0495628_0306399
326 Ga0495630_0438579
327 Ga0495630_0643035
328 Ga0495666_0276312
329 Ga0495654_0098705
330 Ga0495587_0109275
331 Ga0495621_0000259
332 Ga0495597_0040132
333 Ga0495633_0106057
334 Ga0495633_0461319
335 Ga0495667_0082147
336 Ga0495625_0000088
337 Ga0495588_0302616
338 Ga0495623_0099006
339 Ga0495647_0005006
340 Ga0495658_0003285
341 Ga0495613_0188012
342 Ga0495670_0081156
343 Ga0495674_0023963
344 Ga0495674_0139468
345 Ga0495674_0387012
346 Ga0495674_0577897
347 Ga0495675_0054424
348 Ga0495681_0004370
349 Ga0495684_0024739
350 Ga0501032_0218208
351 Ga0501033_0196436
352 Ga0501034_0563585
353 Ga0501038_0482263
354 Ga0501047_0038811
355 Ga0501047_0279467
356 Ga0501047_0526126
357 Ga0501070_0033580
358 Ga0501080_0329617
359 Ga0501035_0081524
360 Ga0501035_0265523
361 Ga0501044_0001789
362 Ga0501044_0030938
363 Ga0501044_0344691
364 nmdc:mga0k408_577384_c1
365 nmdc:mga06r32_45256_c1
366 Ga0500652_000040
367 Ga0500655_000163
368 Ga0500573_0159897
369 Ga0500589_177275
370 Ga0500570_000071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

60

200

0.96

PF02915

Rubrerythrin

Rubrerythrin

61

196

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hjf-assembly1.cif.gz_D the apo form of dps4 from nostoc punctiforme 0.9422 36 176
4toc-assembly1.cif.gz_A 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9419 37 178
4tod-assembly1.cif.gz_A 2.05a resolution structure of bfrb (d34f) from pseudomonas aeruginosa 0.9408 37 178
1nf6-assembly2.cif.gz_F "x-ray structure of the desulfovibrio desulfuricans bacterioferritin: the diiron site in different catalytic states (""cycled"" structure: reduced in solution and allowed to reoxidise before crystallisation)" 0.9394 36 177
4toc-assembly1.cif.gz_W 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9386 34 178
ID Description Score Start End Superfamily
af_Q8I2J1_338_456_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9503 123 179 3.30.40.10
5hjfD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9422 36 176 1.20.1260.10
1nf6F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9394 36 177 1.20.1260.10
3is8P00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.938 34 178 1.20.1260.10
3is8S00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.938 34 178 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3M5D710-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9934 85 178 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A534AUP0-F1-model_v4 Ferritin-like domain-containing protein 0.9914 69 181 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A3B8PCN6-F1-model_v4 deleted 0.9839 88 178
AF-A0A534PC10-F1-model_v4 Bacterioferritin 0.9809 47 178 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A059KK39-F1-model_v4 Ferritin/DPS protein domain-containing protein 0.9807 35 177 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037

Map