F282791

General Info

Members Datasets Scaffolds Average Seq Length
184 152 153 270

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10048988|Ga0265331_100489881
Length 318
Sequence VPDKPNNVFNVGHSVPNLRDIIRQHSLRLETALSLDPGSARIEVQCLLQFVLQQNRAYLLSHPEDVLDAEQQARYAALFERRLNGEPIAYLLGEREFFGLNFKVTQATLIPRQDTELLVELALQRFPSPQPSTAQGGGSLYRVLDLGTGSGAVALSIAHARPDAVVTAADISNQALAVAGENAQRLNIGNVRLLCSDWFAELHHEHYDLIVANPPYIACDDAHLMQGDLRFEPRAALASGVDGLDDIRRIAAQAAAHLNDHGWLLLEHGHDQAARVRDLLRQSGFVDVFSARDLAGIERVSGGQVFSHTVCQHPPFPA

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221569 Achromobacter sp. Root565 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
12 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
13 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
14 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
15 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
16 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
17 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
18 2855730933 Achromobacter sp. HZ28 Isolate Nodule
19 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
20 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
21 2858950400 Achromobacter sp. K91 Isolate Unclassified
22 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
23 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
24 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
25 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
26 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
27 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
28 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
29 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
30 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
120 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.15
Metatranscriptomes 0
Isolates 16.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.15
Nodule 2.72
Rhizoplane 4.89
Rhizosphere 67.39
Stem 0
Stem Tuber 0
Unclassified 16.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100033332 3300005329 Bacteria 4696
2 Ga0070670_100080078 3300005331 Bacteria 2807
3 Ga0070677_10065831 3300005333 Bacteria 1509
4 Ga0070666_10175286 3300005335 Bacteria 1503
5 Ga0070671_100044036 3300005355 Bacteria 3708
6 Ga0070674_100313711 3300005356 Bacteria 1255
7 Ga0070673_100177741 3300005364 Bacteria 1820
8 Ga0070695_100344102 3300005545 Bacteria 1115
9 Ga0070664_100100202 3300005564 Bacteria 2518
10 Ga0068856_100660294 3300005614 Bacteria 1066
11 Ga0068852_100261239 3300005616 Bacteria 1663
12 Ga0068864_100029319 3300005618 Bacteria 4659
13 Ga0070717_10496333 3300006028 Bacteria 1103
14 Ga0075365_10017891 3300006038 Bacteria 4348
15 Ga0075368_10001429 3300006042 Bacteria 7643
16 Ga0075363_100002663 3300006048 Bacteria 7373
17 Ga0075364_10414517 3300006051 Bacteria 919
18 Ga0070712_100136944 3300006175 Bacteria 1863
19 Ga0075362_10031032 3300006177 Bacteria 2311
20 Ga0075367_10033667 3300006178 Bacteria 2955
21 Ga0068871_100025877 3300006358 Bacteria 4572
22 Ga0105248_10079133 3300009177 Bacteria 3694
23 Ga0157374_10074375 3300013296 Bacteria 3208
24 Ga0157375_10049456 3300013308 Bacteria 4119
25 Ga0182008_10002914 3300014497 Bacteria 10583
26 Ga0182006_1000007 3300015261 Bacteria 452190
27 Ga0182007_10000068 3300015262 Bacteria 82301
28 Ga0182005_1000010 3300015265 Bacteria 434103
29 Ga0163161_10003757 3300017792 Bacteria 10632
30 Ga0163161_10018068 3300017792 Bacteria 4943
31 Ga0209026_1007317 3300025250 Bacteria 2512
32 Ga0209676_1003574 3300025292 Bacteria 9388
33 Ga0209050_1007574 3300025298 Bacteria 6044
34 Ga0207680_10147665 3300025903 Bacteria 1565
35 Ga0207693_10144700 3300025915 Bacteria 1869
36 Ga0207649_10086417 3300025920 Bacteria 2044
37 Ga0207659_10700504 3300025926 Bacteria 867
38 Ga0207691_10005664 3300025940 Bacteria 12076
39 Ga0207679_10075932 3300025945 Bacteria 2551
40 Ga0207651_10043405 3300025960 Bacteria 3001
41 Ga0207658_10402084 3300025986 Bacteria 1204
42 Ga0207677_10017130 3300026023 Bacteria 4312
43 Ga0207648_10104505 3300026089 Bacteria 2484
44 Ga0207683_10001793 3300026121 Bacteria 18998
45 Ga0207698_10291265 3300026142 Bacteria 1515
46 Ga0209371_1005887 3300027312 Bacteria 4716
47 Ga0209371_1006027 3300027312 Bacteria 4623
48 Ga0209813_10006431 3300027866 Bacteria 2902
49 Ga0268256_1006021 3300030500 Bacteria 4614
50 Ga0265330_10002315 3300031235 Bacteria 10458
51 Ga0265331_10008369 3300031250 Bacteria 5889
52 Ga0265331_10013402 3300031250 Bacteria 4410
53 Ga0265331_10048988 3300031250 Bacteria 2030
54 Ga0265327_10000065 3300031251 Bacteria 225004
55 Ga0265316_10234097 3300031344 Bacteria 1352
56 Ga0316575_10000458 3300031665 Bacteria 11696
57 Ga0451577_0000002 3300042876 Bacteria 1731375
58 Ga0451577_0100542 3300042876 Bacteria 2583
59 Ga0466972_0000190 3300044658 Bacteria 47256
60 Ga0453683_0000013 3300044673 Bacteria 371932
61 Ga0466964_0057171 3300044706 Bacteria 1614
62 Ga0453684_0000002 3300044712 Bacteria 1731375
63 Ga0451576_0000006 3300045051 Bacteria 949698
64 Ga0451576_0000037 3300045051 Bacteria 372173
65 Ga0451576_0044799 3300045051 Bacteria 4661
66 Ga0495627_008646 3300046453 Bacteria 3799
67 Ga0495603_0074646 3300046455 Bacteria 1991
68 Ga0495591_028741 3300046458 Bacteria 1697
69 Ga0495584_0005725 3300046491 Bacteria 6559
70 Ga0495585_0040695 3300046492 Bacteria 2608
71 Ga0495607_0000009 3300046501 Bacteria 216674
72 Ga0495607_0046854 3300046501 Bacteria 2535
73 Ga0495583_0016743 3300046506 Bacteria 3925
74 Ga0495606_0027673 3300046507 Bacteria 4014
75 Ga0495616_0009172 3300046513 Bacteria 5804
76 Ga0495631_0078976 3300046518 Bacteria 1420
77 Ga0495637_0039513 3300046520 Bacteria 2036
78 Ga0495644_0003878 3300046523 Bacteria 5886
79 Ga0495644_0038529 3300046523 Bacteria 1802
80 Ga0495644_0045630 3300046523 Bacteria 1648
81 Ga0495648_0020717 3300046524 Bacteria 4576
82 Ga0495654_0015266 3300046530 Bacteria 4081
83 Ga0495587_0063442 3300046536 Bacteria 2161
84 Ga0495597_0006233 3300046542 Bacteria 6186
85 Ga0495622_0070809 3300046557 Bacteria 1609
86 Ga0495633_0000646 3300046558 Bacteria 32408
87 Ga0495633_0021552 3300046558 Bacteria 3221
88 Ga0495611_0034510 3300046648 Bacteria 2236
89 Ga0495625_0064273 3300046660 Bacteria 2589
90 Ga0495625_0339965 3300046660 Bacteria 951
91 Ga0495661_0043564 3300046665 Bacteria 2757
92 Ga0495661_0043806 3300046665 Bacteria 2748
93 Ga0495588_0012348 3300046674 Bacteria 4035
94 Ga0495588_0084213 3300046674 Bacteria 1661
95 Ga0495623_0006154 3300046679 Bacteria 7800
96 Ga0495669_0032584 3300046684 Bacteria 2291
97 Ga0495670_0007507 3300046691 Bacteria 5359
98 Ga0495670_0012398 3300046691 Bacteria 4191
99 Ga0495589_0015718 3300046794 Bacteria 3890
100 Ga0495660_0025120 3300046810 Bacteria 3385
101 Ga0495660_0070505 3300046810 Bacteria 1855
102 Ga0495672_0070316 3300047320 Bacteria 1983
103 Ga0495672_0090727 3300047320 Bacteria 1678
104 Ga0495680_0035118 3300047322 Bacteria 4041
105 Ga0495680_0078781 3300047322 Bacteria 2493
106 Ga0495683_0010279 3300047323 Bacteria 4952
107 Ga0495677_0006397 3300047445 Bacteria 4451
108 Ga0495677_0116130 3300047445 Bacteria 1019
109 Ga0495685_023426 3300047447 Bacteria 2126
110 Ga0495681_0007372 3300047470 Bacteria 7036
111 Ga0495681_0139462 3300047470 Bacteria 1025
112 Ga0495593_0004214 3300047673 Bacteria 8547
113 Ga0495614_0052680 3300048089 Bacteria 1744
114 Ga0496100_0021446 3300048903 Bacteria 3890
115 Ga0496100_0512469 3300048903 Bacteria 925
116 Ga0496101_0220654 3300048904 Bacteria 1471
117 Ga0496102_0229980 3300048905 Bacteria 1748
118 Ga0496103_0004787 3300048906 Bacteria 8181
119 Ga0496108_0295603 3300048911 Bacteria 1410
120 Ga0496111_0008274 3300048914 Bacteria 6878
121 Ga0496117_0000005 3300048920 Bacteria 777468
122 Ga0496118_0000022 3300048921 Bacteria 438602
123 Ga0496118_0002552 3300048921 Bacteria 24370
124 Ga0496121_0017366 3300048924 Bacteria 7356
125 Ga0496121_0036660 3300048924 Bacteria 4367
126 Ga0496121_0171974 3300048924 Bacteria 1572
127 Ga0496122_0013911 3300048925 Bacteria 7827
128 Ga0496123_0004701 3300048926 Bacteria 14136
129 Ga0496124_0038001 3300048927 Bacteria 4182
130 Ga0496124_0121649 3300048927 Bacteria 2085
131 Ga0496124_0152968 3300048927 Bacteria 1807
132 Ga0496124_0386022 3300048927 Bacteria 977
133 Ga0496126_0057456 3300048929 Bacteria 3512
134 Ga0496126_0206779 3300048929 Bacteria 1654
135 Ga0496126_0285638 3300048929 Bacteria 1366
136 Ga0495678_057807 3300049459 Bacteria 1468
137 Ga0495682_0006095 3300049460 Bacteria 4916
138 Ga0495682_0033559 3300049460 Bacteria 1894
139 Ga0501034_0434353 3300049571 Bacteria 1232
140 Ga0501037_0099008 3300049573 Bacteria 2106
141 Ga0501038_0231338 3300049574 Bacteria 1471
142 Ga0501043_0269339 3300049579 Bacteria 1308
143 Ga0501047_0001649 3300049581 Bacteria 21747
144 Ga0501035_0003685 3300049822 Bacteria 14600
145 Ga0501035_0057391 3300049822 Bacteria 3471
146 Ga0501044_0001247 3300049823 Bacteria 30194
147 Ga0501044_0068102 3300049823 Bacteria 3626
148 nmdc:mga03n38_7238_c1 3300050490 Bacteria 3916
149 nmdc:mga0yw44_85830_c1 3300050492 Bacteria 1981
150 nmdc:mga0k408_40047_c1 3300050493 Bacteria 2695
151 nmdc:mga06z11_75108_c1 3300050494 Bacteria 1799
152 nmdc:mga04h51_8022_c1 3300050495 Bacteria 2812
153 Ga0500618_003526 3300053125 Bacteria 5329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_003526 Ga0500618_003526_3403_4326 226
2 3300006175 Ga0070712_100136944 Ga0070712_1001369442 237
3 3300025915 Ga0207693_10144700 Ga0207693_101447002 237
4 3300017792 Ga0163161_10018068 Ga0163161_100180684 241
5 3300049579 Ga0501043_0269339 Ga0501043_0269339_12_824 241
6 3300031665 Ga0316575_10000458 Ga0316575_100004583 246
7 3300048905 Ga0496102_0229980 Ga0496102_0229980_366_1298 247
8 3300048906 Ga0496103_0004787 Ga0496103_0004787_3327_4259 247
9 3300048921 Ga0496118_0002552 Ga0496118_0002552_18129_19061 247
10 3300048924 Ga0496121_0171974 Ga0496121_0171974_236_1066 249
11 3300046492 Ga0495585_0040695 Ga0495585_0040695_368_1189 251
12 3300046558 Ga0495633_0021552 Ga0495633_0021552_1533_2354 251
13 3300046665 Ga0495661_0043806 Ga0495661_0043806_1464_2285 251
14 3300046691 Ga0495670_0012398 Ga0495670_0012398_1104_1925 251
15 3300017792 Ga0163161_10003757 Ga0163161_100037576 253
16 3300049822 Ga0501035_0057391 Ga0501035_0057391_1337_2188 253
17 3300049823 Ga0501044_0068102 Ga0501044_0068102_2765_3616 253
18 3300048924 Ga0496121_0036660 Ga0496121_0036660_2545_3357 254
19 3300049571 Ga0501034_0434353 Ga0501034_0434353_262_1074 254
20 3300049573 Ga0501037_0099008 Ga0501037_0099008_243_1094 254
21 3300049574 Ga0501038_0231338 Ga0501038_0231338_89_940 254
22 3300049581 Ga0501047_0001649 Ga0501047_0001649_7231_8043 254
23 3300049822 Ga0501035_0003685 Ga0501035_0003685_1442_2254 254
24 3300049823 Ga0501044_0001247 Ga0501044_0001247_16477_17289 254
25 3300046458 Ga0495591_028741 Ga0495591_028741_351_1175 255
26 3300046491 Ga0495584_0005725 Ga0495584_0005725_5398_6222 255
27 3300046501 Ga0495607_0000009 Ga0495607_0000009_116938_117756 255
28 3300046501 Ga0495607_0046854 Ga0495607_0046854_534_1358 255
29 3300046506 Ga0495583_0016743 Ga0495583_0016743_981_1805 255
30 3300046507 Ga0495606_0027673 Ga0495606_0027673_1624_2448 255
31 3300046513 Ga0495616_0009172 Ga0495616_0009172_1048_1872 255
32 3300046518 Ga0495631_0078976 Ga0495631_0078976_466_1290 255
33 3300046520 Ga0495637_0039513 Ga0495637_0039513_465_1289 255
34 3300046523 Ga0495644_0038529 Ga0495644_0038529_848_1672 255
35 3300046524 Ga0495648_0020717 Ga0495648_0020717_3497_4321 255
36 3300046530 Ga0495654_0015266 Ga0495654_0015266_125_949 255
37 3300046648 Ga0495611_0034510 Ga0495611_0034510_403_1227 255
38 3300046660 Ga0495625_0064273 Ga0495625_0064273_743_1567 255
39 3300046665 Ga0495661_0043564 Ga0495661_0043564_1400_2224 255
40 3300046684 Ga0495669_0032584 Ga0495669_0032584_558_1382 255
41 3300046691 Ga0495670_0007507 Ga0495670_0007507_3521_4345 255
42 3300046794 Ga0495589_0015718 Ga0495589_0015718_713_1537 255
43 3300046810 Ga0495660_0025120 Ga0495660_0025120_225_1049 255
44 3300047320 Ga0495672_0070316 Ga0495672_0070316_116_940 255
45 3300047320 Ga0495672_0090727 Ga0495672_0090727_810_1628 255
46 3300047323 Ga0495683_0010279 Ga0495683_0010279_403_1227 255
47 3300047445 Ga0495677_0116130 Ga0495677_0116130_129_953 255
48 3300047447 Ga0495685_023426 Ga0495685_023426_739_1563 255
49 3300047470 Ga0495681_0139462 Ga0495681_0139462_29_853 255
50 3300048927 Ga0496124_0121649 Ga0496124_0121649_943_1767 255
51 3300049459 Ga0495678_057807 Ga0495678_057807_138_962 255
52 3300049460 Ga0495682_0033559 Ga0495682_0033559_870_1694 255
53 3300031344 Ga0265316_10234097 Ga0265316_102340971 256
54 3300046523 Ga0495644_0045630 Ga0495644_0045630_362_1189 256
55 3300048927 Ga0496124_0386022 Ga0496124_0386022_102_929 256
56 3300048929 Ga0496126_0057456 Ga0496126_0057456_565_1410 256
57 3300046523 Ga0495644_0003878 Ga0495644_0003878_3138_3956 257
58 3300047445 Ga0495677_0006397 Ga0495677_0006397_3530_4348 257
59 3300027312 Ga0209371_1005887 Ga0209371_10058873 258
60 3300027312 Ga0209371_1006027 Ga0209371_10060276 258
61 3300030500 Ga0268256_1006021 Ga0268256_10060213 258
62 3300044658 Ga0466972_0000190 Ga0466972_0000190_22805_23653 258
63 3300025250 Ga0209026_1007317 Ga0209026_10073171 259
64 3300046557 Ga0495622_0070809 Ga0495622_0070809_537_1367 259
65 3300046810 Ga0495660_0070505 Ga0495660_0070505_1001_1783 259
66 3300048927 Ga0496124_0038001 Ga0496124_0038001_3164_3991 259
67 3300049460 Ga0495682_0006095 Ga0495682_0006095_1197_2027 259
68 3300025292 Ga0209676_1003574 Ga0209676_10035746 260
69 3300025298 Ga0209050_1007574 Ga0209050_10075743 260
70 3300048929 Ga0496126_0206779 Ga0496126_0206779_203_1063 260
71 3300042876 Ga0451577_0000002 Ga0451577_0000002_1461200_1462060 261
72 3300044673 Ga0453683_0000013 Ga0453683_0000013_101757_102617 261
73 3300044712 Ga0453684_0000002 Ga0453684_0000002_269316_270176 261
74 3300045051 Ga0451576_0000037 Ga0451576_0000037_101998_102858 261
75 3300048903 Ga0496100_0512469 Ga0496100_0512469_15_857 262
76 3300048904 Ga0496101_0220654 Ga0496101_0220654_280_1122 262
77 3300014497 Ga0182008_10002914 Ga0182008_100029144 263
78 3300015261 Ga0182006_1000007 Ga0182006_1000007197 263
79 3300015262 Ga0182007_10000068 Ga0182007_1000006849 263
80 3300015265 Ga0182005_1000010 Ga0182005_1000010177 263
81 3300046558 Ga0495633_0000646 Ga0495633_0000646_949_1779 263
82 3300046674 Ga0495588_0012348 Ga0495588_0012348_73_963 263
83 3300048914 Ga0496111_0008274 Ga0496111_0008274_222_1052 263
84 3300048920 Ga0496117_0000005 Ga0496117_0000005_242707_243537 263
85 3300048921 Ga0496118_0000022 Ga0496118_0000022_195066_195896 263
86 3300048924 Ga0496121_0017366 Ga0496121_0017366_5853_6683 263
87 3300048925 Ga0496122_0013911 Ga0496122_0013911_6467_7297 263
88 3300048926 Ga0496123_0004701 Ga0496123_0004701_12486_13316 263
89 3300048927 Ga0496124_0152968 Ga0496124_0152968_507_1337 263
90 3300048929 Ga0496126_0285638 Ga0496126_0285638_483_1313 263
91 3300048903 Ga0496100_0021446 Ga0496100_0021446_1858_2697 264
92 3300006038 Ga0075365_10017891 Ga0075365_100178914 265
93 3300009177 Ga0105248_10079133 Ga0105248_100791334 265
94 3300050492 nmdc:mga0yw44_85830_c1 nmdc:mga0yw44_85830_c1_957_1793 265
95 iso_pu_bacteria 2855730933 2855735251 265
96 iso_pu_bacteria 2881412998 2881417150 265
97 iso_pu_bacteria 2857576091 2857578075 267
98 3300005545 Ga0070695_100344102 Ga0070695_1003441022 268
99 3300046679 Ga0495623_0006154 Ga0495623_0006154_1446_2270 269
100 iso_pu_bacteria 2551306416 2553005020 269
101 iso_pu_bacteria 2600255292 2601671348 269
102 iso_pu_bacteria 2643221621 2644123014 269
103 iso_pu_bacteria 2808606386 2808982446 269
104 iso_pu_bacteria 2808606415 2809129727 269
105 iso_pu_bacteria 2808606419 2809149218 269
106 iso_pu_bacteria 2852618963 2852619359 269
107 iso_pu_bacteria 2858950400 2858954521 269
108 iso_pu_bacteria 2923510766 2923513971 269
109 iso_pu_bacteria 2928130867 2928134755 269
110 iso_pu_bacteria 2932410948 2932415489 269
111 iso_pu_bacteria 2932416698 2932421350 269
112 3300031235 Ga0265330_10002315 Ga0265330_100023157 270
113 3300031250 Ga0265331_10013402 Ga0265331_100134021 270
114 3300044706 Ga0466964_0057171 Ga0466964_0057171_164_1012 270
115 3300045051 Ga0451576_0044799 Ga0451576_0044799_825_1661 270
116 3300046453 Ga0495627_008646 Ga0495627_008646_2364_3191 270
117 3300046536 Ga0495587_0063442 Ga0495587_0063442_706_1533 270
118 3300047322 Ga0495680_0035118 Ga0495680_0035118_345_1172 270
119 iso_pu_bacteria 2765235838 2765571386 270
120 3300006042 Ga0075368_10001429 Ga0075368_100014293 271
121 3300006048 Ga0075363_100002663 Ga0075363_1000026637 271
122 3300006051 Ga0075364_10414517 Ga0075364_104145171 271
123 3300006177 Ga0075362_10031032 Ga0075362_100310322 271
124 3300006178 Ga0075367_10033667 Ga0075367_100336672 271
125 3300027866 Ga0209813_10006431 Ga0209813_100064313 271
126 3300031250 Ga0265331_10008369 Ga0265331_100083695 271
127 3300031251 Ga0265327_10000065 Ga0265327_10000065112 271
128 3300045051 Ga0451576_0000006 Ga0451576_0000006_865248_866099 271
129 3300050490 nmdc:mga03n38_7238_c1 nmdc:mga03n38_7238_c1_1009_1830 271
130 3300050493 nmdc:mga0k408_40047_c1 nmdc:mga0k408_40047_c1_1524_2345 271
131 3300050494 nmdc:mga06z11_75108_c1 nmdc:mga06z11_75108_c1_351_1172 271
132 3300050495 nmdc:mga04h51_8022_c1 nmdc:mga04h51_8022_c1_1224_2045 271
133 iso_pu_bacteria 2599185292 2599907735 271
134 iso_pu_bacteria 2643221569 2643859147 271
135 iso_pu_bacteria 2643221594 2643979840 271
136 iso_pu_bacteria 2643221603 2644027040 271
137 iso_pu_bacteria 2808606395 2809033734 271
138 iso_pu_bacteria 2857537821 2857542428 271
139 iso_pu_bacteria 2884811622 2884812074 271
140 iso_pu_bacteria 2884836552 2884838544 271
141 iso_pu_bacteria 2884852848 2884854835 271
142 iso_pu_bacteria 2896154374 2896156496 271
143 3300042876 Ga0451577_0100542 Ga0451577_0100542_389_1243 272
144 3300046455 Ga0495603_0074646 Ga0495603_0074646_966_1796 272
145 3300046542 Ga0495597_0006233 Ga0495597_0006233_2640_3467 272
146 3300046660 Ga0495625_0339965 Ga0495625_0339965_89_922 272
147 3300046674 Ga0495588_0084213 Ga0495588_0084213_230_1063 272
148 3300047322 Ga0495680_0078781 Ga0495680_0078781_274_1104 272
149 3300047470 Ga0495681_0007372 Ga0495681_0007372_5661_6488 272
150 3300047673 Ga0495593_0004214 Ga0495593_0004214_6506_7336 272
151 3300048089 Ga0495614_0052680 Ga0495614_0052680_629_1459 272
152 iso_pu_bacteria 2511231003 2511249579 272
153 iso_pu_bacteria 2513237151 2513962698 272
154 iso_pu_bacteria 2548876994 2550695356 272
155 iso_pu_bacteria 8055266321 8055269526 272
156 3300005356 Ga0070674_100313711 Ga0070674_1003137112 273
157 iso_pu_bacteria 2721755763 2723879566 274
158 3300005329 Ga0070683_100033332 Ga0070683_1000333324 275
159 3300005331 Ga0070670_100080078 Ga0070670_1000800783 275
160 3300005333 Ga0070677_10065831 Ga0070677_100658312 275
161 3300005335 Ga0070666_10175286 Ga0070666_101752862 275
162 3300005355 Ga0070671_100044036 Ga0070671_1000440364 275
163 3300005364 Ga0070673_100177741 Ga0070673_1001777412 275
164 3300005564 Ga0070664_100100202 Ga0070664_1001002022 275
165 3300005614 Ga0068856_100660294 Ga0068856_1006602942 275
166 3300005616 Ga0068852_100261239 Ga0068852_1002612392 275
167 3300005618 Ga0068864_100029319 Ga0068864_1000293193 275
168 3300006028 Ga0070717_10496333 Ga0070717_104963331 275
169 3300006358 Ga0068871_100025877 Ga0068871_1000258772 275
170 3300013296 Ga0157374_10074375 Ga0157374_100743753 275
171 3300013308 Ga0157375_10049456 Ga0157375_100494564 275
172 3300025903 Ga0207680_10147665 Ga0207680_101476652 275
173 3300025920 Ga0207649_10086417 Ga0207649_100864171 275
174 3300025926 Ga0207659_10700504 Ga0207659_107005041 275
175 3300025940 Ga0207691_10005664 Ga0207691_1000566410 275
176 3300025945 Ga0207679_10075932 Ga0207679_100759322 275
177 3300025960 Ga0207651_10043405 Ga0207651_100434054 275
178 3300025986 Ga0207658_10402084 Ga0207658_104020841 275
179 3300026023 Ga0207677_10017130 Ga0207677_100171303 275
180 3300026089 Ga0207648_10104505 Ga0207648_101045053 275
181 3300026121 Ga0207683_10001793 Ga0207683_100017933 275
182 3300026142 Ga0207698_10291265 Ga0207698_102912652 275
183 3300031250 Ga0265331_10048988 Ga0265331_100489881 275
184 3300048911 Ga0496108_0295603 Ga0496108_0295603_129_956 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

141

209

0.94

PF05175

MTS

Methyltransferase small domain

132

228

0.94

PF08241

Methyltransf_11

Methyltransferase domain

144

221

0.94

PF01170

UPF0020

RMKL-like, methyltransferase domain

120

229

0.9

PF13847

Methyltransf_31

Methyltransferase domain

138

267

0.89

PF17827

PrmC_N

PrmC N-terminal domain

20

93

0.89

PF13649

Methyltransf_25

Methyltransferase domain

143

227

0.86

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

132

215

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9407 5 269
1nv9-assembly1.cif.gz_A hemk, apo structure 0.9128 16 268
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9042 5 269
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.9019 16 274
1vq1-assembly2.cif.gz_B crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.8953 16 274
ID Description Score Start End Superfamily
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9677 80 269 3.40.50.150
1t43A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9529 80 269 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9481 106 159 3.40.50.150
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9255 3 77 1.10.8.10
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9219 104 163 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A378A736-F1-model_v4 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (EC 2.1.1.-) 0.9935 106 260 GO:0003676
GO:0032259
GO:0036009
AF-A0A3M2ZX95-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9896 64 271 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A7C3NZV2-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9889 1 270 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A1G0JSS6-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9873 56 271 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A6S6T7L3-F1-model_v4 Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2 0.9871 178 271 GO:0032259
GO:0036009

Feature Viewer

pLDDT pTM Quality
95.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map