F280823
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 183 | 133 | 183 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10000095|Ga0105249_1000009517 |
| Length | 177 |
| Sequence | VKTPSGRWAGLVFALLVLATLAAFAWSQRLKRDPLVIDRVTFVAVPNLHPKKPVHSFTPNGDCRFDRIRIRFRTTTTDHGTVQVVKPGGRVVITLARDAFLKRYHFHTYYWDGRSRNDGIAPPGRYKLRVKLLGQDRVLVPPGSMKLHRAEESHPSESSPGESRDACFDFHGKGKGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 26 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 27 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 58 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 59 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 60 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 61 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 104 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 105 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 106 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 107 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 108 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 109 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 111 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 112 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 113 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 114 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 117 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 118 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 133 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 14.75 |
| Rhizosphere | 82.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000969 | 3300001977 | Bacteria | 4504 |
| 2 | Ga0070683_100020417 | 3300005329 | Bacteria | 5896 |
| 3 | Ga0070683_100134769 | 3300005329 | Bacteria | 2338 |
| 4 | Ga0070677_10000048 | 3300005333 | Bacteria | 37331 |
| 5 | Ga0070680_100392538 | 3300005336 | Unclassified | 1182 |
| 6 | Ga0070682_100000029 | 3300005337 | Bacteria | 183516 |
| 7 | Ga0070669_100068368 | 3300005353 | Bacteria | 2622 |
| 8 | Ga0070673_100000245 | 3300005364 | Bacteria | 27379 |
| 9 | Ga0070659_100143279 | 3300005366 | Bacteria | 1946 |
| 10 | Ga0070701_10584459 | 3300005438 | Bacteria | 737 |
| 11 | Ga0070663_100156707 | 3300005455 | Bacteria | 1750 |
| 12 | Ga0070678_100785732 | 3300005456 | Bacteria | 863 |
| 13 | Ga0070662_100000008 | 3300005457 | Bacteria | 168754 |
| 14 | Ga0070681_10788110 | 3300005458 | Unclassified | 867 |
| 15 | Ga0070679_100000823 | 3300005530 | Bacteria | 26958 |
| 16 | Ga0070684_100054463 | 3300005535 | Bacteria | 3486 |
| 17 | Ga0070684_100709685 | 3300005535 | Unclassified | 938 |
| 18 | Ga0068853_100055822 | 3300005539 | Bacteria | 3405 |
| 19 | Ga0070693_100012182 | 3300005547 | Bacteria | 4348 |
| 20 | Ga0070665_100000120 | 3300005548 | Bacteria | 148340 |
| 21 | Ga0068854_100065537 | 3300005578 | Bacteria | 2641 |
| 22 | Ga0068856_100618330 | 3300005614 | Bacteria | 1104 |
| 23 | Ga0068864_100000044 | 3300005618 | Bacteria | 157919 |
| 24 | Ga0068861_100096377 | 3300005719 | Bacteria | 2344 |
| 25 | Ga0068858_100000035 | 3300005842 | Bacteria | 140466 |
| 26 | Ga0097621_100221116 | 3300006237 | Bacteria | 1650 |
| 27 | Ga0068871_100200328 | 3300006358 | Bacteria | 1723 |
| 28 | Ga0075433_10009223 | 3300006852 | Bacteria | 7887 |
| 29 | Ga0105245_10000150 | 3300009098 | Bacteria | 66121 |
| 30 | Ga0105245_10000327 | 3300009098 | Bacteria | 44888 |
| 31 | Ga0105245_10959319 | 3300009098 | Bacteria | 898 |
| 32 | Ga0105247_10000712 | 3300009101 | Bacteria | 25919 |
| 33 | Ga0105242_10002594 | 3300009176 | Bacteria | 14161 |
| 34 | Ga0105242_10011835 | 3300009176 | Bacteria | 6714 |
| 35 | Ga0105242_10164987 | 3300009176 | Unclassified | 1942 |
| 36 | Ga0105238_10000240 | 3300009551 | Bacteria | 61138 |
| 37 | Ga0105249_10000095 | 3300009553 | Bacteria | 121300 |
| 38 | Ga0105246_10693554 | 3300011119 | Bacteria | 892 |
| 39 | Ga0157374_10000668 | 3300013296 | Bacteria | 30198 |
| 40 | Ga0157375_10000723 | 3300013308 | Bacteria | 29095 |
| 41 | Ga0157375_10006804 | 3300013308 | Bacteria | 9953 |
| 42 | Ga0157375_10008069 | 3300013308 | Bacteria | 9210 |
| 43 | Ga0163161_10000058 | 3300017792 | Bacteria | 114035 |
| 44 | Ga0207682_10000168 | 3300025893 | Bacteria | 30073 |
| 45 | Ga0207710_10000103 | 3300025900 | Bacteria | 109033 |
| 46 | Ga0207707_10023305 | 3300025912 | Bacteria | 5417 |
| 47 | Ga0207663_10011424 | 3300025916 | Bacteria | 4769 |
| 48 | Ga0207681_10054746 | 3300025923 | Bacteria | 2714 |
| 49 | Ga0207694_10000067 | 3300025924 | Bacteria | 128108 |
| 50 | Ga0207687_10000021 | 3300025927 | Bacteria | 226396 |
| 51 | Ga0207687_10000099 | 3300025927 | Bacteria | 63345 |
| 52 | Ga0207706_10000016 | 3300025933 | Bacteria | 170697 |
| 53 | Ga0207686_10005499 | 3300025934 | Bacteria | 6798 |
| 54 | Ga0207661_10013560 | 3300025944 | Bacteria | 5953 |
| 55 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 56 | Ga0207703_10000067 | 3300026035 | Bacteria | 125623 |
| 57 | Ga0207639_10015952 | 3300026041 | Bacteria | 5306 |
| 58 | Ga0207678_10183374 | 3300026067 | Unclassified | 1787 |
| 59 | Ga0207708_10083159 | 3300026075 | Bacteria | 2461 |
| 60 | Ga0207708_10162864 | 3300026075 | Bacteria | 1762 |
| 61 | Ga0207702_10009270 | 3300026078 | Bacteria | 8271 |
| 62 | Ga0207676_10000043 | 3300026095 | Bacteria | 161948 |
| 63 | Ga0207675_100236769 | 3300026118 | Bacteria | 1763 |
| 64 | Ga0207683_10821181 | 3300026121 | Bacteria | 863 |
| 65 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 66 | Ga0268265_10730674 | 3300028380 | Bacteria | 959 |
| 67 | Ga0373947_0847877 | 3300035725 | Bacteria | 624 |
| 68 | Ga0373937_0005645 | 3300036401 | Bacteria | 10741 |
| 69 | Ga0451833_0776297 | 3300041491 | Bacteria | 998 |
| 70 | Ga0451853_3713106 | 3300041512 | Bacteria | 4139 |
| 71 | Ga0495592_0367192 | 3300046454 | Unclassified | 919 |
| 72 | Ga0495592_0417801 | 3300046454 | Bacteria | 846 |
| 73 | Ga0495603_0002055 | 3300046455 | Bacteria | 11838 |
| 74 | Ga0495603_0004805 | 3300046455 | Bacteria | 8078 |
| 75 | Ga0495591_062709 | 3300046458 | Bacteria | 983 |
| 76 | Ga0495641_0000187 | 3300046461 | Bacteria | 47961 |
| 77 | Ga0495641_0200953 | 3300046461 | Bacteria | 893 |
| 78 | Ga0495651_0239204 | 3300046462 | Unclassified | 1246 |
| 79 | Ga0495653_0080445 | 3300046463 | Unclassified | 2411 |
| 80 | Ga0495582_0000005 | 3300046473 | Bacteria | 156170 |
| 81 | Ga0495639_0196784 | 3300046475 | Unclassified | 985 |
| 82 | Ga0495662_0000022 | 3300046476 | Bacteria | 54342 |
| 83 | Ga0495662_0268230 | 3300046476 | Bacteria | 840 |
| 84 | Ga0495608_0000702 | 3300046511 | Bacteria | 23274 |
| 85 | Ga0495608_0082218 | 3300046511 | Bacteria | 2091 |
| 86 | Ga0495628_0002703 | 3300046516 | Bacteria | 15872 |
| 87 | Ga0495628_0038496 | 3300046516 | Bacteria | 3828 |
| 88 | Ga0495628_0445075 | 3300046516 | Bacteria | 941 |
| 89 | Ga0495630_0034097 | 3300046517 | Bacteria | 3798 |
| 90 | Ga0495637_0094348 | 3300046520 | Bacteria | 1176 |
| 91 | Ga0495652_0619576 | 3300046529 | Bacteria | 736 |
| 92 | Ga0495665_0421654 | 3300046531 | Bacteria | 676 |
| 93 | Ga0495640_0018395 | 3300046533 | Bacteria | 5184 |
| 94 | Ga0495640_0659139 | 3300046533 | Unclassified | 629 |
| 95 | Ga0495586_0023067 | 3300046535 | Bacteria | 3322 |
| 96 | Ga0495656_0009659 | 3300046615 | Unclassified | 3478 |
| 97 | Ga0495668_0110988 | 3300046616 | Bacteria | 1500 |
| 98 | Ga0495634_0182392 | 3300046642 | Bacteria | 1313 |
| 99 | Ga0495635_0000106 | 3300046663 | Bacteria | 49353 |
| 100 | Ga0495588_0116944 | 3300046674 | Unclassified | 1405 |
| 101 | Ga0495657_0065503 | 3300046675 | Bacteria | 2389 |
| 102 | Ga0495599_0012575 | 3300046678 | Bacteria | 5219 |
| 103 | Ga0495623_0107035 | 3300046679 | Bacteria | 1698 |
| 104 | Ga0495647_0000013 | 3300046681 | Bacteria | 88029 |
| 105 | Ga0495647_0003993 | 3300046681 | Bacteria | 4762 |
| 106 | Ga0495647_0194069 | 3300046681 | Unclassified | 888 |
| 107 | Ga0495658_0000019 | 3300046683 | Bacteria | 91606 |
| 108 | Ga0495658_0147304 | 3300046683 | Bacteria | 1444 |
| 109 | Ga0495669_0000163 | 3300046684 | Bacteria | 42549 |
| 110 | Ga0495669_0363933 | 3300046684 | Unclassified | 699 |
| 111 | Ga0495613_0000257 | 3300046689 | Bacteria | 50000 |
| 112 | Ga0495624_0000013 | 3300046690 | Bacteria | 115278 |
| 113 | Ga0495624_0026298 | 3300046690 | Bacteria | 3815 |
| 114 | Ga0495649_0000828 | 3300046694 | Bacteria | 24830 |
| 115 | Ga0495600_0116204 | 3300046809 | Bacteria | 1741 |
| 116 | Ga0495600_0185168 | 3300046809 | Bacteria | 1341 |
| 117 | Ga0495600_0353859 | 3300046809 | Unclassified | 920 |
| 118 | Ga0495604_0000033 | 3300047317 | Bacteria | 134810 |
| 119 | Ga0495604_0351428 | 3300047317 | Unclassified | 979 |
| 120 | Ga0495674_0000007 | 3300047319 | Bacteria | 336257 |
| 121 | Ga0495676_0000091 | 3300047321 | Bacteria | 66575 |
| 122 | Ga0495676_0922359 | 3300047321 | Bacteria | 559 |
| 123 | Ga0495680_0000023 | 3300047322 | Bacteria | 116444 |
| 124 | Ga0495680_0110520 | 3300047322 | Unclassified | 2037 |
| 125 | Ga0495680_0320169 | 3300047322 | Bacteria | 1085 |
| 126 | Ga0495673_0068305 | 3300047469 | Bacteria | 1502 |
| 127 | Ga0495684_0418887 | 3300047471 | Bacteria | 937 |
| 128 | Ga0495593_0044691 | 3300047673 | Bacteria | 2368 |
| 129 | Ga0495602_0024048 | 3300048088 | Bacteria | 5917 |
| 130 | Ga0495602_0162065 | 3300048088 | Unclassified | 1745 |
| 131 | Ga0495614_0026726 | 3300048089 | Bacteria | 2488 |
| 132 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 133 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 134 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 135 | Ga0496104_0000063 | 3300048907 | Bacteria | 116618 |
| 136 | Ga0496104_0001015 | 3300048907 | Bacteria | 24067 |
| 137 | Ga0496104_0434965 | 3300048907 | Bacteria | 1224 |
| 138 | Ga0496105_0000031 | 3300048908 | Bacteria | 137220 |
| 139 | Ga0496105_0000041 | 3300048908 | Bacteria | 116618 |
| 140 | Ga0496105_0000209 | 3300048908 | Bacteria | 39293 |
| 141 | Ga0496105_0013957 | 3300048908 | Bacteria | 6387 |
| 142 | Ga0496106_0000048 | 3300048909 | Bacteria | 98233 |
| 143 | Ga0496107_0000008 | 3300048910 | Bacteria | 251874 |
| 144 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 145 | Ga0496108_0246965 | 3300048911 | Bacteria | 1552 |
| 146 | Ga0496108_0313993 | 3300048911 | Unclassified | 1366 |
| 147 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 148 | Ga0496109_0056558 | 3300048912 | Bacteria | 3580 |
| 149 | Ga0496109_0109589 | 3300048912 | Bacteria | 2567 |
| 150 | Ga0496110_0031609 | 3300048913 | Bacteria | 4568 |
| 151 | Ga0496110_0300702 | 3300048913 | Unclassified | 1461 |
| 152 | Ga0496111_0033906 | 3300048914 | Bacteria | 3642 |
| 153 | Ga0496111_0388561 | 3300048914 | Bacteria | 1032 |
| 154 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 155 | Ga0496112_1720924 | 3300048915 | Bacteria | 539 |
| 156 | Ga0496113_0080793 | 3300048916 | Bacteria | 2491 |
| 157 | Ga0496114_0017181 | 3300048917 | Bacteria | 5835 |
| 158 | Ga0496115_0686450 | 3300048918 | Bacteria | 806 |
| 159 | Ga0496119_0007318 | 3300048922 | Bacteria | 9988 |
| 160 | Ga0496120_0026756 | 3300048923 | Bacteria | 3558 |
| 161 | Ga0501031_0239220 | 3300049568 | Archaea | 1180 |
| 162 | Ga0501031_0240160 | 3300049568 | Unclassified | 1178 |
| 163 | Ga0501036_0155772 | 3300049572 | Bacteria | 1927 |
| 164 | Ga0501040_0053062 | 3300049576 | Bacteria | 2776 |
| 165 | Ga0501040_0705626 | 3300049576 | Bacteria | 730 |
| 166 | Ga0501041_0608295 | 3300049577 | Bacteria | 698 |
| 167 | Ga0501072_0260767 | 3300049588 | Unclassified | 1379 |
| 168 | Ga0501075_0000855 | 3300049591 | Bacteria | 19203 |
| 169 | Ga0501075_0408660 | 3300049591 | Unclassified | 1035 |
| 170 | Ga0501076_0413866 | 3300049592 | Unclassified | 1109 |
| 171 | Ga0501076_1101960 | 3300049592 | Bacteria | 654 |
| 172 | Ga0501079_0679260 | 3300049741 | Unclassified | 811 |
| 173 | Ga0501045_0350303 | 3300049824 | Bacteria | 1099 |
| 174 | nmdc:mga0a205_1249_c1 | 3300050515 | Bacteria | 21321 |
| 175 | Ga0495601_0000120 | 3300053077 | Bacteria | 43540 |
| 176 | Ga0495601_0011663 | 3300053077 | Bacteria | 5268 |
| 177 | Ga0495601_0097122 | 3300053077 | Bacteria | 1900 |
| 178 | Ga0495612_0001747 | 3300053078 | Bacteria | 8905 |
| 179 | Ga0495595_0000109 | 3300053084 | Bacteria | 37617 |
| 180 | Ga0495619_0011820 | 3300053085 | Bacteria | 5499 |
| 181 | Ga0495619_0148392 | 3300053085 | Bacteria | 1617 |
| 182 | Ga0500614_000177 | 3300053123 | Bacteria | 16403 |
| 183 | Ga0501082_0856946 | 3300060353 | Bacteria | 795 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006237 | Ga0097621_100221116 | Ga0097621_1002211162 | 143 |
| 2 | 3300006358 | Ga0068871_100200328 | Ga0068871_1002003282 | 143 |
| 3 | 3300046517 | Ga0495630_0034097 | Ga0495630_0034097_1873_2358 | 144 |
| 4 | 3300049741 | Ga0501079_0679260 | Ga0501079_0679260_292_741 | 144 |
| 5 | 3300046529 | Ga0495652_0619576 | Ga0495652_0619576_212_682 | 148 |
| 6 | 3300046684 | Ga0495669_0363933 | Ga0495669_0363933_57_545 | 149 |
| 7 | 3300049577 | Ga0501041_0608295 | Ga0501041_0608295_101_562 | 150 |
| 8 | 3300049592 | Ga0501076_1101960 | Ga0501076_1101960_24_485 | 150 |
| 9 | 3300060353 | Ga0501082_0856946 | Ga0501082_0856946_276_737 | 150 |
| 10 | 3300005457 | Ga0070662_100000008 | Ga0070662_100000008110 | 151 |
| 11 | 3300013308 | Ga0157375_10006804 | Ga0157375_100068049 | 151 |
| 12 | 3300025933 | Ga0207706_10000016 | Ga0207706_1000001664 | 151 |
| 13 | 3300046679 | Ga0495623_0107035 | Ga0495623_0107035_55_549 | 151 |
| 14 | 3300046681 | Ga0495647_0000013 | Ga0495647_0000013_86085_86579 | 151 |
| 15 | 3300046690 | Ga0495624_0000013 | Ga0495624_0000013_95594_96091 | 151 |
| 16 | 3300047317 | Ga0495604_0351428 | Ga0495604_0351428_364_861 | 151 |
| 17 | 3300048907 | Ga0496104_0001015 | Ga0496104_0001015_12230_12706 | 151 |
| 18 | 3300048908 | Ga0496105_0000209 | Ga0496105_0000209_2139_2615 | 151 |
| 19 | 3300048915 | Ga0496112_1720924 | Ga0496112_1720924_17_502 | 151 |
| 20 | 3300049591 | Ga0501075_0000855 | Ga0501075_0000855_14356_14865 | 151 |
| 21 | 3300053077 | Ga0495601_0011663 | Ga0495601_0011663_3812_4288 | 151 |
| 22 | 3300053077 | Ga0495601_0097122 | Ga0495601_0097122_232_708 | 151 |
| 23 | 3300005366 | Ga0070659_100143279 | Ga0070659_1001432793 | 152 |
| 24 | 3300005455 | Ga0070663_100156707 | Ga0070663_1001567073 | 152 |
| 25 | 3300005456 | Ga0070678_100785732 | Ga0070678_1007857322 | 152 |
| 26 | 3300005547 | Ga0070693_100012182 | Ga0070693_1000121824 | 152 |
| 27 | 3300005618 | Ga0068864_100000044 | Ga0068864_100000044111 | 152 |
| 28 | 3300009176 | Ga0105242_10011835 | Ga0105242_100118353 | 152 |
| 29 | 3300013296 | Ga0157374_10000668 | Ga0157374_1000066818 | 152 |
| 30 | 3300013308 | Ga0157375_10000723 | Ga0157375_100007237 | 152 |
| 31 | 3300025934 | Ga0207686_10005499 | Ga0207686_100054994 | 152 |
| 32 | 3300026067 | Ga0207678_10183374 | Ga0207678_101833742 | 152 |
| 33 | 3300026075 | Ga0207708_10083159 | Ga0207708_100831593 | 152 |
| 34 | 3300026095 | Ga0207676_10000043 | Ga0207676_10000043110 | 152 |
| 35 | 3300026121 | Ga0207683_10821181 | Ga0207683_108211812 | 152 |
| 36 | 3300046455 | Ga0495603_0004805 | Ga0495603_0004805_5784_6272 | 152 |
| 37 | 3300046475 | Ga0495639_0196784 | Ga0495639_0196784_94_579 | 152 |
| 38 | 3300046476 | Ga0495662_0268230 | Ga0495662_0268230_246_704 | 152 |
| 39 | 3300046520 | Ga0495637_0094348 | Ga0495637_0094348_29_520 | 152 |
| 40 | 3300046535 | Ga0495586_0023067 | Ga0495586_0023067_409_894 | 152 |
| 41 | 3300046681 | Ga0495647_0194069 | Ga0495647_0194069_242_700 | 152 |
| 42 | 3300047317 | Ga0495604_0000033 | Ga0495604_0000033_31709_32188 | 152 |
| 43 | 3300048911 | Ga0496108_0246965 | Ga0496108_0246965_194_655 | 152 |
| 44 | 3300048912 | Ga0496109_0056558 | Ga0496109_0056558_390_851 | 152 |
| 45 | 3300049568 | Ga0501031_0240160 | Ga0501031_0240160_273_752 | 152 |
| 46 | 3300049572 | Ga0501036_0155772 | Ga0501036_0155772_337_816 | 152 |
| 47 | 3300049576 | Ga0501040_0053062 | Ga0501040_0053062_2048_2527 | 152 |
| 48 | 3300049588 | Ga0501072_0260767 | Ga0501072_0260767_391_870 | 152 |
| 49 | 3300049591 | Ga0501075_0408660 | Ga0501075_0408660_123_602 | 152 |
| 50 | 3300049592 | Ga0501076_0413866 | Ga0501076_0413866_535_1014 | 152 |
| 51 | 3300049824 | Ga0501045_0350303 | Ga0501045_0350303_313_792 | 152 |
| 52 | 3300046516 | Ga0495628_0038496 | Ga0495628_0038496_2228_2737 | 157 |
| 53 | 3300046531 | Ga0495665_0421654 | Ga0495665_0421654_125_631 | 157 |
| 54 | 3300046615 | Ga0495656_0009659 | Ga0495656_0009659_931_1425 | 157 |
| 55 | 3300046681 | Ga0495647_0003993 | Ga0495647_0003993_2968_3477 | 157 |
| 56 | 3300005329 | Ga0070683_100020417 | Ga0070683_1000204173 | 158 |
| 57 | 3300005333 | Ga0070677_10000048 | Ga0070677_1000004810 | 158 |
| 58 | 3300005364 | Ga0070673_100000245 | Ga0070673_10000024519 | 158 |
| 59 | 3300005535 | Ga0070684_100054463 | Ga0070684_1000544633 | 158 |
| 60 | 3300005539 | Ga0068853_100055822 | Ga0068853_1000558222 | 158 |
| 61 | 3300005548 | Ga0070665_100000120 | Ga0070665_10000012026 | 158 |
| 62 | 3300005578 | Ga0068854_100065537 | Ga0068854_1000655373 | 158 |
| 63 | 3300005842 | Ga0068858_100000035 | Ga0068858_10000003524 | 158 |
| 64 | 3300009098 | Ga0105245_10000327 | Ga0105245_1000032721 | 158 |
| 65 | 3300009176 | Ga0105242_10002594 | Ga0105242_1000259411 | 158 |
| 66 | 3300025893 | Ga0207682_10000168 | Ga0207682_1000016823 | 158 |
| 67 | 3300025927 | Ga0207687_10000021 | Ga0207687_1000002121 | 158 |
| 68 | 3300025944 | Ga0207661_10013560 | Ga0207661_100135604 | 158 |
| 69 | 3300026035 | Ga0207703_10000067 | Ga0207703_1000006757 | 158 |
| 70 | 3300026041 | Ga0207639_10015952 | Ga0207639_100159523 | 158 |
| 71 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023386 | 158 |
| 72 | 3300041512 | Ga0451853_3713106 | Ga0451853_3713106_2962_3465 | 158 |
| 73 | 3300046694 | Ga0495649_0000828 | Ga0495649_0000828_3811_4326 | 158 |
| 74 | 3300048088 | Ga0495602_0162065 | Ga0495602_0162065_1214_1711 | 158 |
| 75 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_352373_352888 | 158 |
| 76 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_352373_352888 | 158 |
| 77 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_128836_129348 | 158 |
| 78 | 3300048908 | Ga0496105_0000031 | Ga0496105_0000031_7873_8385 | 158 |
| 79 | 3300048909 | Ga0496106_0000048 | Ga0496106_0000048_7918_8433 | 158 |
| 80 | 3300048910 | Ga0496107_0000008 | Ga0496107_0000008_243433_243948 | 158 |
| 81 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_216565_217077 | 158 |
| 82 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_216527_217039 | 158 |
| 83 | 3300048916 | Ga0496113_0080793 | Ga0496113_0080793_1451_1954 | 158 |
| 84 | 3300049576 | Ga0501040_0705626 | Ga0501040_0705626_88_582 | 158 |
| 85 | 3300053077 | Ga0495601_0000120 | Ga0495601_0000120_206_709 | 158 |
| 86 | 3300005336 | Ga0070680_100392538 | Ga0070680_1003925382 | 159 |
| 87 | 3300005337 | Ga0070682_100000029 | Ga0070682_100000029143 | 159 |
| 88 | 3300005353 | Ga0070669_100068368 | Ga0070669_1000683682 | 159 |
| 89 | 3300005458 | Ga0070681_10788110 | Ga0070681_107881102 | 159 |
| 90 | 3300005530 | Ga0070679_100000823 | Ga0070679_10000082311 | 159 |
| 91 | 3300005614 | Ga0068856_100618330 | Ga0068856_1006183302 | 159 |
| 92 | 3300005719 | Ga0068861_100096377 | Ga0068861_1000963773 | 159 |
| 93 | 3300009098 | Ga0105245_10000150 | Ga0105245_1000015020 | 159 |
| 94 | 3300009101 | Ga0105247_10000712 | Ga0105247_1000071213 | 159 |
| 95 | 3300009176 | Ga0105242_10164987 | Ga0105242_101649872 | 159 |
| 96 | 3300009551 | Ga0105238_10000240 | Ga0105238_1000024031 | 159 |
| 97 | 3300009553 | Ga0105249_10000095 | Ga0105249_1000009517 | 159 |
| 98 | 3300013308 | Ga0157375_10008069 | Ga0157375_100080697 | 159 |
| 99 | 3300017792 | Ga0163161_10000058 | Ga0163161_1000005869 | 159 |
| 100 | 3300025900 | Ga0207710_10000103 | Ga0207710_1000010313 | 159 |
| 101 | 3300025912 | Ga0207707_10023305 | Ga0207707_100233056 | 159 |
| 102 | 3300025923 | Ga0207681_10054746 | Ga0207681_100547463 | 159 |
| 103 | 3300025924 | Ga0207694_10000067 | Ga0207694_1000006795 | 159 |
| 104 | 3300025927 | Ga0207687_10000099 | Ga0207687_1000009919 | 159 |
| 105 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003511 | 159 |
| 106 | 3300026078 | Ga0207702_10009270 | Ga0207702_100092706 | 159 |
| 107 | 3300026118 | Ga0207675_100236769 | Ga0207675_1002367693 | 159 |
| 108 | 3300028380 | Ga0268265_10730674 | Ga0268265_107306742 | 159 |
| 109 | 3300041491 | Ga0451833_0776297 | Ga0451833_0776297_27_539 | 159 |
| 110 | 3300046454 | Ga0495592_0367192 | Ga0495592_0367192_13_528 | 159 |
| 111 | 3300046455 | Ga0495603_0002055 | Ga0495603_0002055_10866_11390 | 159 |
| 112 | 3300046458 | Ga0495591_062709 | Ga0495591_062709_116_616 | 159 |
| 113 | 3300046461 | Ga0495641_0000187 | Ga0495641_0000187_44454_44960 | 159 |
| 114 | 3300046463 | Ga0495653_0080445 | Ga0495653_0080445_1713_2228 | 159 |
| 115 | 3300046473 | Ga0495582_0000005 | Ga0495582_0000005_133128_133643 | 159 |
| 116 | 3300046476 | Ga0495662_0000022 | Ga0495662_0000022_42474_42989 | 159 |
| 117 | 3300046511 | Ga0495608_0000702 | Ga0495608_0000702_12206_12721 | 159 |
| 118 | 3300046511 | Ga0495608_0082218 | Ga0495608_0082218_299_805 | 159 |
| 119 | 3300046516 | Ga0495628_0002703 | Ga0495628_0002703_7626_8141 | 159 |
| 120 | 3300046516 | Ga0495628_0445075 | Ga0495628_0445075_208_705 | 159 |
| 121 | 3300046533 | Ga0495640_0018395 | Ga0495640_0018395_1033_1548 | 159 |
| 122 | 3300046533 | Ga0495640_0659139 | Ga0495640_0659139_115_612 | 159 |
| 123 | 3300046642 | Ga0495634_0182392 | Ga0495634_0182392_286_801 | 159 |
| 124 | 3300046678 | Ga0495599_0012575 | Ga0495599_0012575_114_617 | 159 |
| 125 | 3300046683 | Ga0495658_0000019 | Ga0495658_0000019_22538_23053 | 159 |
| 126 | 3300046684 | Ga0495669_0000163 | Ga0495669_0000163_7928_8446 | 159 |
| 127 | 3300046689 | Ga0495613_0000257 | Ga0495613_0000257_12068_12583 | 159 |
| 128 | 3300046809 | Ga0495600_0353859 | Ga0495600_0353859_80_598 | 159 |
| 129 | 3300047319 | Ga0495674_0000007 | Ga0495674_0000007_18286_18783 | 159 |
| 130 | 3300047321 | Ga0495676_0000091 | Ga0495676_0000091_11159_11665 | 159 |
| 131 | 3300047322 | Ga0495680_0320169 | Ga0495680_0320169_105_617 | 159 |
| 132 | 3300048907 | Ga0496104_0000063 | Ga0496104_0000063_23747_24274 | 159 |
| 133 | 3300048908 | Ga0496105_0000041 | Ga0496105_0000041_92345_92872 | 159 |
| 134 | 3300048913 | Ga0496110_0031609 | Ga0496110_0031609_2040_2546 | 159 |
| 135 | 3300048917 | Ga0496114_0017181 | Ga0496114_0017181_4113_4619 | 159 |
| 136 | 3300048918 | Ga0496115_0686450 | Ga0496115_0686450_44_550 | 159 |
| 137 | 3300048922 | Ga0496119_0007318 | Ga0496119_0007318_9351_9878 | 159 |
| 138 | 3300048923 | Ga0496120_0026756 | Ga0496120_0026756_2669_3196 | 159 |
| 139 | 3300053078 | Ga0495612_0001747 | Ga0495612_0001747_5009_5527 | 159 |
| 140 | 3300053084 | Ga0495595_0000109 | Ga0495595_0000109_238_753 | 159 |
| 141 | 3300053123 | Ga0500614_000177 | Ga0500614_000177_12240_12746 | 159 |
| 142 | 3300001977 | JGI24746J21847_1000969 | JGI24746J21847_10009692 | 160 |
| 143 | 3300005329 | Ga0070683_100134769 | Ga0070683_1001347693 | 160 |
| 144 | 3300005438 | Ga0070701_10584459 | Ga0070701_105844591 | 160 |
| 145 | 3300005535 | Ga0070684_100709685 | Ga0070684_1007096852 | 160 |
| 146 | 3300006852 | Ga0075433_10009223 | Ga0075433_100092236 | 160 |
| 147 | 3300009098 | Ga0105245_10959319 | Ga0105245_109593192 | 160 |
| 148 | 3300011119 | Ga0105246_10693554 | Ga0105246_106935541 | 160 |
| 149 | 3300025916 | Ga0207663_10011424 | Ga0207663_100114243 | 160 |
| 150 | 3300026075 | Ga0207708_10162864 | Ga0207708_101628641 | 160 |
| 151 | 3300035725 | Ga0373947_0847877 | Ga0373947_0847877_45_560 | 160 |
| 152 | 3300036401 | Ga0373937_0005645 | Ga0373937_0005645_6575_7078 | 160 |
| 153 | 3300046454 | Ga0495592_0417801 | Ga0495592_0417801_239_751 | 160 |
| 154 | 3300046461 | Ga0495641_0200953 | Ga0495641_0200953_296_811 | 160 |
| 155 | 3300046462 | Ga0495651_0239204 | Ga0495651_0239204_182_700 | 160 |
| 156 | 3300046616 | Ga0495668_0110988 | Ga0495668_0110988_755_1273 | 160 |
| 157 | 3300046663 | Ga0495635_0000106 | Ga0495635_0000106_47395_47913 | 160 |
| 158 | 3300046674 | Ga0495588_0116944 | Ga0495588_0116944_384_902 | 160 |
| 159 | 3300046675 | Ga0495657_0065503 | Ga0495657_0065503_1160_1684 | 160 |
| 160 | 3300046683 | Ga0495658_0147304 | Ga0495658_0147304_71_553 | 160 |
| 161 | 3300046690 | Ga0495624_0026298 | Ga0495624_0026298_672_1193 | 160 |
| 162 | 3300046809 | Ga0495600_0116204 | Ga0495600_0116204_685_1188 | 160 |
| 163 | 3300046809 | Ga0495600_0185168 | Ga0495600_0185168_68_571 | 160 |
| 164 | 3300047321 | Ga0495676_0922359 | Ga0495676_0922359_13_528 | 160 |
| 165 | 3300047322 | Ga0495680_0000023 | Ga0495680_0000023_59086_59604 | 160 |
| 166 | 3300047322 | Ga0495680_0110520 | Ga0495680_0110520_528_1031 | 160 |
| 167 | 3300047469 | Ga0495673_0068305 | Ga0495673_0068305_763_1281 | 160 |
| 168 | 3300047471 | Ga0495684_0418887 | Ga0495684_0418887_363_881 | 160 |
| 169 | 3300047673 | Ga0495593_0044691 | Ga0495593_0044691_1482_1985 | 160 |
| 170 | 3300048088 | Ga0495602_0024048 | Ga0495602_0024048_297_812 | 160 |
| 171 | 3300048089 | Ga0495614_0026726 | Ga0495614_0026726_1440_1937 | 160 |
| 172 | 3300048907 | Ga0496104_0434965 | Ga0496104_0434965_347_916 | 160 |
| 173 | 3300048908 | Ga0496105_0013957 | Ga0496105_0013957_2291_2860 | 160 |
| 174 | 3300048911 | Ga0496108_0313993 | Ga0496108_0313993_101_604 | 160 |
| 175 | 3300048912 | Ga0496109_0109589 | Ga0496109_0109589_1888_2391 | 160 |
| 176 | 3300048913 | Ga0496110_0300702 | Ga0496110_0300702_677_1180 | 160 |
| 177 | 3300048914 | Ga0496111_0033906 | Ga0496111_0033906_1411_1914 | 160 |
| 178 | 3300048914 | Ga0496111_0388561 | Ga0496111_0388561_518_1009 | 160 |
| 179 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_671745_672257 | 160 |
| 180 | 3300049568 | Ga0501031_0239220 | Ga0501031_0239220_498_1022 | 160 |
| 181 | 3300050515 | nmdc:mga0a205_1249_c1 | nmdc:mga0a205_1249_c1_1560_2045 | 160 |
| 182 | 3300053085 | Ga0495619_0011820 | Ga0495619_0011820_3711_4214 | 160 |
| 183 | 3300053085 | Ga0495619_0148392 | Ga0495619_0148392_383_886 | 160 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xf1-assembly1.cif.gz_B | structure of c5a peptidase- a key virulence factor from streptococcus | 0.7169 | 56 | 150 |
| 5xxz-assembly1.cif.gz_A | crystal structure of a serine protease from streptococcus species | 0.6821 | 47 | 148 |
| 3osv-assembly1.cif.gz_A | the crytsal structure of flgd from p. aeruginosa | 0.6753 | 66 | 140 |
| 6foa-assembly1.cif.gz_A | human xylosyltransferase 1 apo structure | 0.6687 | 66 | 132 |
| 6ejc-assembly1.cif.gz_A | human xylosyltransferase 1 in complex with peptide qeeegsgvgqgg | 0.6644 | 66 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6IE52_125_219_2.60.40.1930 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.7219 | 33 | 151 | 2.60.40.1930 |
| af_Q6IE52_125_219_2.60.40.1930 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.7156 | 33 | 151 | 2.60.40.1930 |
| af_A0A0R4ITJ9_559_652_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6783 | 33 | 151 | 2.60.40.10 |
| af_Q8R422_128_225_2.60.40.1930 | Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain | 0.6687 | 39 | 151 | 2.60.40.1930 |
| 3osvD02 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6639 | 66 | 145 | 2.60.40.4070 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0UT15-F1-model_v4 | N,N-dimethylformamidase beta subunit-like C-terminal domain-containing protein | 0.8793 | 34 | 151 |
|
| AF-A0A660YQB0-F1-model_v4 | FlgD Ig-like domain-containing protein | 0.875 | 56 | 149 |
|
| AF-A0A661UHT1-F1-model_v4 | T9SS type A sorting domain-containing protein | 0.8719 | 66 | 149 |
|
| AF-A0A496ZTL1-F1-model_v4 | T9SS type A sorting domain-containing protein | 0.8692 | 57 | 149 |
|
| AF-A0A7D5T0Z8-F1-model_v4 | FlgD Ig-like domain-containing protein | 0.8649 | 56 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar