F283094

General Info

Members Datasets Scaffolds Average Seq Length
184 128 184 130

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0041459|Ga0495650_0041459_531_944
Length 137
Sequence MQRADDSQNVNMQNLSYISPFFIVSSLKASVTFYVNKLGFELRFIGPEGDPFFAIVGRDHISIMLKAAGNPIPNYTRHEWARWDAFIHTAEPDALFGEYSSGGIIFRQSIRNDDDGLRGFEVTDADGYVLFFGKPVV

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
126 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
127 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
128 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 0.54
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10021911 3300003320 Bacteria 22507
2 rootH2_10078140 3300003320 Unclassified 1458
3 JGI25160J50197_1002584 3300003354 Bacteria 8359
4 Ga0070658_10000153 3300005327 Bacteria 60625
5 Ga0070690_100939199 3300005330 Bacteria 678
6 Ga0068869_100716884 3300005334 Bacteria 854
7 Ga0070680_100016303 3300005336 Bacteria 5846
8 Ga0068868_100038544 3300005338 Bacteria 3710
9 Ga0068868_101280381 3300005338 Unclassified 680
10 Ga0070660_100007068 3300005339 Bacteria 7799
11 Ga0070689_100060233 3300005340 Bacteria 2951
12 Ga0070661_100413330 3300005344 Unclassified 1068
13 Ga0070668_100144264 3300005347 Bacteria 1921
14 Ga0070671_100007468 3300005355 Bacteria 8738
15 Ga0070688_100121201 3300005365 Bacteria 1752
16 Ga0070659_100355104 3300005366 Bacteria 1230
17 Ga0070667_100018805 3300005367 Bacteria 5730
18 Ga0070667_100888262 3300005367 Unclassified 829
19 Ga0070681_10323632 3300005458 Bacteria 1451
20 Ga0070679_100014641 3300005530 Bacteria 7538
21 Ga0070679_100440390 3300005530 Unclassified 1248
22 Ga0068853_100083506 3300005539 Bacteria 2798
23 Ga0068853_100087914 3300005539 Unclassified 2727
24 Ga0070672_100941362 3300005543 Bacteria 764
25 Ga0070665_100785318 3300005548 Bacteria 965
26 Ga0068855_100000098 3300005563 Bacteria 105977
27 Ga0068855_100013032 3300005563 Bacteria 10029
28 Ga0068855_100503180 3300005563 Bacteria 1316
29 Ga0068855_100531399 3300005563 Bacteria 1275
30 Ga0068857_100021917 3300005577 Bacteria 5622
31 Ga0068854_100062603 3300005578 Unclassified 2698
32 Ga0068856_100001044 3300005614 Bacteria 29392
33 Ga0068856_100142943 3300005614 Bacteria 2400
34 Ga0068856_100308034 3300005614 Bacteria 1601
35 Ga0068852_100004592 3300005616 Bacteria 9778
36 Ga0068852_101158691 3300005616 Bacteria 794
37 Ga0068859_100000025 3300005617 Bacteria 191679
38 Ga0068864_100151353 3300005618 Bacteria 2102
39 Ga0068864_100945819 3300005618 Unclassified 852
40 Ga0068866_10363277 3300005718 Bacteria 923
41 Ga0068863_101169307 3300005841 Unclassified 775
42 Ga0068858_100023536 3300005842 Bacteria 5737
43 Ga0068860_100027825 3300005843 Bacteria 5445
44 Ga0068860_102503050 3300005843 Unclassified 536
45 Ga0068862_101636259 3300005844 Unclassified 651
46 Ga0070715_10253153 3300006163 Bacteria 921
47 Ga0097621_100059835 3300006237 Bacteria 3120
48 Ga0097621_101264807 3300006237 Bacteria 696
49 Ga0068871_100000706 3300006358 Bacteria 22685
50 Ga0068865_100177173 3300006881 Bacteria 1639
51 Ga0097620_100000025 3300006931 Bacteria 191679
52 Ga0105240_10003660 3300009093 Bacteria 23789
53 Ga0105240_10011830 3300009093 Bacteria 12119
54 Ga0105240_10013701 3300009093 Bacteria 11111
55 Ga0105240_12429734 3300009093 Unclassified 542
56 Ga0105247_10816075 3300009101 Unclassified 713
57 Ga0105241_10003958 3300009174 Bacteria 10954
58 Ga0105241_10135603 3300009174 Bacteria 1998
59 Ga0105241_10543233 3300009174 Bacteria 1042
60 Ga0105242_10206978 3300009176 Bacteria 1746
61 Ga0105242_11787408 3300009176 Unclassified 653
62 Ga0105248_10934977 3300009177 Bacteria 979
63 Ga0105237_10012067 3300009545 Bacteria 9126
64 Ga0105237_10084180 3300009545 Unclassified 3171
65 Ga0105237_10095317 3300009545 Bacteria 2965
66 Ga0105237_10166395 3300009545 Bacteria 2204
67 Ga0105238_10049633 3300009551 Bacteria 4225
68 Ga0105238_10923748 3300009551 Bacteria 892
69 Ga0105249_10454109 3300009553 Unclassified 1320
70 Ga0105239_10007917 3300010375 Bacteria 12150
71 Ga0105239_10036928 3300010375 Bacteria 5360
72 Ga0105239_10212249 3300010375 Bacteria 2170
73 Ga0105246_10030608 3300011119 Bacteria 3556
74 Ga0157373_10437592 3300013100 Unclassified 940
75 Ga0157370_10011422 3300013104 Bacteria 9287
76 Ga0157370_11254799 3300013104 Unclassified 668
77 Ga0157369_10041920 3300013105 Unclassified 4995
78 Ga0157374_10475947 3300013296 Bacteria 1252
79 Ga0157374_11370814 3300013296 Unclassified 730
80 Ga0157374_12975432 3300013296 Unclassified 501
81 Ga0157378_10298382 3300013297 Bacteria 1559
82 Ga0157378_10306369 3300013297 Bacteria 1539
83 Ga0163162_10008620 3300013306 Bacteria 9936
84 Ga0163162_10544850 3300013306 Bacteria 1289
85 Ga0157372_10012850 3300013307 Bacteria 8924
86 Ga0157375_10000870 3300013308 Bacteria 26284
87 Ga0157379_10085625 3300014968 Bacteria 2825
88 Ga0157376_10004602 3300014969 Bacteria 9609
89 Ga0163161_10003923 3300017792 Bacteria 10433
90 Ga0206356_10081099 3300020070 Unclassified 1079
91 Ga0206355_1340327 3300020076 Unclassified 506
92 Ga0209026_1018908 3300025250 Bacteria 1085
93 Ga0207426_1000002 3300025302 Bacteria 1249660
94 Ga0207642_11148639 3300025899 Unclassified 503
95 Ga0207680_10386393 3300025903 Unclassified 987
96 Ga0207647_10067885 3300025904 Bacteria 2159
97 Ga0207685_10189931 3300025905 Bacteria 958
98 Ga0207705_10000108 3300025909 Bacteria 93501
99 Ga0207705_10136815 3300025909 Bacteria 1827
100 Ga0207654_10019999 3300025911 Bacteria 3542
101 Ga0207654_10182893 3300025911 Bacteria 1368
102 Ga0207654_10525970 3300025911 Unclassified 838
103 Ga0207654_11200795 3300025911 Unclassified 553
104 Ga0207707_10049637 3300025912 Bacteria 3656
105 Ga0207695_10027817 3300025913 Bacteria 6289
106 Ga0207695_10041102 3300025913 Bacteria 4950
107 Ga0207695_10136261 3300025913 Bacteria 2408
108 Ga0207695_10327999 3300025913 Bacteria 1419
109 Ga0207695_10461933 3300025913 Unclassified 1152
110 Ga0207671_10029882 3300025914 Bacteria 4066
111 Ga0207671_10373441 3300025914 Bacteria 1132
112 Ga0207657_10108874 3300025919 Bacteria 2290
113 Ga0207652_10019147 3300025921 Bacteria 5625
114 Ga0207652_10373576 3300025921 Unclassified 1287
115 Ga0207694_10024882 3300025924 Unclassified 4547
116 Ga0207644_10005564 3300025931 Bacteria 8198
117 Ga0207670_10263993 3300025936 Bacteria 1336
118 Ga0207704_10195905 3300025938 Bacteria 1474
119 Ga0207691_10555876 3300025940 Bacteria 973
120 Ga0207711_11928366 3300025941 Unclassified 534
121 Ga0207689_10524900 3300025942 Bacteria 993
122 Ga0207667_10000014 3300025949 Bacteria 421261
123 Ga0207667_10009296 3300025949 Bacteria 11594
124 Ga0207667_10100645 3300025949 Bacteria 2981
125 Ga0207667_10438018 3300025949 Bacteria 1329
126 Ga0207667_10469977 3300025949 Bacteria 1277
127 Ga0207651_10878398 3300025960 Bacteria 798
128 Ga0207712_11636840 3300025961 Unclassified 577
129 Ga0207640_10044559 3300025981 Unclassified 2843
130 Ga0207658_10065739 3300025986 Bacteria 2725
131 Ga0207658_10089586 3300025986 Bacteria 2382
132 Ga0207658_12046513 3300025986 Bacteria 521
133 Ga0207677_10028561 3300026023 Bacteria 3530
134 Ga0207703_10007755 3300026035 Bacteria 8496
135 Ga0207639_10070308 3300026041 Bacteria 2734
136 Ga0207639_10174004 3300026041 Unclassified 1826
137 Ga0207702_10010483 3300026078 Bacteria 7752
138 Ga0207702_10094131 3300026078 Unclassified 2629
139 Ga0207702_10179876 3300026078 Bacteria 1947
140 Ga0207648_10479640 3300026089 Bacteria 1136
141 Ga0207676_11006140 3300026095 Unclassified 821
142 Ga0207674_10092462 3300026116 Unclassified 3015
143 Ga0207698_10011193 3300026142 Bacteria 5805
144 Ga0268265_11308356 3300028380 Unclassified 725
145 Ga0268264_10043527 3300028381 Bacteria 3721
146 Ga0268264_10274070 3300028381 Bacteria 1577
147 Ga0265340_10174179 3300031247 Bacteria 974
148 Ga0373927_0328661 3300035695 Bacteria 1007
149 Ga0373933_0480372 3300035724 Bacteria 814
150 Ga0373937_0183507 3300036401 Bacteria 1965
151 Ga0373937_0997629 3300036401 Unclassified 786
152 Ga0373925_0455288 3300037068 Bacteria 1048
153 Ga0395899_0030182 3300037312 Unclassified 4078
154 Ga0395900_0000507 3300037418 Bacteria 54887
155 Ga0395900_0012592 3300037418 Bacteria 8654
156 Ga0395898_0737951 3300037466 Unclassified 926
157 Ga0395905_0004972 3300037471 Bacteria 13695
158 Ga0395901_0033723 3300038443 Bacteria 5286
159 Ga0466966_0127206 3300044684 Bacteria 1562
160 Ga0466957_0155576 3300044842 Bacteria 1482
161 Ga0495590_0404287 3300046457 Bacteria 524
162 Ga0495641_0319961 3300046461 Bacteria 700
163 Ga0495651_0823383 3300046462 Unclassified 572
164 Ga0495650_0041459 3300046471 Bacteria 1968
165 Ga0495585_0001088 3300046492 Bacteria 22366
166 Ga0495628_0551262 3300046516 Bacteria 828
167 Ga0495632_0209447 3300046519 Bacteria 885
168 Ga0495648_0004496 3300046524 Bacteria 11903
169 Ga0495609_0011323 3300046538 Bacteria 4250
170 Ga0495668_0000012 3300046616 Bacteria 458817
171 Ga0495625_0001346 3300046660 Bacteria 30375
172 Ga0495625_0009089 3300046660 Bacteria 8381
173 Ga0495658_0084929 3300046683 Bacteria 1865
174 Ga0495649_0027457 3300046694 Unclassified 3159
175 Ga0495649_0474536 3300046694 Unclassified 623
176 Ga0495600_0324510 3300046809 Bacteria 968
177 Ga0495614_0127330 3300048089 Bacteria 1125
178 Ga0496114_0193151 3300048917 Bacteria 1781
179 Ga0501047_0457847 3300049581 Bacteria 1105
180 Ga0500594_0210980 3300053118 Unclassified 640
181 Ga0500608_089137 3300053122 Bacteria 1444
182 Ga0500608_136309 3300053122 Bacteria 1094
183 Ga0500637_0370429 3300053178 Bacteria 755
184 Ga0500611_000003 3300053727 Bacteria 333431

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0041459 Ga0495650_0041459_531_944 125
2 3300003320 rootH2_10021911 rootH2_1002191119 128
3 3300003320 rootH2_10078140 rootH2_100781402 128
4 3300003354 JGI25160J50197_1002584 JGI25160J50197_10025846 128
5 3300005327 Ga0070658_10000153 Ga0070658_1000015370 128
6 3300005330 Ga0070690_100939199 Ga0070690_1009391991 128
7 3300005334 Ga0068869_100716884 Ga0068869_1007168842 128
8 3300005336 Ga0070680_100016303 Ga0070680_1000163036 128
9 3300005338 Ga0068868_100038544 Ga0068868_1000385443 128
10 3300005338 Ga0068868_101280381 Ga0068868_1012803812 128
11 3300005339 Ga0070660_100007068 Ga0070660_10000706813 128
12 3300005340 Ga0070689_100060233 Ga0070689_1000602336 128
13 3300005344 Ga0070661_100413330 Ga0070661_1004133303 128
14 3300005347 Ga0070668_100144264 Ga0070668_1001442643 128
15 3300005355 Ga0070671_100007468 Ga0070671_10000746812 128
16 3300005365 Ga0070688_100121201 Ga0070688_1001212012 128
17 3300005366 Ga0070659_100355104 Ga0070659_1003551042 128
18 3300005367 Ga0070667_100018805 Ga0070667_1000188058 128
19 3300005367 Ga0070667_100888262 Ga0070667_1008882621 128
20 3300005458 Ga0070681_10323632 Ga0070681_103236322 128
21 3300005530 Ga0070679_100014641 Ga0070679_1000146414 128
22 3300005530 Ga0070679_100440390 Ga0070679_1004403901 128
23 3300005539 Ga0068853_100083506 Ga0068853_1000835062 128
24 3300005539 Ga0068853_100087914 Ga0068853_1000879142 128
25 3300005543 Ga0070672_100941362 Ga0070672_1009413621 128
26 3300005548 Ga0070665_100785318 Ga0070665_1007853182 128
27 3300005563 Ga0068855_100000098 Ga0068855_10000009864 128
28 3300005563 Ga0068855_100013032 Ga0068855_1000130324 128
29 3300005563 Ga0068855_100503180 Ga0068855_1005031801 128
30 3300005563 Ga0068855_100531399 Ga0068855_1005313992 128
31 3300005577 Ga0068857_100021917 Ga0068857_1000219176 128
32 3300005578 Ga0068854_100062603 Ga0068854_1000626032 128
33 3300005614 Ga0068856_100001044 Ga0068856_10000104411 128
34 3300005614 Ga0068856_100142943 Ga0068856_1001429432 128
35 3300005614 Ga0068856_100308034 Ga0068856_1003080342 128
36 3300005616 Ga0068852_100004592 Ga0068852_1000045926 128
37 3300005616 Ga0068852_101158691 Ga0068852_1011586912 128
38 3300005617 Ga0068859_100000025 Ga0068859_10000002567 128
39 3300005618 Ga0068864_100151353 Ga0068864_1001513532 128
40 3300005618 Ga0068864_100945819 Ga0068864_1009458192 128
41 3300005718 Ga0068866_10363277 Ga0068866_103632773 128
42 3300005841 Ga0068863_101169307 Ga0068863_1011693071 128
43 3300005842 Ga0068858_100023536 Ga0068858_1000235364 128
44 3300005843 Ga0068860_100027825 Ga0068860_1000278254 128
45 3300005843 Ga0068860_102503050 Ga0068860_1025030501 128
46 3300005844 Ga0068862_101636259 Ga0068862_1016362592 128
47 3300006163 Ga0070715_10253153 Ga0070715_102531531 128
48 3300006237 Ga0097621_100059835 Ga0097621_1000598353 128
49 3300006237 Ga0097621_101264807 Ga0097621_1012648071 128
50 3300006358 Ga0068871_100000706 Ga0068871_10000070617 128
51 3300006881 Ga0068865_100177173 Ga0068865_1001771734 128
52 3300006931 Ga0097620_100000025 Ga0097620_10000002567 128
53 3300009093 Ga0105240_10003660 Ga0105240_1000366018 128
54 3300009093 Ga0105240_10011830 Ga0105240_100118306 128
55 3300009093 Ga0105240_10013701 Ga0105240_100137013 128
56 3300009093 Ga0105240_12429734 Ga0105240_124297341 128
57 3300009101 Ga0105247_10816075 Ga0105247_108160752 128
58 3300009174 Ga0105241_10003958 Ga0105241_100039584 128
59 3300009174 Ga0105241_10135603 Ga0105241_101356034 128
60 3300009174 Ga0105241_10543233 Ga0105241_105432332 128
61 3300009176 Ga0105242_10206978 Ga0105242_102069781 128
62 3300009176 Ga0105242_11787408 Ga0105242_117874081 128
63 3300009177 Ga0105248_10934977 Ga0105248_109349772 128
64 3300009545 Ga0105237_10012067 Ga0105237_100120676 128
65 3300009545 Ga0105237_10084180 Ga0105237_100841802 128
66 3300009545 Ga0105237_10095317 Ga0105237_100953174 128
67 3300009545 Ga0105237_10166395 Ga0105237_101663951 128
68 3300009551 Ga0105238_10049633 Ga0105238_100496335 128
69 3300009551 Ga0105238_10923748 Ga0105238_109237482 128
70 3300009553 Ga0105249_10454109 Ga0105249_104541092 128
71 3300010375 Ga0105239_10007917 Ga0105239_1000791711 128
72 3300010375 Ga0105239_10036928 Ga0105239_100369286 128
73 3300010375 Ga0105239_10212249 Ga0105239_102122493 128
74 3300011119 Ga0105246_10030608 Ga0105246_100306081 128
75 3300013100 Ga0157373_10437592 Ga0157373_104375922 128
76 3300013104 Ga0157370_10011422 Ga0157370_100114223 128
77 3300013104 Ga0157370_11254799 Ga0157370_112547991 128
78 3300013105 Ga0157369_10041920 Ga0157369_100419205 128
79 3300013296 Ga0157374_10475947 Ga0157374_104759472 128
80 3300013296 Ga0157374_11370814 Ga0157374_113708141 128
81 3300013296 Ga0157374_12975432 Ga0157374_129754321 128
82 3300013297 Ga0157378_10298382 Ga0157378_102983821 128
83 3300013297 Ga0157378_10306369 Ga0157378_103063692 128
84 3300013306 Ga0163162_10008620 Ga0163162_100086207 128
85 3300013306 Ga0163162_10544850 Ga0163162_105448503 128
86 3300013307 Ga0157372_10012850 Ga0157372_100128505 128
87 3300013308 Ga0157375_10000870 Ga0157375_100008709 128
88 3300014968 Ga0157379_10085625 Ga0157379_100856254 128
89 3300014969 Ga0157376_10004602 Ga0157376_100046024 128
90 3300017792 Ga0163161_10003923 Ga0163161_1000392312 128
91 3300020070 Ga0206356_10081099 Ga0206356_100810992 128
92 3300020076 Ga0206355_1340327 Ga0206355_13403271 128
93 3300025250 Ga0209026_1018908 Ga0209026_10189082 128
94 3300025302 Ga0207426_1000002 Ga0207426_1000002971 128
95 3300025899 Ga0207642_11148639 Ga0207642_111486391 128
96 3300025903 Ga0207680_10386393 Ga0207680_103863933 128
97 3300025904 Ga0207647_10067885 Ga0207647_100678852 128
98 3300025905 Ga0207685_10189931 Ga0207685_101899311 128
99 3300025909 Ga0207705_10000108 Ga0207705_1000010842 128
100 3300025909 Ga0207705_10136815 Ga0207705_101368152 128
101 3300025911 Ga0207654_10019999 Ga0207654_100199995 128
102 3300025911 Ga0207654_10182893 Ga0207654_101828932 128
103 3300025911 Ga0207654_10525970 Ga0207654_105259702 128
104 3300025911 Ga0207654_11200795 Ga0207654_112007951 128
105 3300025912 Ga0207707_10049637 Ga0207707_100496375 128
106 3300025913 Ga0207695_10027817 Ga0207695_100278172 128
107 3300025913 Ga0207695_10041102 Ga0207695_100411022 128
108 3300025913 Ga0207695_10136261 Ga0207695_101362612 128
109 3300025913 Ga0207695_10327999 Ga0207695_103279992 128
110 3300025913 Ga0207695_10461933 Ga0207695_104619332 128
111 3300025914 Ga0207671_10029882 Ga0207671_100298823 128
112 3300025914 Ga0207671_10373441 Ga0207671_103734412 128
113 3300025919 Ga0207657_10108874 Ga0207657_101088743 128
114 3300025921 Ga0207652_10019147 Ga0207652_100191473 128
115 3300025921 Ga0207652_10373576 Ga0207652_103735762 128
116 3300025924 Ga0207694_10024882 Ga0207694_100248824 128
117 3300025931 Ga0207644_10005564 Ga0207644_100055643 128
118 3300025936 Ga0207670_10263993 Ga0207670_102639933 128
119 3300025938 Ga0207704_10195905 Ga0207704_101959054 128
120 3300025940 Ga0207691_10555876 Ga0207691_105558761 128
121 3300025941 Ga0207711_11928366 Ga0207711_119283661 128
122 3300025942 Ga0207689_10524900 Ga0207689_105249002 128
123 3300025949 Ga0207667_10000014 Ga0207667_10000014169 128
124 3300025949 Ga0207667_10009296 Ga0207667_1000929614 128
125 3300025949 Ga0207667_10100645 Ga0207667_101006454 128
126 3300025949 Ga0207667_10438018 Ga0207667_104380182 128
127 3300025949 Ga0207667_10469977 Ga0207667_104699772 128
128 3300025960 Ga0207651_10878398 Ga0207651_108783982 128
129 3300025961 Ga0207712_11636840 Ga0207712_116368401 128
130 3300025981 Ga0207640_10044559 Ga0207640_100445592 128
131 3300025986 Ga0207658_10065739 Ga0207658_100657394 128
132 3300025986 Ga0207658_10089586 Ga0207658_100895862 128
133 3300025986 Ga0207658_12046513 Ga0207658_120465131 128
134 3300026023 Ga0207677_10028561 Ga0207677_100285614 128
135 3300026035 Ga0207703_10007755 Ga0207703_100077554 128
136 3300026041 Ga0207639_10070308 Ga0207639_100703082 128
137 3300026041 Ga0207639_10174004 Ga0207639_101740043 128
138 3300026078 Ga0207702_10010483 Ga0207702_100104835 128
139 3300026078 Ga0207702_10094131 Ga0207702_100941312 128
140 3300026078 Ga0207702_10179876 Ga0207702_101798762 128
141 3300026089 Ga0207648_10479640 Ga0207648_104796402 128
142 3300026095 Ga0207676_11006140 Ga0207676_110061402 128
143 3300026116 Ga0207674_10092462 Ga0207674_100924624 128
144 3300026142 Ga0207698_10011193 Ga0207698_100111933 128
145 3300028380 Ga0268265_11308356 Ga0268265_113083562 128
146 3300028381 Ga0268264_10043527 Ga0268264_100435274 128
147 3300028381 Ga0268264_10274070 Ga0268264_102740703 128
148 3300031247 Ga0265340_10174179 Ga0265340_101741791 128
149 3300035695 Ga0373927_0328661 Ga0373927_0328661_296_682 128
150 3300035724 Ga0373933_0480372 Ga0373933_0480372_176_568 128
151 3300036401 Ga0373937_0183507 Ga0373937_0183507_642_1034 128
152 3300036401 Ga0373937_0997629 Ga0373937_0997629_235_627 128
153 3300037068 Ga0373925_0455288 Ga0373925_0455288_497_883 128
154 3300037312 Ga0395899_0030182 Ga0395899_0030182_3629_4021 128
155 3300037418 Ga0395900_0000507 Ga0395900_0000507_31129_31518 128
156 3300037418 Ga0395900_0012592 Ga0395900_0012592_3932_4324 128
157 3300037466 Ga0395898_0737951 Ga0395898_0737951_228_620 128
158 3300037471 Ga0395905_0004972 Ga0395905_0004972_12565_12957 128
159 3300038443 Ga0395901_0033723 Ga0395901_0033723_4369_4761 128
160 3300044684 Ga0466966_0127206 Ga0466966_0127206_744_1130 128
161 3300044842 Ga0466957_0155576 Ga0466957_0155576_540_929 128
162 3300046457 Ga0495590_0404287 Ga0495590_0404287_14_448 128
163 3300046461 Ga0495641_0319961 Ga0495641_0319961_63_452 128
164 3300046462 Ga0495651_0823383 Ga0495651_0823383_161_550 128
165 3300046492 Ga0495585_0001088 Ga0495585_0001088_19382_19771 128
166 3300046516 Ga0495628_0551262 Ga0495628_0551262_403_792 128
167 3300046519 Ga0495632_0209447 Ga0495632_0209447_341_730 128
168 3300046524 Ga0495648_0004496 Ga0495648_0004496_1029_1418 128
169 3300046538 Ga0495609_0011323 Ga0495609_0011323_3152_3544 128
170 3300046616 Ga0495668_0000012 Ga0495668_0000012_402988_403377 128
171 3300046660 Ga0495625_0001346 Ga0495625_0001346_17962_18351 128
172 3300046660 Ga0495625_0009089 Ga0495625_0009089_825_1214 128
173 3300046683 Ga0495658_0084929 Ga0495658_0084929_607_996 128
174 3300046694 Ga0495649_0027457 Ga0495649_0027457_2652_3041 128
175 3300046694 Ga0495649_0474536 Ga0495649_0474536_118_540 128
176 3300046809 Ga0495600_0324510 Ga0495600_0324510_169_558 128
177 3300048089 Ga0495614_0127330 Ga0495614_0127330_494_886 128
178 3300048917 Ga0496114_0193151 Ga0496114_0193151_483_893 128
179 3300049581 Ga0501047_0457847 Ga0501047_0457847_181_570 128
180 3300053118 Ga0500594_0210980 Ga0500594_0210980_97_486 128
181 3300053122 Ga0500608_089137 Ga0500608_089137_367_756 128
182 3300053122 Ga0500608_136309 Ga0500608_136309_75_467 128
183 3300053178 Ga0500637_0370429 Ga0500637_0370429_223_612 128
184 3300053727 Ga0500611_000003 Ga0500611_000003_115649_116041 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

132

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.7943 2 124
1xrk-assembly1.cif.gz_A crystal structure of a mutant bleomycin binding protein from streptoalloteichus hindustanus displaying increased thermostability 0.7769 2 125
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7737 5 128
2zhp-assembly1.cif.gz_B crystal structure of bleomycin-binding protein from streptoalloteichus hindustanus complexed with bleomycin derivative 0.7677 2 124
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.7659 4 125
ID Description Score Start End Superfamily
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8532 77 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8445 77 128 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8438 75 128 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7972 3 57 3.10.180.10
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7942 75 128 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A369Q0V5-F1-model_v4 VOC domain-containing protein 0.9383 9 128
AF-A0A2V7Y3Q5-F1-model_v4 Bleomycin resistance protein 0.9187 19 128
AF-A0A495Z5T2-F1-model_v4 VOC domain-containing protein 0.9163 2 128
AF-A0A369Q0V5-F1-model_v4 VOC domain-containing protein 0.916 9 128
AF-A0A2V7Y3Q5-F1-model_v4 Bleomycin resistance protein 0.9108 19 128

Feature Viewer

pLDDT pTM Quality
92.59 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map