F283464

General Info

Members Datasets Scaffolds Average Seq Length
184 118 368 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862507626|2862509291
Length 188
Sequence LGVWIRENRDGLDRAVQQAFTRPIPKSAGAQMRYLVKQLKGTRAVADALGVSQRTVERYVKDQIRRPRPDLARRLEDAVRARWQPRVRAQARKQAATTGGIVIDTRARFGFTAAPGTTDDARIRRLTLALPPHHAARLFDAQDRGAGERQLRDLAAEALGEVYFRDGGRRATGLAVQFTDVEYLEFDL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
3 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
4 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
5 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
6 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
7 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
8 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
9 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
10 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
11 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
12 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
13 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
14 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
15 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
16 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
17 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
18 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
19 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
20 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
21 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
22 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
23 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
24 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
25 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
26 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
27 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
28 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
29 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
30 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
31 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
32 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
33 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
34 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
35 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
36 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
37 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
38 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
39 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
40 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
41 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
42 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
43 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
44 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
45 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
46 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
47 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
48 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
49 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
50 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
51 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
52 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
53 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
54 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
55 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
56 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
57 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
58 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
59 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
60 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
61 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
62 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
63 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
64 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
65 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
69 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
72 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
73 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
74 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
75 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
76 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
87 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
88 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
89 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
90 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
91 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
92 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
93 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
94 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
95 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
96 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
99 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
100 2643221647 Streptomyces sp. Root369 Isolate Unclassified
101 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
102 2808606448 Streptomyces sp. 193411 Isolate Unclassified
103 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
104 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
105 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
106 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
107 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
108 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
109 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
110 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
111 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
112 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
113 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
114 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
115 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
116 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
117 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
118 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.52
Metatranscriptomes 0
Isolates 18.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 0
Rhizoplane 5.43
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10119173 3300003323 Bacteria 4462
2 Ga0075370_10721425 3300006353 Bacteria 606
3 Ga0207639_10018774 3300026041 Bacteria 4918
4 Ga0207639_10065187 3300026041 Bacteria 2827
5 Ga0207678_10772733 3300026067 Bacteria 847
6 Ga0314311_1082229 3300030733 Bacteria 841
7 Ga0307508_10326787 3300031616 Bacteria 1125
8 Ga0307514_10003045 3300031649 Bacteria 16549
9 Ga0307514_10121576 3300031649 Bacteria 1819
10 Ga0307416_100669922 3300032002 Bacteria 1124
11 Ga0307510_10013312 3300033180 Bacteria 9754
12 Ga0439439_0226452 3300041406 Bacteria 549
13 Ga0451853_1570365 3300041512 Bacteria 810
14 Ga0439449_0013500 3300042007 Bacteria 3073
15 Ga0439449_0280020 3300042007 Bacteria 628
16 Ga0439457_002251 3300042014 Bacteria 5582
17 Ga0466972_0014289 3300044658 Bacteria 3978
18 Ga0466972_0020497 3300044658 Bacteria 3303
19 Ga0466972_0114666 3300044658 Bacteria 1272
20 Ga0466965_0209911 3300044683 Bacteria 1035
21 Ga0466966_0001004 3300044684 Bacteria 18011
22 Ga0466966_0003396 3300044684 Bacteria 10502
23 Ga0466964_0213644 3300044706 Bacteria 933
24 Ga0466971_0015976 3300044719 Bacteria 3307
25 Ga0466971_0077732 3300044719 Bacteria 1511
26 Ga0466970_0440878 3300044765 Bacteria 746
27 Ga0466957_0011493 3300044842 Bacteria 5110
28 Ga0466959_0671748 3300045049 Bacteria 695
29 Ga0495627_046825 3300046453 Bacteria 1313
30 Ga0495603_0000213 3300046455 Bacteria 29952
31 Ga0495603_0005990 3300046455 Bacteria 7271
32 Ga0495603_0010608 3300046455 Bacteria 5583
33 Ga0495603_0011065 3300046455 Bacteria 5469
34 Ga0495603_0034506 3300046455 Bacteria 3041
35 Ga0495603_0321625 3300046455 Bacteria 888
36 Ga0495629_0061822 3300046459 Bacteria 2617
37 Ga0495629_0339127 3300046459 Bacteria 1026
38 Ga0495605_0020079 3300046474 Bacteria 3554
39 Ga0495639_0003472 3300046475 Bacteria 6821
40 Ga0495662_0154835 3300046476 Bacteria 1129
41 Ga0495662_0231370 3300046476 Bacteria 911
42 Ga0495662_0265270 3300046476 Bacteria 845
43 Ga0495585_0046052 3300046492 Bacteria 2433
44 Ga0495585_0086714 3300046492 Bacteria 1691
45 Ga0495594_0002237 3300046499 Bacteria 10074
46 Ga0495594_0022421 3300046499 Bacteria 3378
47 Ga0495594_0038752 3300046499 Bacteria 2603
48 Ga0495583_0014587 3300046506 Bacteria 4325
49 Ga0495583_0072337 3300046506 Bacteria 1513
50 Ga0495606_0016843 3300046507 Bacteria 5552
51 Ga0495606_0111875 3300046507 Bacteria 1646
52 Ga0495610_0071641 3300046512 Bacteria 1615
53 Ga0495616_0007498 3300046513 Bacteria 6532
54 Ga0495620_0004141 3300046515 Bacteria 8227
55 Ga0495620_0013781 3300046515 Bacteria 4132
56 Ga0495620_0066761 3300046515 Bacteria 1481
57 Ga0495628_0273941 3300046516 Bacteria 1255
58 Ga0495631_0009699 3300046518 Bacteria 4800
59 Ga0495631_0101888 3300046518 Bacteria 1235
60 Ga0495632_0329301 3300046519 Bacteria 674
61 Ga0495643_0036866 3300046522 Bacteria 2684
62 Ga0495666_0025875 3300046526 Bacteria 2896
63 Ga0495652_0934229 3300046529 Bacteria 571
64 Ga0495597_0028571 3300046542 Bacteria 2552
65 Ga0495597_0269562 3300046542 Bacteria 665
66 Ga0495668_0021329 3300046616 Bacteria 3716
67 Ga0495668_0025126 3300046616 Bacteria 3386
68 Ga0495668_0029820 3300046616 Bacteria 3082
69 Ga0495634_0075800 3300046642 Bacteria 2208
70 Ga0495625_0006344 3300046660 Bacteria 10565
71 Ga0495625_0022858 3300046660 Bacteria 4784
72 Ga0495625_0028687 3300046660 Bacteria 4171
73 Ga0495625_0145435 3300046660 Bacteria 1596
74 Ga0495661_0040219 3300046665 Bacteria 2902
75 Ga0495588_0024364 3300046674 Bacteria 3006
76 Ga0495588_0061516 3300046674 Bacteria 1945
77 Ga0495657_0002078 3300046675 Bacteria 17006
78 Ga0495657_0040788 3300046675 Bacteria 3181
79 Ga0495613_0077914 3300046689 Bacteria 2411
80 Ga0495624_0010894 3300046690 Bacteria 6268
81 Ga0495624_0193897 3300046690 Bacteria 1235
82 Ga0495649_0043552 3300046694 Bacteria 2450
83 Ga0495649_0160831 3300046694 Bacteria 1177
84 Ga0495589_0011484 3300046794 Bacteria 4598
85 Ga0495589_0298109 3300046794 Bacteria 747
86 Ga0495660_0046863 3300046810 Bacteria 2369
87 Ga0495660_0303787 3300046810 Bacteria 722
88 Ga0495581_0591941 3300047315 Bacteria 643
89 Ga0495636_0002385 3300047318 Bacteria 7216
90 Ga0495676_0000449 3300047321 Bacteria 33738
91 Ga0495676_0025443 3300047321 Bacteria 5110
92 Ga0495676_0315843 3300047321 Bacteria 1050
93 Ga0495683_0022040 3300047323 Bacteria 3277
94 Ga0495683_0161258 3300047323 Bacteria 1037
95 Ga0495683_0269233 3300047323 Bacteria 741
96 Ga0495687_000632 3300047443 Bacteria 40296
97 Ga0495687_012649 3300047443 Bacteria 4448
98 Ga0495687_013409 3300047443 Bacteria 4280
99 Ga0495687_021321 3300047443 Bacteria 3137
100 Ga0495687_023902 3300047443 Bacteria 2914
101 Ga0495679_157068 3300047446 Bacteria 609
102 Ga0495685_000380 3300047447 Bacteria 14129
103 Ga0495681_0004282 3300047470 Bacteria 9777
104 Ga0495686_0071735 3300047472 Bacteria 2131
105 Ga0495593_0011451 3300047673 Bacteria 5095
106 Ga0495614_0019727 3300048089 Bacteria 2917
107 Ga0495614_0051125 3300048089 Bacteria 1771
108 Ga0495626_0061261 3300048091 Bacteria 1712
109 Ga0496101_0868999 3300048904 Bacteria 710
110 Ga0496105_0487048 3300048908 Bacteria 970
111 Ga0496106_0000747 3300048909 Bacteria 23467
112 Ga0496108_0110900 3300048911 Bacteria 2346
113 Ga0496109_0024171 3300048912 Bacteria 5399
114 Ga0496109_0469031 3300048912 Bacteria 1189
115 Ga0496110_0561805 3300048913 Bacteria 1037
116 Ga0496115_0654542 3300048918 Bacteria 830
117 Ga0496122_0408334 3300048925 Bacteria 687
118 Ga0496125_0089820 3300048928 Bacteria 2309
119 Ga0496126_0960552 3300048929 Bacteria 644
120 Ga0495678_027605 3300049459 Bacteria 2407
121 Ga0501033_0005551 3300049570 Bacteria 9975
122 Ga0501034_0137785 3300049571 Bacteria 2421
123 Ga0501037_0021834 3300049573 Bacteria 4737
124 Ga0501038_0435970 3300049574 Bacteria 1009
125 Ga0501043_0194416 3300049579 Bacteria 1577
126 Ga0501043_0280465 3300049579 Bacteria 1277
127 Ga0501046_0059960 3300049580 Bacteria 2979
128 Ga0501046_0075073 3300049580 Bacteria 2622
129 Ga0501047_0002454 3300049581 Bacteria 17707
130 Ga0501047_0004225 3300049581 Bacteria 13520
131 Ga0501047_0012610 3300049581 Bacteria 8007
132 Ga0501047_0027293 3300049581 Bacteria 5500
133 Ga0501047_0194715 3300049581 Bacteria 1889
134 Ga0501035_0150060 3300049822 Bacteria 2023
135 Ga0501044_0078053 3300049823 Bacteria 3356
136 nmdc:mga03n38_11497_c2 3300050490 Bacteria 1680
137 nmdc:mga03n38_346588_c1 3300050490 Bacteria 807
138 Ga0500578_0206083 3300053086 Bacteria 1201
139 Ga0500654_011501 3300053099 Bacteria 5984
140 Ga0500614_074872 3300053123 Bacteria 937
141 Ga0500621_021434 3300053126 Bacteria 2479
142 Ga0500652_012121 3300053131 Bacteria 3013
143 Ga0500573_0054143 3300053140 Bacteria 2304
144 Ga0500579_109521 3300053143 Bacteria 1397
145 Ga0500600_0263948 3300053149 Bacteria 762
146 Ga0500600_0267762 3300053149 Bacteria 753
147 Ga0500616_0005050 3300053153 Bacteria 9124
148 Ga0500634_0008337 3300053161 Bacteria 5176
149 Ga0500587_002716 3300053739 Bacteria 2504
150 Ga0466962_0007263 3300061719 Bacteria 5308
151 2862509291 2862507626 Bacteria 9425308
152 2547411141 2547132111 Bacteria 8013147
153 2644269343 2643221647 Bacteria 10741251
154 2784592713 2784132148 Bacteria 8627943
155 2809236549 2808606448 Bacteria 8656184
156 2862508255 2862507626 Bacteria 9425308
157 2862508285 2862507626 Bacteria 9425308
158 2862508658 2862507626 Bacteria 9425308
159 2862509285 2862507626 Bacteria 9425308
160 2862512258 2862507626 Bacteria 9425308
161 2862513519 2862507626 Bacteria 9425308
162 2862516664 2862507626 Bacteria 9425308
163 2912723947 2912715099 Bacteria 9460473
164 2912723968 2912715099 Bacteria 9460473
165 2912727398 2912723979 Bacteria 8557534
166 2918501155 2918501144 Bacteria 8668083
167 2918508940 2918501144 Bacteria 8668083
168 2954008041 2954002825 Bacteria 9173742
169 2954691529 2954691527 Bacteria 10720516
170 2954701440 2954691527 Bacteria 10720516
171 3006394779 3006393351 Bacteria 6615579
172 3006486239 3006486233 Bacteria 8157040
173 3006495998 3006493962 Bacteria 8825450
174 8023625216 8023623736 Bacteria 8593882
175 8025537153 8025530807 Bacteria 8495698
176 8047903067 8047893842 Bacteria 11723082
177 8047903596 8047893842 Bacteria 11723082
178 8048131974 8048127548 Bacteria 11053136
179 8048356860 8048356638 Bacteria 11044339
180 8048369683 8048369669 Bacteria 11666822
181 8048378966 8048369669 Bacteria 11666822
182 8048388071 8048379754 Bacteria 11877923
183 8048389911 8048379754 Bacteria 11877923
184 8056835053 8056829672 Bacteria 9045328
185 rootH1_10119173
186 Ga0075370_10721425
187 Ga0207639_10018774
188 Ga0207639_10065187
189 Ga0207678_10772733
190 Ga0314311_1082229
191 Ga0307508_10326787
192 Ga0307514_10003045
193 Ga0307514_10121576
194 Ga0307416_100669922
195 Ga0307510_10013312
196 Ga0439439_0226452
197 Ga0451853_1570365
198 Ga0439449_0013500
199 Ga0439449_0280020
200 Ga0439457_002251
201 Ga0466972_0014289
202 Ga0466972_0020497
203 Ga0466972_0114666
204 Ga0466965_0209911
205 Ga0466966_0001004
206 Ga0466966_0003396
207 Ga0466964_0213644
208 Ga0466971_0015976
209 Ga0466971_0077732
210 Ga0466970_0440878
211 Ga0466957_0011493
212 Ga0466959_0671748
213 Ga0495627_046825
214 Ga0495603_0000213
215 Ga0495603_0005990
216 Ga0495603_0010608
217 Ga0495603_0011065
218 Ga0495603_0034506
219 Ga0495603_0321625
220 Ga0495629_0061822
221 Ga0495629_0339127
222 Ga0495605_0020079
223 Ga0495639_0003472
224 Ga0495662_0154835
225 Ga0495662_0231370
226 Ga0495662_0265270
227 Ga0495585_0046052
228 Ga0495585_0086714
229 Ga0495594_0002237
230 Ga0495594_0022421
231 Ga0495594_0038752
232 Ga0495583_0014587
233 Ga0495583_0072337
234 Ga0495606_0016843
235 Ga0495606_0111875
236 Ga0495610_0071641
237 Ga0495616_0007498
238 Ga0495620_0004141
239 Ga0495620_0013781
240 Ga0495620_0066761
241 Ga0495628_0273941
242 Ga0495631_0009699
243 Ga0495631_0101888
244 Ga0495632_0329301
245 Ga0495643_0036866
246 Ga0495666_0025875
247 Ga0495652_0934229
248 Ga0495597_0028571
249 Ga0495597_0269562
250 Ga0495668_0021329
251 Ga0495668_0025126
252 Ga0495668_0029820
253 Ga0495634_0075800
254 Ga0495625_0006344
255 Ga0495625_0022858
256 Ga0495625_0028687
257 Ga0495625_0145435
258 Ga0495661_0040219
259 Ga0495588_0024364
260 Ga0495588_0061516
261 Ga0495657_0002078
262 Ga0495657_0040788
263 Ga0495613_0077914
264 Ga0495624_0010894
265 Ga0495624_0193897
266 Ga0495649_0043552
267 Ga0495649_0160831
268 Ga0495589_0011484
269 Ga0495589_0298109
270 Ga0495660_0046863
271 Ga0495660_0303787
272 Ga0495581_0591941
273 Ga0495636_0002385
274 Ga0495676_0000449
275 Ga0495676_0025443
276 Ga0495676_0315843
277 Ga0495683_0022040
278 Ga0495683_0161258
279 Ga0495683_0269233
280 Ga0495687_000632
281 Ga0495687_012649
282 Ga0495687_013409
283 Ga0495687_021321
284 Ga0495687_023902
285 Ga0495679_157068
286 Ga0495685_000380
287 Ga0495681_0004282
288 Ga0495686_0071735
289 Ga0495593_0011451
290 Ga0495614_0019727
291 Ga0495614_0051125
292 Ga0495626_0061261
293 Ga0496101_0868999
294 Ga0496105_0487048
295 Ga0496106_0000747
296 Ga0496108_0110900
297 Ga0496109_0024171
298 Ga0496109_0469031
299 Ga0496110_0561805
300 Ga0496115_0654542
301 Ga0496122_0408334
302 Ga0496125_0089820
303 Ga0496126_0960552
304 Ga0495678_027605
305 Ga0501033_0005551
306 Ga0501034_0137785
307 Ga0501037_0021834
308 Ga0501038_0435970
309 Ga0501043_0194416
310 Ga0501043_0280465
311 Ga0501046_0059960
312 Ga0501046_0075073
313 Ga0501047_0002454
314 Ga0501047_0004225
315 Ga0501047_0012610
316 Ga0501047_0027293
317 Ga0501047_0194715
318 Ga0501035_0150060
319 Ga0501044_0078053
320 nmdc:mga03n38_11497_c2
321 nmdc:mga03n38_346588_c1
322 Ga0500578_0206083
323 Ga0500654_011501
324 Ga0500614_074872
325 Ga0500621_021434
326 Ga0500652_012121
327 Ga0500573_0054143
328 Ga0500579_109521
329 Ga0500600_0263948
330 Ga0500600_0267762
331 Ga0500616_0005050
332 Ga0500634_0008337
333 Ga0500587_002716
334 Ga0466962_0007263
335 2862509291
336 2547411141
337 2644269343
338 2784592713
339 2809236549
340 2862508255
341 2862508285
342 2862508658
343 2862509285
344 2862512258
345 2862513519
346 2862516664
347 2912723947
348 2912723968
349 2912727398
350 2918501155
351 2918508940
352 2954008041
353 2954691529
354 2954701440
355 3006394779
356 3006486239
357 3006495998
358 8023625216
359 8025537153
360 8047903067
361 8047903596
362 8048131974
363 8048356860
364 8048369683
365 8048378966
366 8048388071
367 8048389911
368 8056835053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

32

80

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8y-assembly1.cif.gz_A solution structure of xph1, a hybrid sequence of xfaso 1 and pfl 6, two cro proteins with different folds 0.9233 27 55
7t5u-assembly1.cif.gz_A structure of e. coli ms115-1 caph n-terminal domain 0.8116 25 75
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.8103 25 75
3zkc-assembly1.cif.gz_B crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.7878 25 75
3qq6-assembly1.cif.gz_A the n-terminal dna binding domain of sinr from bacillus subtilis 0.7766 25 75
ID Description Score Start End Superfamily
af_Q4D7G0_684_830_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8223 126 154 1.20.120.1080
3qq6B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8138 25 75 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.81 25 75 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8072 25 75 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.795 21 75 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6M3JKP4-F1-model_v4 Putative antitoxin 0.9589 27 77
AF-H2KA40-F1-model_v4 deleted 0.9364 5 185
AF-A0A243Q900-F1-model_v4 DNA-binding protein 0.9349 16 82 GO:0003677
AF-A0A3N6GVV5-F1-model_v4 Terminal protein 0.9285 5 185 GO:0003677
AF-A0A7J0CHG0-F1-model_v4 DNA-binding protein 0.9224 88 185

Map