F283505

General Info

Members Datasets Scaffolds Average Seq Length
184 142 155 300

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8046352972|8046354079
Length 337
Sequence TQSVRGTGRVASGPAPGDASAANVAAEASARPALPPVRRRPLRPRLAPWLFVGPALVLAAGLLLAPLVYTLVLSFRGRQVAGGGLGLATEVWVGLDNYVRSLTDPALYASFGRMLVYALIAVPVTMGLALLFALLLDHLATRFRRFSRVSIFVPYAVPGVIAALMWGFMYLPGVSPIRDAFAAVGLPEPDLMGPVSVFFAVANVTIWGSVGFNMVILYTSLRGLPQELYESARLDGCSELQLALRIKVPLIVPGVILTGLFAIIGALQVFSEPNMMMTLTNSITSDWVPMMLVYRDAFVTNDLYGGAATAMIITLVTLVASLGLLKVLQRRAFGGES

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
4 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
5 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
6 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
7 2808606394 Promicromonospora sp. C35 Isolate Unclassified
8 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
9 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
10 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
11 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
12 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
13 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
14 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
15 2867428634 Streptomyces sp. RP5T Isolate Unclassified
16 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
17 2928153084 Leifsonia sp. 563 Isolate Unclassified
18 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
19 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
20 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
21 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
22 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
23 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
24 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
25 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
26 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
62 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
73 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
141 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
142 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.7
Metatranscriptomes 0.54
Isolates 15.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 0
Rhizoplane 0.54
Rhizosphere 73.37
Stem 0
Stem Tuber 0
Unclassified 18.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10015806 3300002067 Bacteria 2349
2 Ga0006562J51391_1096277 3300003578 Bacteria 7210
3 Ga0070658_10029441 3300005327 Bacteria 4411
4 Ga0070714_100001935 3300005435 Bacteria 15133
5 Ga0070714_100002028 3300005435 Bacteria 14834
6 Ga0070710_10000347 3300005437 Bacteria 22041
7 Ga0070710_10083506 3300005437 Bacteria 1870
8 Ga0070711_100007277 3300005439 Bacteria 6727
9 Ga0070663_100018031 3300005455 Bacteria 4619
10 Ga0068853_100023793 3300005539 Bacteria 5131
11 Ga0068855_100006626 3300005563 Bacteria 14068
12 Ga0068855_100007628 3300005563 Bacteria 13083
13 Ga0068854_100019011 3300005578 Bacteria 4622
14 Ga0068852_100018338 3300005616 Bacteria 5514
15 Ga0081540_1002307 3300005983 Bacteria 15648
16 Ga0081540_1009303 3300005983 Bacteria 6779
17 Ga0075365_10049471 3300006038 Bacteria 2770
18 Ga0070716_100136364 3300006173 Bacteria 1559
19 Ga0075362_10014011 3300006177 Bacteria 3226
20 Ga0075370_10020341 3300006353 Bacteria 3625
21 Ga0105240_10014489 3300009093 Bacteria 10765
22 Ga0105241_10002540 3300009174 Bacteria 13697
23 Ga0105238_10004425 3300009551 Bacteria 13936
24 Ga0105239_10015818 3300010375 Bacteria 8349
25 Ga0105239_10111957 3300010375 Bacteria 3026
26 Ga0157369_10008886 3300013105 Bacteria 11510
27 Ga0157374_10016373 3300013296 Bacteria 6513
28 Ga0207692_10001270 3300025898 Bacteria 9367
29 Ga0207647_10005648 3300025904 Bacteria 9135
30 Ga0207654_10017351 3300025911 Bacteria 3760
31 Ga0207695_10007673 3300025913 Bacteria 13663
32 Ga0207671_10000307 3300025914 Bacteria 72252
33 Ga0207694_10001463 3300025924 Bacteria 20199
34 Ga0207694_10109301 3300025924 Bacteria 2198
35 Ga0207664_10118608 3300025929 Bacteria 2211
36 Ga0207664_10151996 3300025929 Bacteria 1967
37 Ga0207667_10002623 3300025949 Bacteria 22264
38 Ga0207667_10106843 3300025949 Bacteria 2887
39 Ga0207640_10003238 3300025981 Bacteria 8773
40 Ga0207678_10015989 3300026067 Bacteria 6590
41 Ga0207702_10143167 3300026078 Bacteria 2166
42 Ga0268266_10131537 3300028379 Bacteria 2238
43 Ga0316177_1032617 3300030731 Bacteria 2928
44 Ga0316176_1189300 3300030732 Bacteria 4095
45 Ga0307513_10104526 3300031456 Bacteria 2845
46 Ga0307509_10009969 3300031507 Bacteria 11736
47 Ga0307408_100076860 3300031548 Bacteria 2485
48 Ga0307508_10085652 3300031616 Bacteria 2734
49 Ga0307508_10257902 3300031616 Bacteria 1339
50 Ga0307516_10014914 3300031730 Bacteria 8199
51 Ga0307413_10432317 3300031824 Bacteria 1040
52 Ga0307406_10000005 3300031901 Bacteria 155981
53 Ga0307406_10130325 3300031901 Bacteria 1764
54 Ga0307406_10200914 3300031901 Bacteria 1467
55 Ga0307409_100209897 3300031995 Bacteria 1749
56 Ga0307507_10263046 3300033179 Bacteria 1099
57 Ga0316215_1009636 3300033544 Bacteria 953
58 Ga0316214_1008453 3300033545 Bacteria 1385
59 Ga0373953_0054075 3300035117 Bacteria 1628
60 Ga0373925_0001018 3300037068 Bacteria 25375
61 Ga0466969_0001772 3300044656 Bacteria 11503
62 Ga0466972_0075883 3300044658 Bacteria 1601
63 Ga0466965_0005771 3300044683 Bacteria 5587
64 Ga0466965_0010542 3300044683 Bacteria 4317
65 Ga0466965_0012138 3300044683 Bacteria 4046
66 Ga0466966_0009437 3300044684 Bacteria 6462
67 Ga0466961_0011361 3300044693 Bacteria 5693
68 Ga0466963_0031150 3300044694 Bacteria 3446
69 Ga0466968_0032353 3300044735 Bacteria 2175
70 Ga0466960_0000667 3300044901 Bacteria 11931
71 Ga0466967_0251827 3300045976 Bacteria 1687
72 Ga0495592_0133804 3300046454 Bacteria 1731
73 Ga0495651_0005236 3300046462 Bacteria 9885
74 Ga0495651_0364793 3300046462 Bacteria 951
75 Ga0495628_0028457 3300046516 Bacteria 4541
76 Ga0495628_0200850 3300046516 Bacteria 1502
77 Ga0495652_0002948 3300046529 Bacteria 17123
78 Ga0495652_0005151 3300046529 Bacteria 12352
79 Ga0495645_0019104 3300046543 Bacteria 4933
80 Ga0495667_0021081 3300046559 Bacteria 4396
81 Ga0495634_0062066 3300046642 Bacteria 2483
82 Ga0495635_0003913 3300046663 Bacteria 10350
83 Ga0495635_0022003 3300046663 Bacteria 4443
84 Ga0495623_0015953 3300046679 Bacteria 4855
85 Ga0495646_0002636 3300046680 Bacteria 11079
86 Ga0495613_0216350 3300046689 Bacteria 1346
87 Ga0495600_0004874 3300046809 Bacteria 8063
88 Ga0495581_0064971 3300047315 Bacteria 2109
89 Ga0495602_0195958 3300048088 Bacteria 1545
90 Ga0496113_0054556 3300048916 Bacteria 2992
91 Ga0496117_0004262 3300048920 Bacteria 15955
92 Ga0496118_0039707 3300048921 Bacteria 3752
93 Ga0496118_0091548 3300048921 Bacteria 2091
94 Ga0496121_0181766 3300048924 Bacteria 1517
95 Ga0496122_0001688 3300048925 Bacteria 34239
96 Ga0496122_0023188 3300048925 Bacteria 5483
97 Ga0496123_0002197 3300048926 Bacteria 24824
98 Ga0496123_0023651 3300048926 Bacteria 4697
99 Ga0496123_0124998 3300048926 Bacteria 1438
100 Ga0496124_0181177 3300048927 Bacteria 1621
101 Ga0496125_0000221 3300048928 Bacteria 116650
102 Ga0496125_0186709 3300048928 Bacteria 1374
103 Ga0496125_0289390 3300048928 Bacteria 1010
104 Ga0501031_0002593 3300049568 Bacteria 11516
105 Ga0501031_0004576 3300049568 Bacteria 8972
106 Ga0501032_0011362 3300049569 Bacteria 6395
107 Ga0501032_0016566 3300049569 Bacteria 5182
108 Ga0501033_0002637 3300049570 Bacteria 15089
109 Ga0501033_0044494 3300049570 Bacteria 3304
110 Ga0501034_0020018 3300049571 Bacteria 6834
111 Ga0501034_0067003 3300049571 Bacteria 3604
112 Ga0501034_0078962 3300049571 Bacteria 3294
113 Ga0501036_0019564 3300049572 Bacteria 5684
114 Ga0501036_0045387 3300049572 Bacteria 3722
115 Ga0501036_0072872 3300049572 Bacteria 2903
116 Ga0501037_0070940 3300049573 Bacteria 2534
117 Ga0501038_0002906 3300049574 Bacteria 15969
118 Ga0501038_0057372 3300049574 Bacteria 3343
119 Ga0501039_0004329 3300049575 Bacteria 10705
120 Ga0501039_0010441 3300049575 Bacteria 7076
121 Ga0501042_0022589 3300049578 Bacteria 4395
122 Ga0501043_0012382 3300049579 Bacteria 6671
123 Ga0501046_0003090 3300049580 Bacteria 15369
124 Ga0501046_0005598 3300049580 Bacteria 11212
125 Ga0501047_0077959 3300049581 Bacteria 3186
126 Ga0501047_0081165 3300049581 Bacteria 3117
127 Ga0501048_0017924 3300049582 Bacteria 5210
128 Ga0501048_0024653 3300049582 Bacteria 4389
129 Ga0501068_0014035 3300049584 Bacteria 4573
130 Ga0501068_0181834 3300049584 Bacteria 1329
131 Ga0501070_0001057 3300049586 Bacteria 24767
132 Ga0501070_0024114 3300049586 Bacteria 5102
133 Ga0501073_0055728 3300049589 Bacteria 2765
134 Ga0501074_0022832 3300049590 Bacteria 4549
135 Ga0501080_0512386 3300049742 Bacteria 1071
136 Ga0501035_0072525 3300049822 Bacteria 3047
137 Ga0501044_0022016 3300049823 Bacteria 6795
138 Ga0501044_0073303 3300049823 Bacteria 3480
139 Ga0501045_0003118 3300049824 Bacteria 11333
140 Ga0501045_0046056 3300049824 Bacteria 3176
141 nmdc:mga03683_5902_c1 3300050489 Bacteria 3589
142 nmdc:mga00v17_75986_c2 3300050491 Bacteria 989
143 nmdc:mga0yw44_71850_c1 3300050492 Bacteria 2149
144 nmdc:mga07m45_19517_c1 3300050496 Bacteria 3674
145 Ga0495601_0005793 3300053077 Bacteria 7203
146 Ga0495601_0053093 3300053077 Bacteria 2561
147 Ga0495612_0002168 3300053078 Bacteria 8078
148 Ga0500651_0000717 3300053093 Bacteria 16308
149 Ga0500556_0000008 3300053104 Bacteria 304943
150 Ga0500568_0000003 3300053139 Bacteria 863587
151 Ga0500573_0015159 3300053140 Bacteria 4367
152 Ga0500573_0020334 3300053140 Bacteria 3803
153 Ga0500573_0211609 3300053140 Bacteria 1023
154 Ga0500577_0001541 3300053142 Bacteria 5875
155 Ga0501084_0241344 3300054114 Bacteria 1525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100023793 Ga0068853_1000237933 241
2 3300025924 Ga0207694_10109301 Ga0207694_101093013 255
3 3300044656 Ga0466969_0001772 Ga0466969_0001772_10184_11053 257
4 3300044684 Ga0466966_0009437 Ga0466966_0009437_3706_4575 257
5 3300044693 Ga0466961_0011361 Ga0466961_0011361_3469_4338 257
6 3300046689 Ga0495613_0216350 Ga0495613_0216350_82_996 257
7 3300047315 Ga0495581_0064971 Ga0495581_0064971_397_1311 257
8 3300053104 Ga0500556_0000008 Ga0500556_0000008_166543_167463 260
9 3300053139 Ga0500568_0000003 Ga0500568_0000003_141187_142107 260
10 3300005563 Ga0068855_100006626 Ga0068855_10000662613 261
11 3300025949 Ga0207667_10002623 Ga0207667_1000262316 261
12 3300046462 Ga0495651_0005236 Ga0495651_0005236_8667_9557 261
13 3300046516 Ga0495628_0028457 Ga0495628_0028457_2252_3142 261
14 3300046529 Ga0495652_0002948 Ga0495652_0002948_11864_12754 261
15 3300048928 Ga0496125_0289390 Ga0496125_0289390_11_916 261
16 3300005983 Ga0081540_1002307 Ga0081540_100230713 262
17 3300026078 Ga0207702_10143167 Ga0207702_101431672 262
18 3300046462 Ga0495651_0364793 Ga0495651_0364793_39_926 263
19 3300053077 Ga0495601_0053093 Ga0495601_0053093_933_1820 263
20 3300005983 Ga0081540_1009303 Ga0081540_10093033 264
21 3300049568 Ga0501031_0002593 Ga0501031_0002593_10333_11271 264
22 3300049569 Ga0501032_0011362 Ga0501032_0011362_588_1526 264
23 3300049570 Ga0501033_0002637 Ga0501033_0002637_4288_5226 264
24 3300049571 Ga0501034_0078962 Ga0501034_0078962_1421_2359 264
25 3300049572 Ga0501036_0019564 Ga0501036_0019564_3823_4761 264
26 3300049572 Ga0501036_0072872 Ga0501036_0072872_1863_2801 264
27 3300049573 Ga0501037_0070940 Ga0501037_0070940_706_1644 264
28 3300049574 Ga0501038_0002906 Ga0501038_0002906_891_1829 264
29 3300049575 Ga0501039_0004329 Ga0501039_0004329_7099_8037 264
30 3300049578 Ga0501042_0022589 Ga0501042_0022589_425_1363 264
31 3300049579 Ga0501043_0012382 Ga0501043_0012382_2677_3615 264
32 3300049580 Ga0501046_0003090 Ga0501046_0003090_10683_11621 264
33 3300049581 Ga0501047_0081165 Ga0501047_0081165_1996_2934 264
34 3300049582 Ga0501048_0024653 Ga0501048_0024653_2191_3129 264
35 3300049584 Ga0501068_0014035 Ga0501068_0014035_2579_3517 264
36 3300049589 Ga0501073_0055728 Ga0501073_0055728_612_1550 264
37 3300049590 Ga0501074_0022832 Ga0501074_0022832_1627_2565 264
38 3300049742 Ga0501080_0512386 Ga0501080_0512386_49_891 264
39 3300049823 Ga0501044_0073303 Ga0501044_0073303_1106_2044 264
40 3300049824 Ga0501045_0046056 Ga0501045_0046056_1669_2607 264
41 3300054114 Ga0501084_0241344 Ga0501084_0241344_314_1252 264
42 3300053140 Ga0500573_0211609 Ga0500573_0211609_158_1003 265
43 3300010375 Ga0105239_10111957 Ga0105239_101119573 266
44 3300049586 Ga0501070_0001057 Ga0501070_0001057_17420_18388 266
45 3300053140 Ga0500573_0020334 Ga0500573_0020334_2923_3774 266
46 3300044683 Ga0466965_0010542 Ga0466965_0010542_2717_3649 267
47 3300045976 Ga0466967_0251827 Ga0466967_0251827_817_1668 267
48 3300005455 Ga0070663_100018031 Ga0070663_1000180314 268
49 3300005563 Ga0068855_100007628 Ga0068855_1000076285 268
50 3300005578 Ga0068854_100019011 Ga0068854_1000190114 268
51 3300005616 Ga0068852_100018338 Ga0068852_1000183385 268
52 3300009093 Ga0105240_10014489 Ga0105240_100144893 268
53 3300009174 Ga0105241_10002540 Ga0105241_100025404 268
54 3300009551 Ga0105238_10004425 Ga0105238_1000442510 268
55 3300010375 Ga0105239_10015818 Ga0105239_100158185 268
56 3300013296 Ga0157374_10016373 Ga0157374_100163734 268
57 3300025904 Ga0207647_10005648 Ga0207647_100056484 269
58 3300025911 Ga0207654_10017351 Ga0207654_100173513 269
59 3300025913 Ga0207695_10007673 Ga0207695_1000767311 269
60 3300025914 Ga0207671_10000307 Ga0207671_100003074 269
61 3300025924 Ga0207694_10001463 Ga0207694_1000146318 269
62 3300025981 Ga0207640_10003238 Ga0207640_100032385 269
63 3300026067 Ga0207678_10015989 Ga0207678_100159894 269
64 3300028379 Ga0268266_10131537 Ga0268266_101315372 269
65 3300048924 Ga0496121_0181766 Ga0496121_0181766_424_1302 269
66 3300048927 Ga0496124_0181177 Ga0496124_0181177_605_1483 269
67 3300048928 Ga0496125_0000221 Ga0496125_0000221_97468_98346 269
68 3300005437 Ga0070710_10000347 Ga0070710_1000034713 270
69 3300025898 Ga0207692_10001270 Ga0207692_100012705 270
70 3300044658 Ga0466972_0075883 Ga0466972_0075883_519_1448 270
71 3300044683 Ga0466965_0005771 Ga0466965_0005771_2337_3266 270
72 3300044735 Ga0466968_0032353 Ga0466968_0032353_1163_2092 270
73 3300044901 Ga0466960_0000667 Ga0466960_0000667_6011_6940 270
74 3300046543 Ga0495645_0019104 Ga0495645_0019104_34_897 270
75 3300048925 Ga0496122_0001688 Ga0496122_0001688_14363_15223 270
76 3300048926 Ga0496123_0002197 Ga0496123_0002197_9646_10506 270
77 3300050489 nmdc:mga03683_5902_c1 nmdc:mga03683_5902_c1_2534_3442 270
78 3300050492 nmdc:mga0yw44_71850_c1 nmdc:mga0yw44_71850_c1_716_1624 270
79 3300050496 nmdc:mga07m45_19517_c1 nmdc:mga07m45_19517_c1_1293_2201 270
80 3300053093 Ga0500651_0000717 Ga0500651_0000717_3147_4145 274
81 3300006038 Ga0075365_10049471 Ga0075365_100494712 275
82 3300006177 Ga0075362_10014011 Ga0075362_100140112 275
83 3300006353 Ga0075370_10020341 Ga0075370_100203413 275
84 3300048925 Ga0496122_0023188 Ga0496122_0023188_1403_2320 275
85 3300048926 Ga0496123_0023651 Ga0496123_0023651_1338_2255 275
86 3300048926 Ga0496123_0124998 Ga0496123_0124998_506_1420 275
87 3300031616 Ga0307508_10085652 Ga0307508_100856522 276
88 3300033179 Ga0307507_10263046 Ga0307507_102630461 276
89 3300048921 Ga0496118_0091548 Ga0496118_0091548_1138_2076 276
90 iso_pu_bacteria 2515154155 2515855794 276
91 iso_pu_bacteria 2837268691 2837275207 276
92 3300005435 Ga0070714_100002028 Ga0070714_1000020287 277
93 3300005437 Ga0070710_10083506 Ga0070710_100835062 277
94 3300005439 Ga0070711_100007277 Ga0070711_1000072776 277
95 3300031901 Ga0307406_10000005 Ga0307406_1000000539 277
96 3300035117 Ga0373953_0054075 Ga0373953_0054075_73_954 277
97 3300044683 Ga0466965_0012138 Ga0466965_0012138_2430_3356 277
98 3300046559 Ga0495667_0021081 Ga0495667_0021081_1365_2246 277
99 3300046663 Ga0495635_0022003 Ga0495635_0022003_3508_4389 277
100 iso_pu_bacteria 2739367654 2739604546 277
101 iso_pu_bacteria 2758568522 2760303221 277
102 iso_pu_bacteria 2808606394 2809027717 277
103 iso_pu_bacteria 8045830549 8045833885 277
104 3300005435 Ga0070714_100001935 Ga0070714_10000193513 278
105 3300006173 Ga0070716_100136364 Ga0070716_1001363642 278
106 3300025929 Ga0207664_10118608 Ga0207664_101186082 278
107 3300025929 Ga0207664_10151996 Ga0207664_101519962 278
108 3300025949 Ga0207667_10106843 Ga0207667_101068432 278
109 3300030731 Ga0316177_1032617 Ga0316177_10326172 278
110 3300030732 Ga0316176_1189300 Ga0316176_11893003 278
111 3300033544 Ga0316215_1009636 Ga0316215_10096361 278
112 3300033545 Ga0316214_1008453 Ga0316214_10084531 278
113 3300037068 Ga0373925_0001018 Ga0373925_0001018_17184_18077 278
114 3300044694 Ga0466963_0031150 Ga0466963_0031150_36_929 278
115 3300053140 Ga0500573_0015159 Ga0500573_0015159_108_1055 278
116 iso_pu_bacteria 2738541272 2738697469 278
117 iso_pu_bacteria 2738543027 2739328066 278
118 iso_pu_bacteria 2939657138 2939659506 278
119 3300053142 Ga0500577_0001541 Ga0500577_0001541_3296_4225 280
120 3300050491 nmdc:mga00v17_75986_c2 nmdc:mga00v17_75986_c2_10_933 281
121 iso_pu_bacteria 2844852863 2844853444 281
122 3300049571 Ga0501034_0067003 Ga0501034_0067003_455_1354 282
123 3300031456 Ga0307513_10104526 Ga0307513_101045262 283
124 iso_pu_bacteria 8004182704 8004184276 283
125 3300031616 Ga0307508_10257902 Ga0307508_102579021 284
126 3300031730 Ga0307516_10014914 Ga0307516_100149145 284
127 iso_pu_bacteria 2643221616 2644097627 284
128 iso_pu_bacteria 2844841374 2844845190 284
129 iso_pu_bacteria 2928153084 2928154738 284
130 3300013105 Ga0157369_10008886 Ga0157369_1000888610 285
131 3300049568 Ga0501031_0004576 Ga0501031_0004576_1156_2151 285
132 3300049569 Ga0501032_0016566 Ga0501032_0016566_3044_4039 285
133 3300049570 Ga0501033_0044494 Ga0501033_0044494_652_1647 285
134 3300049571 Ga0501034_0020018 Ga0501034_0020018_2622_3617 285
135 3300049572 Ga0501036_0045387 Ga0501036_0045387_148_1143 285
136 3300049574 Ga0501038_0057372 Ga0501038_0057372_2329_3324 285
137 3300049575 Ga0501039_0010441 Ga0501039_0010441_3717_4712 285
138 3300049580 Ga0501046_0005598 Ga0501046_0005598_147_1142 285
139 3300049581 Ga0501047_0077959 Ga0501047_0077959_780_1775 285
140 3300049582 Ga0501048_0017924 Ga0501048_0017924_178_1173 285
141 3300049584 Ga0501068_0181834 Ga0501068_0181834_147_1142 285
142 3300049586 Ga0501070_0024114 Ga0501070_0024114_3684_4679 285
143 3300049822 Ga0501035_0072525 Ga0501035_0072525_1905_2900 285
144 3300049823 Ga0501044_0022016 Ga0501044_0022016_3896_4891 285
145 3300049824 Ga0501045_0003118 Ga0501045_0003118_1301_2296 285
146 iso_pu_bacteria 2857729791 2857731024 285
147 iso_pu_bacteria 2928121344 2928122414 285
148 3300031901 Ga0307406_10200914 Ga0307406_102009142 286
149 iso_pu_bacteria 8046352972 8046354079 286
150 3300005327 Ga0070658_10029441 Ga0070658_100294413 287
151 3300031507 Ga0307509_10009969 Ga0307509_100099697 287
152 3300031548 Ga0307408_100076860 Ga0307408_1000768602 287
153 3300031824 Ga0307413_10432317 Ga0307413_104323171 287
154 3300031901 Ga0307406_10130325 Ga0307406_101303252 287
155 3300031995 Ga0307409_100209897 Ga0307409_1002098972 287
156 3300046454 Ga0495592_0133804 Ga0495592_0133804_38_1045 287
157 3300046516 Ga0495628_0200850 Ga0495628_0200850_116_1123 287
158 3300046529 Ga0495652_0005151 Ga0495652_0005151_6765_7772 287
159 3300046642 Ga0495634_0062066 Ga0495634_0062066_319_1326 287
160 3300046663 Ga0495635_0003913 Ga0495635_0003913_6828_7841 287
161 3300046679 Ga0495623_0015953 Ga0495623_0015953_1955_2962 287
162 3300046680 Ga0495646_0002636 Ga0495646_0002636_3288_4295 287
163 3300046809 Ga0495600_0004874 Ga0495600_0004874_3261_4274 287
164 3300048088 Ga0495602_0195958 Ga0495602_0195958_471_1478 287
165 3300053077 Ga0495601_0005793 Ga0495601_0005793_4026_5033 287
166 3300053078 Ga0495612_0002168 Ga0495612_0002168_221_1234 287
167 iso_pu_bacteria 2816332139 2816510862 287
168 iso_pu_bacteria 2852646457 2852648341 287
169 iso_pu_bacteria 2862993130 2862995211 287
170 iso_pu_bacteria 2867428634 2867433598 287
171 iso_pu_bacteria 2945968032 2945970428 287
172 iso_pu_bacteria 2954711539 2954711953 287
173 iso_pu_bacteria 2954721474 2954721890 287
174 iso_pu_bacteria 2954731030 2954739961 287
175 iso_pu_bacteria 2954740390 2954740785 287
176 iso_pu_bacteria 2954749733 2954758780 287
177 iso_pu_bacteria 2954759201 2954759794 287
178 iso_pu_bacteria 2964326757 2964327789 287
179 3300002067 JGI24735J21928_10015806 JGI24735J21928_100158061 288
180 3300003578 Ga0006562J51391_1096277 Ga0006562J51391_10962775 288
181 3300048916 Ga0496113_0054556 Ga0496113_0054556_1602_2516 288
182 3300048920 Ga0496117_0004262 Ga0496117_0004262_5762_6736 288
183 3300048921 Ga0496118_0039707 Ga0496118_0039707_258_1232 288
184 3300048928 Ga0496125_0186709 Ga0496125_0186709_377_1291 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

126

334

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.8002 52 283
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7665 18 279
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.749 13 278
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7489 17 281
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7485 49 275
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8044 49 283 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7935 50 281 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7864 18 275 1.10.3720.10
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7794 52 281 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7727 50 281 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2L0UGH5-F1-model_v4 ABC transporter permease 0.8515 19 285 GO:0005886
GO:0055085
AF-A0A7W4V3V7-F1-model_v4 Multiple sugar transport system permease protein 0.8395 19 283 GO:0005886
GO:0055085
AF-A0A329XI23-F1-model_v4 Sugar ABC transporter permease 0.8354 19 280 GO:0005886
GO:0055085
AF-A0A418UUI3-F1-model_v4 Sugar ABC transporter permease 0.822 19 285 GO:0005886
GO:0055085
AF-A0A285JRW8-F1-model_v4 Multiple sugar transport system permease protein 0.8212 17 286 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
68.55 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map