F282425

General Info

Members Datasets Scaffolds Average Seq Length
184 121 368 637

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100008751|Ga0075435_1000087516
Length 708
Sequence MLRLCTALLVAAEVFVGAPFRGARPATVPASAEGYGGSAEALREGGNASLDTSLDAPAGDAREREWPVYGADQGGTKYSPLADINRANVSRLAVAWQWSVREKALAEFGTRPGNFQATPIMLGGVLYFSTPYNRVVALDADSGAELWSFDPKAYEDGQPPNGTGFVHRGVAAWRDRANNNALRIFINSRYRLICLDAATGRPVDSFGAHGIVDLSKGLVWEINKTHYTNTSPPVIYKDLVILGNGVGDRLAYRNDPPGDVRAFDAHTGKQVWTFHTIPQPGEFGNDTWQQDSWSYTGHTNVWAPFTLDEARGLVYLPVTTPSNDFYGGRRPGANLFGESLVCLDAATGLRKWHYQLIHHGLWDYDNPSPPNLVTITVDGRKVDAVVQLTKQGFAFVFDRVTGKPVWPIDERPVPSSDVDGEHAWPTQPTPSRPPAITDQGVTLDDAFDLTPELKAAAQKELAKYRLGPVFTPPTLRGTVQRPGIIGGANWGGGAFDPQSGVLFVKTTNQANLIRVGKPDRSSANPRASEVDAELTRIGDTNAEFMDGLPLLKPPYGHLVAIDLQRGTIKWRVPFGDTPSLRRHPALKGVALPPALGVAGAPGVIATXXXLVIGGGGDLALHAIDAATGAQLWHTPLTRRVNATPMTYRTASGRQIIVALVAFALATTASNVGPPFQGGQGGSAKASREGGKGRPHADDRRIDSSRGGK

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
75 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
76 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
77 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100008751 3300007076 Bacteria 7285
2 Ga0065712_10069960 3300005290 Bacteria 6466
3 Ga0070676_10002665 3300005328 Bacteria 9188
4 Ga0070690_100014179 3300005330 Bacteria 4725
5 Ga0070666_10002940 3300005335 Bacteria 10310
6 Ga0070691_10004276 3300005341 Bacteria 6483
7 Ga0070687_100019928 3300005343 Bacteria 3128
8 Ga0070675_100023411 3300005354 Bacteria 4939
9 Ga0070674_100020150 3300005356 Bacteria 4253
10 Ga0070688_100004833 3300005365 Bacteria 7046
11 Ga0070688_100084051 3300005365 Unclassified 2067
12 Ga0070714_100014045 3300005435 Bacteria 6425
13 Ga0070713_100004071 3300005436 Bacteria 9734
14 Ga0070711_100010647 3300005439 Bacteria 5698
15 Ga0070705_100001569 3300005440 Bacteria 11983
16 Ga0070662_100023958 3300005457 Bacteria 4200
17 Ga0070662_100111798 3300005457 Bacteria 2082
18 Ga0070698_100049472 3300005471 Unclassified 4290
19 Ga0070698_100066552 3300005471 Bacteria 3626
20 Ga0070699_100002722 3300005518 Bacteria 15765
21 Ga0070699_100088754 3300005518 Unclassified 2701
22 Ga0070679_100002771 3300005530 Bacteria 15932
23 Ga0070697_100002846 3300005536 Bacteria 13299
24 Ga0070686_100000596 3300005544 Bacteria 21373
25 Ga0070686_100003086 3300005544 Bacteria 9128
26 Ga0070695_100021250 3300005545 Bacteria 3968
27 Ga0070665_100002571 3300005548 Bacteria 19891
28 Ga0070665_100013463 3300005548 Bacteria 8228
29 Ga0068854_100038992 3300005578 Bacteria 3344
30 Ga0070702_100005240 3300005615 Bacteria 6013
31 Ga0068859_100025770 3300005617 Bacteria 5897
32 Ga0068859_100029456 3300005617 Bacteria 5508
33 Ga0068864_100010678 3300005618 Bacteria 7589
34 Ga0068866_10019507 3300005718 Bacteria 3089
35 Ga0068866_10034674 3300005718 Bacteria 2460
36 Ga0068861_100007701 3300005719 Bacteria 7395
37 Ga0068863_100006604 3300005841 Bacteria 11384
38 Ga0068858_100012725 3300005842 Bacteria 7927
39 Ga0068862_100002252 3300005844 Bacteria 17259
40 Ga0068862_100020119 3300005844 Bacteria 5574
41 Ga0075428_100007840 3300006844 Bacteria 11836
42 Ga0075428_100161666 3300006844 Bacteria 2431
43 Ga0075434_100008575 3300006871 Bacteria 9509
44 Ga0075434_100009202 3300006871 Bacteria 9205
45 Ga0068865_100004651 3300006881 Bacteria 8292
46 Ga0068865_100094703 3300006881 Bacteria 2174
47 Ga0075436_100000126 3300006914 Bacteria 45406
48 Ga0075436_100012988 3300006914 Bacteria 5710
49 Ga0075436_100025631 3300006914 Bacteria 4058
50 Ga0097620_100025770 3300006931 Bacteria 5897
51 Ga0097620_100029455 3300006931 Bacteria 5508
52 Ga0075435_100000002 3300007076 Bacteria 140391
53 Ga0075435_100002324 3300007076 Bacteria 12576
54 Ga0075435_100003357 3300007076 Bacteria 10850
55 Ga0075435_100041798 3300007076 Bacteria 3665
56 Ga0105240_10015650 3300009093 Bacteria 10301
57 Ga0111539_10012645 3300009094 Bacteria 10574
58 Ga0111539_10018948 3300009094 Bacteria 8512
59 Ga0105247_10006806 3300009101 Bacteria 7050
60 Ga0114129_10005305 3300009147 Bacteria 18188
61 Ga0114129_10009358 3300009147 Bacteria 13970
62 Ga0114129_10069519 3300009147 Bacteria 4908
63 Ga0114129_10139793 3300009147 Bacteria 3320
64 Ga0114129_10225940 3300009147 Viruses 2523
65 Ga0105243_10008245 3300009148 Bacteria 8001
66 Ga0105242_10007268 3300009176 Bacteria 8542
67 Ga0105242_10007607 3300009176 Bacteria 8339
68 Ga0105248_10002375 3300009177 Bacteria 20906
69 Ga0105248_10015833 3300009177 Bacteria 8312
70 Ga0105248_10072791 3300009177 Bacteria 3862
71 Ga0105248_10141679 3300009177 Bacteria 2712
72 Ga0163162_10049988 3300013306 Unclassified 4192
73 Ga0163163_10059269 3300014325 Bacteria 3786
74 Ga0157380_10016056 3300014326 Bacteria 5515
75 Ga0157380_10053669 3300014326 Bacteria 3196
76 Ga0157379_10027392 3300014968 Bacteria 5075
77 Ga0157379_10028554 3300014968 Bacteria 4961
78 Ga0157376_10030659 3300014969 Bacteria 4297
79 Ga0207680_10014717 3300025903 Bacteria 4060
80 Ga0207645_10000815 3300025907 Bacteria 26095
81 Ga0207662_10002120 3300025918 Bacteria 9861
82 Ga0207662_10015766 3300025918 Bacteria 4256
83 Ga0207657_10008314 3300025919 Bacteria 10560
84 Ga0207652_10026859 3300025921 Bacteria 4797
85 Ga0207681_10003371 3300025923 Bacteria 10003
86 Ga0207659_10000555 3300025926 Bacteria 22383
87 Ga0207700_10008751 3300025928 Bacteria 6287
88 Ga0207670_10006061 3300025936 Bacteria 6682
89 Ga0207704_10003961 3300025938 Bacteria 6737
90 Ga0207711_10010416 3300025941 Bacteria 7719
91 Ga0207711_10025831 3300025941 Bacteria 4925
92 Ga0207711_10041170 3300025941 Bacteria 3934
93 Ga0207712_10021353 3300025961 Bacteria 4250
94 Ga0207640_10006121 3300025981 Bacteria 6581
95 Ga0207640_10009989 3300025981 Bacteria 5330
96 Ga0207640_10017762 3300025981 Bacteria 4169
97 Ga0207703_10060107 3300026035 Bacteria 3106
98 Ga0207641_10001538 3300026088 Bacteria 22573
99 Ga0207648_10028545 3300026089 Bacteria 4946
100 Ga0207648_10060713 3300026089 Bacteria 3297
101 Ga0207428_10016170 3300027907 Bacteria 6426
102 Ga0207428_10019886 3300027907 Bacteria 5718
103 Ga0268266_10001999 3300028379 Bacteria 22797
104 Ga0268265_10001443 3300028380 Bacteria 20048
105 Ga0268265_10054599 3300028380 Bacteria 3032
106 Ga0307408_100055959 3300031548 Bacteria 2859
107 Ga0265314_10016245 3300031711 Bacteria 5889
108 Ga0265342_10025605 3300031712 Bacteria 3707
109 Ga0307410_10019416 3300031852 Bacteria 4134
110 Ga0307407_10009417 3300031903 Unclassified 4550
111 Ga0307416_100054504 3300032002 Unclassified 3215
112 Ga0373930_0001297 3300034816 Bacteria 3681
113 Ga0373958_0000114 3300034819 Bacteria 8661
114 Ga0373959_0000279 3300034820 Bacteria 10914
115 Ga0373929_0001098 3300035085 Bacteria 5259
116 Ga0373940_0000889 3300035088 Bacteria 5033
117 Ga0373949_0001267 3300035090 Bacteria 7365
118 Ga0373949_0001822 3300035090 Bacteria 5823
119 Ga0373951_0000396 3300035091 Bacteria 12946
120 Ga0373932_0000137 3300035112 Bacteria 20429
121 Ga0373932_0000346 3300035112 Bacteria 14205
122 Ga0373939_0000366 3300035114 Bacteria 11392
123 Ga0373939_0003358 3300035114 Bacteria 3757
124 Ga0373941_0000199 3300035115 Bacteria 11455
125 Ga0373941_0000795 3300035115 Bacteria 6485
126 Ga0373960_0004033 3300035121 Bacteria 3351
127 Ga0373942_0000570 3300035207 Bacteria 10370
128 Ga0373942_0003182 3300035207 Bacteria 3882
129 Ga0373931_0005608 3300035691 Bacteria 5821
130 Ga0373931_0007105 3300035691 Bacteria 5264
131 Ga0373927_0001328 3300035695 Bacteria 18664
132 Ga0373937_0010426 3300036401 Bacteria 8116
133 Ga0436364_0016251 3300037853 Bacteria 31424
134 Ga0436365_0886003 3300039437 Bacteria 8874
135 Ga0451576_0003151 3300045051 Bacteria 23085
136 Ga0451576_0026962 3300045051 Bacteria 6174
137 Ga0495592_0078962 3300046454 Bacteria 2383
138 Ga0495664_0012638 3300046477 Bacteria 4783
139 Ga0495586_0091635 3300046535 Bacteria 1680
140 Ga0495587_0037658 3300046536 Bacteria 2903
141 Ga0495645_0028134 3300046543 Bacteria 4084
142 Ga0495634_0056476 3300046642 Bacteria 2622
143 Ga0495635_0013337 3300046663 Bacteria 5752
144 Ga0495658_0010131 3300046683 Bacteria 4710
145 Ga0495602_0063154 3300048088 Bacteria 3210
146 Ga0496100_0079483 3300048903 Unclassified 2210
147 Ga0496102_0050069 3300048905 Bacteria 3803
148 Ga0496106_0019347 3300048909 Bacteria 5049
149 Ga0496108_0099978 3300048911 Bacteria 2473
150 Ga0496112_0001527 3300048915 Bacteria 17840
151 Ga0496114_0019162 3300048917 Bacteria 5545
152 Ga0496114_0055686 3300048917 Unclassified 3298
153 Ga0496115_0029262 3300048918 Bacteria 4325
154 Ga0501041_0017713 3300049577 Bacteria 4240
155 Ga0501042_0027461 3300049578 Bacteria 4003
156 Ga0501071_0025383 3300049587 Bacteria 4151
157 Ga0501072_0051547 3300049588 Bacteria 3240
158 Ga0501072_0108551 3300049588 Bacteria 2208
159 Ga0501076_0032764 3300049592 Bacteria 4057
160 nmdc:mga05p37_10650_c1 3300050507 Bacteria 10910
161 nmdc:mga05p37_10654_c1 3300050507 Bacteria 10909
162 nmdc:mga05p37_127363_c1 3300050507 Bacteria 3126
163 nmdc:mga05p37_19375_c1 3300050507 Bacteria 8231
164 nmdc:mga05p37_21921_c1 3300050507 Bacteria 7738
165 nmdc:mga05p37_79822_c1 3300050507 Bacteria 4029
166 nmdc:mga09592_30657_c1 3300050508 Bacteria 4475
167 nmdc:mga08y16_47727_c1 3300050511 Bacteria 4482
168 nmdc:mga08y16_5422_c1 3300050511 Bacteria 13335
169 nmdc:mga0n895_43077_c1 3300050512 Bacteria 4396
170 nmdc:mga0n895_60_c1 3300050512 Bacteria 63557
171 nmdc:mga0n895_68539_c1 3300050512 Bacteria 3515
172 nmdc:mga0rr50_12502_c1 3300050513 Bacteria 5491
173 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
174 nmdc:mga0rr50_856_c1 3300050513 Bacteria 16399
175 nmdc:mga0rr50_91039_c1 3300050513 Unclassified 2375
176 nmdc:mga08x19_2548_c1 3300050514 Bacteria 11075
177 nmdc:mga08x19_383_c1 3300050514 Bacteria 31056
178 nmdc:mga08x19_48122_c1 3300050514 Bacteria 2731
179 nmdc:mga08x19_8401_c1 3300050514 Bacteria 6151
180 nmdc:mga0a205_39495_c1 3300050515 Bacteria 4542
181 nmdc:mga0a205_42129_c1 3300050515 Unclassified 4398
182 nmdc:mga0a205_57189_c1 3300050515 Bacteria 3766
183 Ga0500616_0000099 3300053153 Bacteria 175058
184 Ga0530510_0046297 3300061734 Bacteria 3142
185 Ga0075435_100008751
186 Ga0065712_10069960
187 Ga0070676_10002665
188 Ga0070690_100014179
189 Ga0070666_10002940
190 Ga0070691_10004276
191 Ga0070687_100019928
192 Ga0070675_100023411
193 Ga0070674_100020150
194 Ga0070688_100004833
195 Ga0070688_100084051
196 Ga0070714_100014045
197 Ga0070713_100004071
198 Ga0070711_100010647
199 Ga0070705_100001569
200 Ga0070662_100023958
201 Ga0070662_100111798
202 Ga0070698_100049472
203 Ga0070698_100066552
204 Ga0070699_100002722
205 Ga0070699_100088754
206 Ga0070679_100002771
207 Ga0070697_100002846
208 Ga0070686_100000596
209 Ga0070686_100003086
210 Ga0070695_100021250
211 Ga0070665_100002571
212 Ga0070665_100013463
213 Ga0068854_100038992
214 Ga0070702_100005240
215 Ga0068859_100025770
216 Ga0068859_100029456
217 Ga0068864_100010678
218 Ga0068866_10019507
219 Ga0068866_10034674
220 Ga0068861_100007701
221 Ga0068863_100006604
222 Ga0068858_100012725
223 Ga0068862_100002252
224 Ga0068862_100020119
225 Ga0075428_100007840
226 Ga0075428_100161666
227 Ga0075434_100008575
228 Ga0075434_100009202
229 Ga0068865_100004651
230 Ga0068865_100094703
231 Ga0075436_100000126
232 Ga0075436_100012988
233 Ga0075436_100025631
234 Ga0097620_100025770
235 Ga0097620_100029455
236 Ga0075435_100000002
237 Ga0075435_100002324
238 Ga0075435_100003357
239 Ga0075435_100041798
240 Ga0105240_10015650
241 Ga0111539_10012645
242 Ga0111539_10018948
243 Ga0105247_10006806
244 Ga0114129_10005305
245 Ga0114129_10009358
246 Ga0114129_10069519
247 Ga0114129_10139793
248 Ga0114129_10225940
249 Ga0105243_10008245
250 Ga0105242_10007268
251 Ga0105242_10007607
252 Ga0105248_10002375
253 Ga0105248_10015833
254 Ga0105248_10072791
255 Ga0105248_10141679
256 Ga0163162_10049988
257 Ga0163163_10059269
258 Ga0157380_10016056
259 Ga0157380_10053669
260 Ga0157379_10027392
261 Ga0157379_10028554
262 Ga0157376_10030659
263 Ga0207680_10014717
264 Ga0207645_10000815
265 Ga0207662_10002120
266 Ga0207662_10015766
267 Ga0207657_10008314
268 Ga0207652_10026859
269 Ga0207681_10003371
270 Ga0207659_10000555
271 Ga0207700_10008751
272 Ga0207670_10006061
273 Ga0207704_10003961
274 Ga0207711_10010416
275 Ga0207711_10025831
276 Ga0207711_10041170
277 Ga0207712_10021353
278 Ga0207640_10006121
279 Ga0207640_10009989
280 Ga0207640_10017762
281 Ga0207703_10060107
282 Ga0207641_10001538
283 Ga0207648_10028545
284 Ga0207648_10060713
285 Ga0207428_10016170
286 Ga0207428_10019886
287 Ga0268266_10001999
288 Ga0268265_10001443
289 Ga0268265_10054599
290 Ga0307408_100055959
291 Ga0265314_10016245
292 Ga0265342_10025605
293 Ga0307410_10019416
294 Ga0307407_10009417
295 Ga0307416_100054504
296 Ga0373930_0001297
297 Ga0373958_0000114
298 Ga0373959_0000279
299 Ga0373929_0001098
300 Ga0373940_0000889
301 Ga0373949_0001267
302 Ga0373949_0001822
303 Ga0373951_0000396
304 Ga0373932_0000137
305 Ga0373932_0000346
306 Ga0373939_0000366
307 Ga0373939_0003358
308 Ga0373941_0000199
309 Ga0373941_0000795
310 Ga0373960_0004033
311 Ga0373942_0000570
312 Ga0373942_0003182
313 Ga0373931_0005608
314 Ga0373931_0007105
315 Ga0373927_0001328
316 Ga0373937_0010426
317 Ga0436364_0016251
318 Ga0436365_0886003
319 Ga0451576_0003151
320 Ga0451576_0026962
321 Ga0495592_0078962
322 Ga0495664_0012638
323 Ga0495586_0091635
324 Ga0495587_0037658
325 Ga0495645_0028134
326 Ga0495634_0056476
327 Ga0495635_0013337
328 Ga0495658_0010131
329 Ga0495602_0063154
330 Ga0496100_0079483
331 Ga0496102_0050069
332 Ga0496106_0019347
333 Ga0496108_0099978
334 Ga0496112_0001527
335 Ga0496114_0019162
336 Ga0496114_0055686
337 Ga0496115_0029262
338 Ga0501041_0017713
339 Ga0501042_0027461
340 Ga0501071_0025383
341 Ga0501072_0051547
342 Ga0501072_0108551
343 Ga0501076_0032764
344 nmdc:mga05p37_10650_c1
345 nmdc:mga05p37_10654_c1
346 nmdc:mga05p37_127363_c1
347 nmdc:mga05p37_19375_c1
348 nmdc:mga05p37_21921_c1
349 nmdc:mga05p37_79822_c1
350 nmdc:mga09592_30657_c1
351 nmdc:mga08y16_47727_c1
352 nmdc:mga08y16_5422_c1
353 nmdc:mga0n895_43077_c1
354 nmdc:mga0n895_60_c1
355 nmdc:mga0n895_68539_c1
356 nmdc:mga0rr50_12502_c1
357 nmdc:mga0rr50_27_c1
358 nmdc:mga0rr50_856_c1
359 nmdc:mga0rr50_91039_c1
360 nmdc:mga08x19_2548_c1
361 nmdc:mga08x19_383_c1
362 nmdc:mga08x19_48122_c1
363 nmdc:mga08x19_8401_c1
364 nmdc:mga0a205_39495_c1
365 nmdc:mga0a205_42129_c1
366 nmdc:mga0a205_57189_c1
367 Ga0500616_0000099
368 Ga0530510_0046297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

124

161

0.82

PF13360

PQQ_2

PQQ-like domain

89

294

0.72

PF13360

PQQ_2

PQQ-like domain

554

665

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7904 127 228
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.7838 20 623
1kv9-assembly1.cif.gz_A structure at 1.9 a resolution of a quinohemoprotein alcohol dehydrogenase from pseudomonas putida hk5 0.7751 14 625
1kb0-assembly1.cif.gz_A crystal structure of quinohemoprotein alcohol dehydrogenase from comamonas testosteroni 0.7746 20 625
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.7734 18 623
ID Description Score Start End Superfamily
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.883 20 625 2.140.10.10
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8557 20 625 2.140.10.10
af_Q4L235_729_965_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8041 124 359 2.130.10.10
af_A0A0P0VQD8_25_138_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7929 258 358 2.130.10.10
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7904 127 228 2.40.10.480
ID Description Score Start End GO Terms
AF-A0A2N9MMM8-F1-model_v4 Quinoprotein glucose dehydrogenase (EC 1.1.5.2) 0.9789 19 625 GO:0008876
GO:0016020
GO:0048038
AF-A0A7X4D1Y8-F1-model_v4 deleted 0.9721 19 622
AF-A0A6N8VZ50-F1-model_v4 deleted 0.9719 20 384
AF-A0A2V8M0D2-F1-model_v4 Pyrroloquinoline quinone-dependent dehydrogenase 0.9652 21 544 GO:0008876
AF-Q025P1-F1-model_v4 Quinoprotein glucose dehydrogenase (EC 1.1.5.2) 0.9614 2 623 GO:0008876
GO:0016020
GO:0048038
GO:0050660

Map