F282105

General Info

Members Datasets Scaffolds Average Seq Length
184 118 184 217

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10000768|Ga0070701_100007687
Length 227
Sequence MMDSWLEAFASTGFRRSSDTAHDLKTPLNVAVLNLELLRMRVRKLAQGNDDEKVMAYARSIELELRRMAQIFDTFFILSTPPKGEGDPIDLDVCAICQEAADSVDVTLEPVAAIAVHAHESRIRQAFRLFFEGATQVLSAEGRTAKIVSNGTFTVSITGKPVAEELEIAKIFKFYYTDEQGNPDLSLAAARLIIETYGGELIASQDRDKVTLQLSLPSGAYEKSTDR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10023519 3300005327 Bacteria 4944
2 Ga0070683_100000020 3300005329 Bacteria 189501
3 Ga0070690_100084643 3300005330 Bacteria 2079
4 Ga0070670_100000085 3300005331 Bacteria 89017
5 Ga0070677_10099725 3300005333 Bacteria 1278
6 Ga0068869_100013464 3300005334 Bacteria 5442
7 Ga0070680_100029112 3300005336 Bacteria 4436
8 Ga0070680_100449800 3300005336 Unclassified 1100
9 Ga0070682_100000007 3300005337 Bacteria 346590
10 Ga0068868_100000599 3300005338 Bacteria 24234
11 Ga0068868_100003634 3300005338 Bacteria 10760
12 Ga0070689_100026030 3300005340 Bacteria 4400
13 Ga0070687_100077127 3300005343 Bacteria 1807
14 Ga0070661_100140464 3300005344 Bacteria 1820
15 Ga0070692_10040683 3300005345 Bacteria 2379
16 Ga0070675_100000003 3300005354 Bacteria 422595
17 Ga0070674_100265609 3300005356 Bacteria 1354
18 Ga0070673_100200193 3300005364 Bacteria 1720
19 Ga0070713_100101755 3300005436 Bacteria 2490
20 Ga0070701_10000768 3300005438 Bacteria 11437
21 Ga0070700_100000001 3300005441 Bacteria 346167
22 Ga0070708_100001926 3300005445 Bacteria 15995
23 Ga0070708_100017396 3300005445 Bacteria 5995
24 Ga0070708_100318497 3300005445 Bacteria 1465
25 Ga0070678_100241951 3300005456 Bacteria 1509
26 Ga0070678_100363886 3300005456 Bacteria 1247
27 Ga0070706_100001922 3300005467 Bacteria 21408
28 Ga0070706_100009851 3300005467 Bacteria 8879
29 Ga0070707_100003959 3300005468 Bacteria 13949
30 Ga0070707_100231042 3300005468 Bacteria 1800
31 Ga0070707_100271412 3300005468 Bacteria 1649
32 Ga0070707_100288859 3300005468 Bacteria 1593
33 Ga0070698_100020511 3300005471 Bacteria 6928
34 Ga0070698_100031268 3300005471 Bacteria 5519
35 Ga0070698_100055731 3300005471 Bacteria 4006
36 Ga0070698_100198539 3300005471 Bacteria 1942
37 Ga0070699_100000560 3300005518 Bacteria 35113
38 Ga0070699_100122480 3300005518 Bacteria 2288
39 Ga0070684_100013434 3300005535 Bacteria 6602
40 Ga0070684_100103056 3300005535 Bacteria 2552
41 Ga0070697_100130572 3300005536 Bacteria 2106
42 Ga0070697_100135750 3300005536 Bacteria 2066
43 Ga0070697_100148767 3300005536 Bacteria 1973
44 Ga0068853_100478436 3300005539 Unclassified 1174
45 Ga0070672_100000250 3300005543 Bacteria 30267
46 Ga0070672_100196834 3300005543 Bacteria 1684
47 Ga0070696_100290874 3300005546 Bacteria 1248
48 Ga0070696_100594521 3300005546 Archaea 891
49 Ga0070693_100002426 3300005547 Bacteria 8579
50 Ga0068857_100125813 3300005577 Bacteria 2309
51 Ga0068854_100005793 3300005578 Bacteria 7822
52 Ga0068854_100038262 3300005578 Bacteria 3373
53 Ga0070702_100212292 3300005615 Bacteria 1289
54 Ga0068864_100000001 3300005618 Bacteria 686767
55 Ga0068861_100021768 3300005719 Bacteria 4611
56 Ga0068870_10005457 3300005840 Bacteria 5558
57 Ga0068858_100005288 3300005842 Bacteria 12654
58 Ga0070717_10000087 3300006028 Bacteria 74346
59 Ga0070716_100111257 3300006173 Unclassified 1698
60 Ga0070716_100132501 3300006173 Bacteria 1578
61 Ga0070716_100192023 3300006173 Bacteria 1350
62 Ga0097621_100187123 3300006237 Bacteria 1791
63 Ga0097621_100277787 3300006237 Unclassified 1474
64 Ga0068871_100145295 3300006358 Bacteria 2019
65 Ga0068871_100198122 3300006358 Bacteria 1733
66 Ga0075430_100420595 3300006846 Bacteria 1103
67 Ga0075434_100377851 3300006871 Bacteria 1438
68 Ga0075436_100006218 3300006914 Bacteria 8189
69 Ga0075435_100000399 3300007076 Bacteria 26571
70 Ga0075435_100022126 3300007076 Bacteria 4902
71 Ga0105244_10016761 3300009036 Bacteria 4164
72 Ga0105240_10128291 3300009093 Bacteria 3045
73 Ga0111539_10000003 3300009094 Bacteria 880006
74 Ga0105245_10000054 3300009098 Bacteria 124956
75 Ga0105245_10000386 3300009098 Bacteria 41102
76 Ga0105245_10031985 3300009098 Bacteria 4657
77 Ga0105245_10459649 3300009098 Bacteria 1283
78 Ga0114129_10055855 3300009147 Bacteria 5533
79 Ga0114129_10091138 3300009147 Bacteria 4225
80 Ga0105242_10002406 3300009176 Bacteria 14723
81 Ga0105242_11033986 3300009176 Bacteria 831
82 Ga0105248_10549066 3300009177 Bacteria 1303
83 Ga0105238_10000010 3300009551 Bacteria 271274
84 Ga0105239_10028221 3300010375 Bacteria 6173
85 Ga0105246_10195388 3300011119 Unclassified 1569
86 Ga0157371_10219174 3300013102 Bacteria 1366
87 Ga0157369_10002196 3300013105 Bacteria 23502
88 Ga0157374_10000035 3300013296 Bacteria 180440
89 Ga0157378_10007055 3300013297 Bacteria 9810
90 Ga0157378_10054582 3300013297 Bacteria 3558
91 Ga0157378_10079746 3300013297 Bacteria 2956
92 Ga0157378_10236264 3300013297 Bacteria 1744
93 Ga0157378_10480678 3300013297 Bacteria 1238
94 Ga0157378_10731491 3300013297 Bacteria 1011
95 Ga0157378_11117065 3300013297 Bacteria 826
96 Ga0163162_10732991 3300013306 Bacteria 1108
97 Ga0157372_10300964 3300013307 Bacteria 1865
98 Ga0157372_10449069 3300013307 Bacteria 1503
99 Ga0157375_10000005 3300013308 Bacteria 429412
100 Ga0157375_10000066 3300013308 Bacteria 111876
101 Ga0157375_10000499 3300013308 Bacteria 35563
102 Ga0157375_10188903 3300013308 Bacteria 2214
103 Ga0157375_10331906 3300013308 Bacteria 1686
104 Ga0163163_10373254 3300014325 Bacteria 1484
105 Ga0163163_10578624 3300014325 Unclassified 1186
106 Ga0157380_10007558 3300014326 Bacteria 7720
107 Ga0157377_10000007 3300014745 Bacteria 402005
108 Ga0157377_10000105 3300014745 Bacteria 57869
109 Ga0157377_10131930 3300014745 Bacteria 1527
110 Ga0157376_10000002 3300014969 Bacteria 684532
111 Ga0213873_10000001 3300021358 Bacteria 1657979
112 Ga0213876_10000002 3300021384 Bacteria 1168769
113 Ga0213876_10000008 3300021384 Bacteria 506740
114 Ga0213876_10005524 3300021384 Bacteria 6939
115 Ga0213876_10224027 3300021384 Unclassified 1000
116 Ga0207655_1100223 3300025728 Unclassified 999
117 Ga0207645_10422096 3300025907 Bacteria 899
118 Ga0207643_10062138 3300025908 Bacteria 2134
119 Ga0207705_10056038 3300025909 Bacteria 2842
120 Ga0207684_10013402 3300025910 Bacteria 7093
121 Ga0207684_10034456 3300025910 Bacteria 4302
122 Ga0207684_10300405 3300025910 Bacteria 1384
123 Ga0207684_10832856 3300025910 Unclassified 778
124 Ga0207662_10103406 3300025918 Bacteria 1767
125 Ga0207652_10368281 3300025921 Bacteria 1297
126 Ga0207646_10001820 3300025922 Bacteria 25753
127 Ga0207646_10285744 3300025922 Bacteria 1491
128 Ga0207694_10000002 3300025924 Bacteria 1165763
129 Ga0207694_10000003 3300025924 Bacteria 1165533
130 Ga0207650_10000035 3300025925 Bacteria 215488
131 Ga0207659_10000006 3300025926 Bacteria 384976
132 Ga0207687_10000010 3300025927 Bacteria 403706
133 Ga0207687_10001342 3300025927 Bacteria 16831
134 Ga0207687_10018542 3300025927 Bacteria 4596
135 Ga0207686_10024266 3300025934 Bacteria 3512
136 Ga0207670_10000077 3300025936 Bacteria 67426
137 Ga0207670_10476530 3300025936 Bacteria 1010
138 Ga0207665_10076779 3300025939 Bacteria 2292
139 Ga0207665_10129517 3300025939 Bacteria 1789
140 Ga0207691_10006547 3300025940 Bacteria 11246
141 Ga0207691_10217489 3300025940 Bacteria 1658
142 Ga0207689_10012683 3300025942 Bacteria 7199
143 Ga0207661_10000002 3300025944 Bacteria 816104
144 Ga0207651_10046215 3300025960 Bacteria 2926
145 Ga0207640_10135939 3300025981 Bacteria 1785
146 Ga0207677_10000003 3300026023 Bacteria 450061
147 Ga0207677_10000183 3300026023 Bacteria 50255
148 Ga0207703_10000019 3300026035 Bacteria 254885
149 Ga0207639_10000005 3300026041 Bacteria 579948
150 Ga0207708_10000024 3300026075 Bacteria 172863
151 Ga0207648_10284027 3300026089 Bacteria 1480
152 Ga0207648_10451415 3300026089 Bacteria 1171
153 Ga0207648_10734275 3300026089 Bacteria 916
154 Ga0207676_10000002 3300026095 Bacteria 1198607
155 Ga0207674_10109049 3300026116 Bacteria 2745
156 Ga0207675_100013225 3300026118 Bacteria 7703
157 Ga0207683_10105834 3300026121 Bacteria 2515
158 Ga0207683_10797320 3300026121 Bacteria 877
159 Ga0207698_11244938 3300026142 Bacteria 758
160 Ga0207428_10000001 3300027907 Bacteria 1034622
161 Ga0307511_10086960 3300030521 Bacteria 2148
162 Ga0307408_100714644 3300031548 Unclassified 902
163 Ga0373932_0000078 3300035112 Bacteria 24720
164 Ga0436364_1532019 3300037853 Unclassified 1837
165 Ga0436365_0494970 3300039437 Bacteria 2200
166 Ga0436365_0693404 3300039437 Bacteria 102624
167 Ga0436365_0730020 3300039437 Bacteria 42794
168 Ga0436365_0948837 3300039437 Bacteria 1497
169 Ga0436365_1502450 3300039437 Bacteria 8993
170 Ga0436362_0046282 3300039453 Bacteria 14115
171 Ga0436362_0984254 3300039453 Bacteria 405590
172 Ga0451577_0175341 3300042876 Bacteria 1932
173 Ga0453683_0191935 3300044673 Bacteria 1296
174 Ga0453684_0419450 3300044712 Bacteria 1495
175 Ga0495679_013447 3300047446 Bacteria 3073
176 Ga0501040_0297162 3300049576 Unclassified 1154
177 Ga0501073_0007744 3300049589 Bacteria 7973
178 Ga0501080_0016776 3300049742 Bacteria 6764
179 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
180 nmdc:mga0n895_330280_c1 3300050512 Bacteria 1545
181 nmdc:mga0rr50_42_c1 3300050513 Bacteria 82213
182 nmdc:mga0rr50_8775_c1 3300050513 Bacteria 6307
183 nmdc:mga08x19_241_c1 3300050514 Bacteria 41732
184 Ga0495655_0000025 3300053083 Bacteria 34928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100022126 Ga0075435_1000221263 187
2 3300013297 Ga0157378_10236264 Ga0157378_102362642 187
3 3300026089 Ga0207648_10451415 Ga0207648_104514152 187
4 3300050513 nmdc:mga0rr50_8775_c1 nmdc:mga0rr50_8775_c1_2712_3350 187
5 3300005344 Ga0070661_100140464 Ga0070661_1001404642 190
6 3300006173 Ga0070716_100192023 Ga0070716_1001920232 190
7 3300005543 Ga0070672_100000250 Ga0070672_10000025018 193
8 3300013308 Ga0157375_10000005 Ga0157375_10000005214 193
9 3300025940 Ga0207691_10006547 Ga0207691_100065476 193
10 3300010375 Ga0105239_10028221 Ga0105239_100282215 197
11 3300009098 Ga0105245_10000386 Ga0105245_1000038626 200
12 3300025927 Ga0207687_10001342 Ga0207687_1000134212 200
13 3300005577 Ga0068857_100125813 Ga0068857_1001258132 206
14 3300026116 Ga0207674_10109049 Ga0207674_101090493 206
15 3300005547 Ga0070693_100002426 Ga0070693_1000024264 207
16 3300014325 Ga0163163_10578624 Ga0163163_105786242 207
17 3300025907 Ga0207645_10422096 Ga0207645_104220961 207
18 3300005333 Ga0070677_10099725 Ga0070677_100997252 208
19 3300005343 Ga0070687_100077127 Ga0070687_1000771273 208
20 3300005456 Ga0070678_100363886 Ga0070678_1003638861 208
21 3300006871 Ga0075434_100377851 Ga0075434_1003778512 208
22 3300013297 Ga0157378_10731491 Ga0157378_107314912 208
23 3300014745 Ga0157377_10000105 Ga0157377_1000010541 208
24 3300025918 Ga0207662_10103406 Ga0207662_101034062 208
25 3300026121 Ga0207683_10797320 Ga0207683_107973201 208
26 3300035112 Ga0373932_0000078 Ga0373932_0000078_13172_13804 208
27 3300050512 nmdc:mga0n895_330280_c1 nmdc:mga0n895_330280_c1_249_908 208
28 3300006173 Ga0070716_100111257 Ga0070716_1001112572 209
29 3300009093 Ga0105240_10128291 Ga0105240_101282913 210
30 3300013307 Ga0157372_10300964 Ga0157372_103009643 210
31 3300026041 Ga0207639_10000005 Ga0207639_10000005172 210
32 3300005330 Ga0070690_100084643 Ga0070690_1000846432 212
33 3300021384 Ga0213876_10005524 Ga0213876_100055245 212
34 3300039437 Ga0436365_1502450 Ga0436365_1502450_1875_2516 212
35 3300005467 Ga0070706_100009851 Ga0070706_1000098515 213
36 3300005471 Ga0070698_100055731 Ga0070698_1000557312 213
37 3300005536 Ga0070697_100148767 Ga0070697_1001487673 213
38 3300025910 Ga0207684_10034456 Ga0207684_100344563 213
39 3300005441 Ga0070700_100000001 Ga0070700_100000001261 214
40 3300005445 Ga0070708_100017396 Ga0070708_1000173964 214
41 3300005467 Ga0070706_100001922 Ga0070706_10000192223 214
42 3300005468 Ga0070707_100003959 Ga0070707_10000395911 214
43 3300005471 Ga0070698_100020511 Ga0070698_1000205112 214
44 3300005518 Ga0070699_100000560 Ga0070699_10000056014 214
45 3300005518 Ga0070699_100122480 Ga0070699_1001224802 214
46 3300005535 Ga0070684_100103056 Ga0070684_1001030563 214
47 3300005536 Ga0070697_100135750 Ga0070697_1001357502 214
48 3300025910 Ga0207684_10013402 Ga0207684_100134022 214
49 3300025922 Ga0207646_10001820 Ga0207646_100018206 214
50 3300026075 Ga0207708_10000024 Ga0207708_1000002483 214
51 3300005356 Ga0070674_100265609 Ga0070674_1002656091 216
52 3300009147 Ga0114129_10055855 Ga0114129_100558552 216
53 3300014745 Ga0157377_10131930 Ga0157377_101319301 216
54 3300005354 Ga0070675_100000003 Ga0070675_100000003331 217
55 3300005456 Ga0070678_100241951 Ga0070678_1002419512 217
56 3300005546 Ga0070696_100594521 Ga0070696_1005945212 217
57 3300005615 Ga0070702_100212292 Ga0070702_1002122923 217
58 3300006846 Ga0075430_100420595 Ga0075430_1004205952 217
59 3300009036 Ga0105244_10016761 Ga0105244_100167612 217
60 3300009098 Ga0105245_10459649 Ga0105245_104596492 217
61 3300009147 Ga0114129_10091138 Ga0114129_100911383 217
62 3300013102 Ga0157371_10219174 Ga0157371_102191742 217
63 3300013297 Ga0157378_10480678 Ga0157378_104806782 217
64 3300025728 Ga0207655_1100223 Ga0207655_11002232 217
65 3300025926 Ga0207659_10000006 Ga0207659_1000000639 217
66 3300025936 Ga0207670_10476530 Ga0207670_104765302 217
67 3300026089 Ga0207648_10734275 Ga0207648_107342752 217
68 3300026121 Ga0207683_10105834 Ga0207683_101058343 217
69 3300031548 Ga0307408_100714644 Ga0307408_1007146441 217
70 3300005336 Ga0070680_100029112 Ga0070680_1000291122 218
71 3300005337 Ga0070682_100000007 Ga0070682_100000007276 218
72 3300005338 Ga0068868_100000599 Ga0068868_1000005999 218
73 3300005340 Ga0070689_100026030 Ga0070689_1000260305 218
74 3300005364 Ga0070673_100200193 Ga0070673_1002001932 218
75 3300005438 Ga0070701_10000768 Ga0070701_100007687 218
76 3300005445 Ga0070708_100001926 Ga0070708_10000192617 218
77 3300005468 Ga0070707_100231042 Ga0070707_1002310423 218
78 3300005468 Ga0070707_100271412 Ga0070707_1002714122 218
79 3300005468 Ga0070707_100288859 Ga0070707_1002888592 218
80 3300005471 Ga0070698_100031268 Ga0070698_1000312682 218
81 3300005536 Ga0070697_100130572 Ga0070697_1001305722 218
82 3300005539 Ga0068853_100478436 Ga0068853_1004784362 218
83 3300005618 Ga0068864_100000001 Ga0068864_100000001436 218
84 3300005719 Ga0068861_100021768 Ga0068861_1000217684 218
85 3300005840 Ga0068870_10005457 Ga0068870_100054573 218
86 3300005842 Ga0068858_100005288 Ga0068858_1000052885 218
87 3300009094 Ga0111539_10000003 Ga0111539_10000003533 218
88 3300009098 Ga0105245_10031985 Ga0105245_100319853 218
89 3300009176 Ga0105242_10002406 Ga0105242_100024063 218
90 3300011119 Ga0105246_10195388 Ga0105246_101953882 218
91 3300013297 Ga0157378_10079746 Ga0157378_100797463 218
92 3300013306 Ga0163162_10732991 Ga0163162_107329912 218
93 3300013308 Ga0157375_10331906 Ga0157375_103319062 218
94 3300014326 Ga0157380_10007558 Ga0157380_100075583 218
95 3300021358 Ga0213873_10000001 Ga0213873_10000001606 218
96 3300021384 Ga0213876_10000002 Ga0213876_10000002936 218
97 3300021384 Ga0213876_10224027 Ga0213876_102240272 218
98 3300025908 Ga0207643_10062138 Ga0207643_100621383 218
99 3300025910 Ga0207684_10300405 Ga0207684_103004052 218
100 3300025910 Ga0207684_10832856 Ga0207684_108328562 218
101 3300025922 Ga0207646_10285744 Ga0207646_102857443 218
102 3300025927 Ga0207687_10018542 Ga0207687_100185423 218
103 3300025934 Ga0207686_10024266 Ga0207686_100242662 218
104 3300025936 Ga0207670_10000077 Ga0207670_1000007742 218
105 3300025960 Ga0207651_10046215 Ga0207651_100462153 218
106 3300026023 Ga0207677_10000003 Ga0207677_1000000324 218
107 3300026035 Ga0207703_10000019 Ga0207703_10000019125 218
108 3300026089 Ga0207648_10284027 Ga0207648_102840272 218
109 3300026095 Ga0207676_10000002 Ga0207676_10000002398 218
110 3300026118 Ga0207675_100013225 Ga0207675_1000132255 218
111 3300027907 Ga0207428_10000001 Ga0207428_10000001679 218
112 3300030521 Ga0307511_10086960 Ga0307511_100869602 218
113 3300037853 Ga0436364_1532019 Ga0436364_1532019_550_1212 218
114 3300039437 Ga0436365_0693404 Ga0436365_0693404_97883_98548 218
115 3300039437 Ga0436365_0948837 Ga0436365_0948837_90_755 218
116 3300039453 Ga0436362_0984254 Ga0436362_0984254_344630_345295 218
117 3300044673 Ga0453683_0191935 Ga0453683_0191935_184_849 218
118 3300049576 Ga0501040_0297162 Ga0501040_0297162_346_1008 218
119 3300049589 Ga0501073_0007744 Ga0501073_0007744_5763_6425 218
120 3300049742 Ga0501080_0016776 Ga0501080_0016776_2626_3288 218
121 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_279417_280088 218
122 3300005329 Ga0070683_100000020 Ga0070683_10000002031 219
123 3300005331 Ga0070670_100000085 Ga0070670_10000008546 219
124 3300005338 Ga0068868_100003634 Ga0068868_1000036343 219
125 3300005345 Ga0070692_10040683 Ga0070692_100406832 219
126 3300005436 Ga0070713_100101755 Ga0070713_1001017553 219
127 3300005445 Ga0070708_100318497 Ga0070708_1003184972 219
128 3300005471 Ga0070698_100198539 Ga0070698_1001985393 219
129 3300005535 Ga0070684_100013434 Ga0070684_1000134343 219
130 3300005546 Ga0070696_100290874 Ga0070696_1002908741 219
131 3300005578 Ga0068854_100005793 Ga0068854_1000057935 219
132 3300005578 Ga0068854_100038262 Ga0068854_1000382623 219
133 3300006028 Ga0070717_10000087 Ga0070717_1000008725 219
134 3300006173 Ga0070716_100132501 Ga0070716_1001325012 219
135 3300006237 Ga0097621_100187123 Ga0097621_1001871231 219
136 3300006358 Ga0068871_100145295 Ga0068871_1001452952 219
137 3300006914 Ga0075436_100006218 Ga0075436_1000062184 219
138 3300007076 Ga0075435_100000399 Ga0075435_10000039929 219
139 3300009098 Ga0105245_10000054 Ga0105245_1000005495 219
140 3300009176 Ga0105242_11033986 Ga0105242_110339862 219
141 3300009551 Ga0105238_10000010 Ga0105238_10000010259 219
142 3300013105 Ga0157369_10002196 Ga0157369_100021963 219
143 3300013296 Ga0157374_10000035 Ga0157374_100000353 219
144 3300013307 Ga0157372_10449069 Ga0157372_104490692 219
145 3300013308 Ga0157375_10000499 Ga0157375_1000049926 219
146 3300013308 Ga0157375_10188903 Ga0157375_101889032 219
147 3300014325 Ga0163163_10373254 Ga0163163_103732542 219
148 3300014745 Ga0157377_10000007 Ga0157377_10000007166 219
149 3300014969 Ga0157376_10000002 Ga0157376_1000000210 219
150 3300021384 Ga0213876_10000008 Ga0213876_10000008288 219
151 3300025924 Ga0207694_10000002 Ga0207694_10000002434 219
152 3300025924 Ga0207694_10000003 Ga0207694_10000003666 219
153 3300025925 Ga0207650_10000035 Ga0207650_1000003531 219
154 3300025927 Ga0207687_10000010 Ga0207687_10000010297 219
155 3300025939 Ga0207665_10076779 Ga0207665_100767793 219
156 3300025939 Ga0207665_10129517 Ga0207665_101295172 219
157 3300025944 Ga0207661_10000002 Ga0207661_10000002164 219
158 3300025981 Ga0207640_10135939 Ga0207640_101359393 219
159 3300026023 Ga0207677_10000183 Ga0207677_1000018330 219
160 3300026142 Ga0207698_11244938 Ga0207698_112449381 219
161 3300039437 Ga0436365_0494970 Ga0436365_0494970_1516_2181 219
162 3300039437 Ga0436365_0730020 Ga0436365_0730020_21641_22300 219
163 3300039453 Ga0436362_0046282 Ga0436362_0046282_12429_13088 219
164 3300042876 Ga0451577_0175341 Ga0451577_0175341_1036_1704 219
165 3300044712 Ga0453684_0419450 Ga0453684_0419450_39_707 219
166 3300050513 nmdc:mga0rr50_42_c1 nmdc:mga0rr50_42_c1_51976_52647 219
167 3300050514 nmdc:mga08x19_241_c1 nmdc:mga08x19_241_c1_37665_38336 219
168 3300053083 Ga0495655_0000025 Ga0495655_0000025_20746_21462 221
169 3300005327 Ga0070658_10023519 Ga0070658_100235193 222
170 3300005334 Ga0068869_100013464 Ga0068869_1000134642 222
171 3300005336 Ga0070680_100449800 Ga0070680_1004498002 222
172 3300005543 Ga0070672_100196834 Ga0070672_1001968342 222
173 3300006237 Ga0097621_100277787 Ga0097621_1002777872 222
174 3300006358 Ga0068871_100198122 Ga0068871_1001981222 222
175 3300009177 Ga0105248_10549066 Ga0105248_105490662 222
176 3300013297 Ga0157378_10007055 Ga0157378_100070553 222
177 3300013297 Ga0157378_10054582 Ga0157378_100545823 222
178 3300013297 Ga0157378_11117065 Ga0157378_111170652 222
179 3300013308 Ga0157375_10000066 Ga0157375_1000006689 222
180 3300025909 Ga0207705_10056038 Ga0207705_100560383 222
181 3300025921 Ga0207652_10368281 Ga0207652_103682812 222
182 3300025940 Ga0207691_10217489 Ga0207691_102174892 222
183 3300025942 Ga0207689_10012683 Ga0207689_100126833 222
184 3300047446 Ga0495679_013447 Ga0495679_013447_2362_3030 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

16

84

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sl2-assembly1.cif.gz_A atp forms a stable complex with the essential histidine kinase walk (yycg) domain 0.7868 90 222
6blk-assembly2.cif.gz_D mycobacterial sensor histidine kinase mprb 0.7626 90 222
6blk-assembly3.cif.gz_A mycobacterial sensor histidine kinase mprb 0.7604 88 222
3a0y-assembly1.cif.gz_A catalytic domain of histidine kinase thka (tm1359) (nucleotide free form 3: 1,2-propanediol, orthorombic) 0.7476 87 220
8dx0-assembly2.cif.gz_B vansc ca domain 0.7474 90 222
ID Description Score Start End Superfamily
4i5sB04 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8119 89 222 3.30.565.10
af_P0AEJ4_294_450_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8053 87 220 3.30.565.10
af_P9WGK5_228_381_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8035 89 221 3.30.565.10
af_P21865_736_887_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8024 90 222 3.30.565.10
4biyC02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8003 87 222 3.30.565.10
ID Description Score Start End GO Terms
AF-A0A2V7Y2B1-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.7813 4 222 GO:0000155
AF-A0A2V7Y2B1-F1-model_v4 Signal transduction histidine kinase dimerisation/phosphoacceptor domain-containing protein 0.7712 4 222 GO:0000155
AF-A0A832CDS8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.7701 56 222 GO:0016301
AF-A0A832CDS8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.7618 56 222 GO:0016301
AF-A0A7Y2N7U1-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.7553 8 222 GO:0000155
GO:0005886

Feature Viewer

pLDDT pTM Quality
91.43 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map