F280823

General Info

Members Datasets Scaffolds Average Seq Length
183 133 183 167

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000095|Ga0105249_1000009517
Length 177
Sequence VKTPSGRWAGLVFALLVLATLAAFAWSQRLKRDPLVIDRVTFVAVPNLHPKKPVHSFTPNGDCRFDRIRIRFRTTTTDHGTVQVVKPGGRVVITLARDAFLKRYHFHTYYWDGRSRNDGIAPPGRYKLRVKLLGQDRVLVPPGSMKLHRAEESHPSESSPGESRDACFDFHGKGKGR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
76 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
77 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 14.75
Rhizosphere 82.51
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000969 3300001977 Bacteria 4504
2 Ga0070683_100020417 3300005329 Bacteria 5896
3 Ga0070683_100134769 3300005329 Bacteria 2338
4 Ga0070677_10000048 3300005333 Bacteria 37331
5 Ga0070680_100392538 3300005336 Unclassified 1182
6 Ga0070682_100000029 3300005337 Bacteria 183516
7 Ga0070669_100068368 3300005353 Bacteria 2622
8 Ga0070673_100000245 3300005364 Bacteria 27379
9 Ga0070659_100143279 3300005366 Bacteria 1946
10 Ga0070701_10584459 3300005438 Bacteria 737
11 Ga0070663_100156707 3300005455 Bacteria 1750
12 Ga0070678_100785732 3300005456 Bacteria 863
13 Ga0070662_100000008 3300005457 Bacteria 168754
14 Ga0070681_10788110 3300005458 Unclassified 867
15 Ga0070679_100000823 3300005530 Bacteria 26958
16 Ga0070684_100054463 3300005535 Bacteria 3486
17 Ga0070684_100709685 3300005535 Unclassified 938
18 Ga0068853_100055822 3300005539 Bacteria 3405
19 Ga0070693_100012182 3300005547 Bacteria 4348
20 Ga0070665_100000120 3300005548 Bacteria 148340
21 Ga0068854_100065537 3300005578 Bacteria 2641
22 Ga0068856_100618330 3300005614 Bacteria 1104
23 Ga0068864_100000044 3300005618 Bacteria 157919
24 Ga0068861_100096377 3300005719 Bacteria 2344
25 Ga0068858_100000035 3300005842 Bacteria 140466
26 Ga0097621_100221116 3300006237 Bacteria 1650
27 Ga0068871_100200328 3300006358 Bacteria 1723
28 Ga0075433_10009223 3300006852 Bacteria 7887
29 Ga0105245_10000150 3300009098 Bacteria 66121
30 Ga0105245_10000327 3300009098 Bacteria 44888
31 Ga0105245_10959319 3300009098 Bacteria 898
32 Ga0105247_10000712 3300009101 Bacteria 25919
33 Ga0105242_10002594 3300009176 Bacteria 14161
34 Ga0105242_10011835 3300009176 Bacteria 6714
35 Ga0105242_10164987 3300009176 Unclassified 1942
36 Ga0105238_10000240 3300009551 Bacteria 61138
37 Ga0105249_10000095 3300009553 Bacteria 121300
38 Ga0105246_10693554 3300011119 Bacteria 892
39 Ga0157374_10000668 3300013296 Bacteria 30198
40 Ga0157375_10000723 3300013308 Bacteria 29095
41 Ga0157375_10006804 3300013308 Bacteria 9953
42 Ga0157375_10008069 3300013308 Bacteria 9210
43 Ga0163161_10000058 3300017792 Bacteria 114035
44 Ga0207682_10000168 3300025893 Bacteria 30073
45 Ga0207710_10000103 3300025900 Bacteria 109033
46 Ga0207707_10023305 3300025912 Bacteria 5417
47 Ga0207663_10011424 3300025916 Bacteria 4769
48 Ga0207681_10054746 3300025923 Bacteria 2714
49 Ga0207694_10000067 3300025924 Bacteria 128108
50 Ga0207687_10000021 3300025927 Bacteria 226396
51 Ga0207687_10000099 3300025927 Bacteria 63345
52 Ga0207706_10000016 3300025933 Bacteria 170697
53 Ga0207686_10005499 3300025934 Bacteria 6798
54 Ga0207661_10013560 3300025944 Bacteria 5953
55 Ga0207712_10000003 3300025961 Bacteria 615314
56 Ga0207703_10000067 3300026035 Bacteria 125623
57 Ga0207639_10015952 3300026041 Bacteria 5306
58 Ga0207678_10183374 3300026067 Unclassified 1787
59 Ga0207708_10083159 3300026075 Bacteria 2461
60 Ga0207708_10162864 3300026075 Bacteria 1762
61 Ga0207702_10009270 3300026078 Bacteria 8271
62 Ga0207676_10000043 3300026095 Bacteria 161948
63 Ga0207675_100236769 3300026118 Bacteria 1763
64 Ga0207683_10821181 3300026121 Bacteria 863
65 Ga0268266_10000023 3300028379 Bacteria 501899
66 Ga0268265_10730674 3300028380 Bacteria 959
67 Ga0373947_0847877 3300035725 Bacteria 624
68 Ga0373937_0005645 3300036401 Bacteria 10741
69 Ga0451833_0776297 3300041491 Bacteria 998
70 Ga0451853_3713106 3300041512 Bacteria 4139
71 Ga0495592_0367192 3300046454 Unclassified 919
72 Ga0495592_0417801 3300046454 Bacteria 846
73 Ga0495603_0002055 3300046455 Bacteria 11838
74 Ga0495603_0004805 3300046455 Bacteria 8078
75 Ga0495591_062709 3300046458 Bacteria 983
76 Ga0495641_0000187 3300046461 Bacteria 47961
77 Ga0495641_0200953 3300046461 Bacteria 893
78 Ga0495651_0239204 3300046462 Unclassified 1246
79 Ga0495653_0080445 3300046463 Unclassified 2411
80 Ga0495582_0000005 3300046473 Bacteria 156170
81 Ga0495639_0196784 3300046475 Unclassified 985
82 Ga0495662_0000022 3300046476 Bacteria 54342
83 Ga0495662_0268230 3300046476 Bacteria 840
84 Ga0495608_0000702 3300046511 Bacteria 23274
85 Ga0495608_0082218 3300046511 Bacteria 2091
86 Ga0495628_0002703 3300046516 Bacteria 15872
87 Ga0495628_0038496 3300046516 Bacteria 3828
88 Ga0495628_0445075 3300046516 Bacteria 941
89 Ga0495630_0034097 3300046517 Bacteria 3798
90 Ga0495637_0094348 3300046520 Bacteria 1176
91 Ga0495652_0619576 3300046529 Bacteria 736
92 Ga0495665_0421654 3300046531 Bacteria 676
93 Ga0495640_0018395 3300046533 Bacteria 5184
94 Ga0495640_0659139 3300046533 Unclassified 629
95 Ga0495586_0023067 3300046535 Bacteria 3322
96 Ga0495656_0009659 3300046615 Unclassified 3478
97 Ga0495668_0110988 3300046616 Bacteria 1500
98 Ga0495634_0182392 3300046642 Bacteria 1313
99 Ga0495635_0000106 3300046663 Bacteria 49353
100 Ga0495588_0116944 3300046674 Unclassified 1405
101 Ga0495657_0065503 3300046675 Bacteria 2389
102 Ga0495599_0012575 3300046678 Bacteria 5219
103 Ga0495623_0107035 3300046679 Bacteria 1698
104 Ga0495647_0000013 3300046681 Bacteria 88029
105 Ga0495647_0003993 3300046681 Bacteria 4762
106 Ga0495647_0194069 3300046681 Unclassified 888
107 Ga0495658_0000019 3300046683 Bacteria 91606
108 Ga0495658_0147304 3300046683 Bacteria 1444
109 Ga0495669_0000163 3300046684 Bacteria 42549
110 Ga0495669_0363933 3300046684 Unclassified 699
111 Ga0495613_0000257 3300046689 Bacteria 50000
112 Ga0495624_0000013 3300046690 Bacteria 115278
113 Ga0495624_0026298 3300046690 Bacteria 3815
114 Ga0495649_0000828 3300046694 Bacteria 24830
115 Ga0495600_0116204 3300046809 Bacteria 1741
116 Ga0495600_0185168 3300046809 Bacteria 1341
117 Ga0495600_0353859 3300046809 Unclassified 920
118 Ga0495604_0000033 3300047317 Bacteria 134810
119 Ga0495604_0351428 3300047317 Unclassified 979
120 Ga0495674_0000007 3300047319 Bacteria 336257
121 Ga0495676_0000091 3300047321 Bacteria 66575
122 Ga0495676_0922359 3300047321 Bacteria 559
123 Ga0495680_0000023 3300047322 Bacteria 116444
124 Ga0495680_0110520 3300047322 Unclassified 2037
125 Ga0495680_0320169 3300047322 Bacteria 1085
126 Ga0495673_0068305 3300047469 Bacteria 1502
127 Ga0495684_0418887 3300047471 Bacteria 937
128 Ga0495593_0044691 3300047673 Bacteria 2368
129 Ga0495602_0024048 3300048088 Bacteria 5917
130 Ga0495602_0162065 3300048088 Unclassified 1745
131 Ga0495614_0026726 3300048089 Bacteria 2488
132 Ga0496100_0000003 3300048903 Bacteria 360802
133 Ga0496101_0000003 3300048904 Bacteria 406565
134 Ga0496104_0000003 3300048907 Bacteria 669219
135 Ga0496104_0000063 3300048907 Bacteria 116618
136 Ga0496104_0001015 3300048907 Bacteria 24067
137 Ga0496104_0434965 3300048907 Bacteria 1224
138 Ga0496105_0000031 3300048908 Bacteria 137220
139 Ga0496105_0000041 3300048908 Bacteria 116618
140 Ga0496105_0000209 3300048908 Bacteria 39293
141 Ga0496105_0013957 3300048908 Bacteria 6387
142 Ga0496106_0000048 3300048909 Bacteria 98233
143 Ga0496107_0000008 3300048910 Bacteria 251874
144 Ga0496108_0000002 3300048911 Bacteria 700890
145 Ga0496108_0246965 3300048911 Bacteria 1552
146 Ga0496108_0313993 3300048911 Unclassified 1366
147 Ga0496109_0000001 3300048912 Bacteria 700852
148 Ga0496109_0056558 3300048912 Bacteria 3580
149 Ga0496109_0109589 3300048912 Bacteria 2567
150 Ga0496110_0031609 3300048913 Bacteria 4568
151 Ga0496110_0300702 3300048913 Unclassified 1461
152 Ga0496111_0033906 3300048914 Bacteria 3642
153 Ga0496111_0388561 3300048914 Bacteria 1032
154 Ga0496112_0000002 3300048915 Bacteria 782039
155 Ga0496112_1720924 3300048915 Bacteria 539
156 Ga0496113_0080793 3300048916 Bacteria 2491
157 Ga0496114_0017181 3300048917 Bacteria 5835
158 Ga0496115_0686450 3300048918 Bacteria 806
159 Ga0496119_0007318 3300048922 Bacteria 9988
160 Ga0496120_0026756 3300048923 Bacteria 3558
161 Ga0501031_0239220 3300049568 Archaea 1180
162 Ga0501031_0240160 3300049568 Unclassified 1178
163 Ga0501036_0155772 3300049572 Bacteria 1927
164 Ga0501040_0053062 3300049576 Bacteria 2776
165 Ga0501040_0705626 3300049576 Bacteria 730
166 Ga0501041_0608295 3300049577 Bacteria 698
167 Ga0501072_0260767 3300049588 Unclassified 1379
168 Ga0501075_0000855 3300049591 Bacteria 19203
169 Ga0501075_0408660 3300049591 Unclassified 1035
170 Ga0501076_0413866 3300049592 Unclassified 1109
171 Ga0501076_1101960 3300049592 Bacteria 654
172 Ga0501079_0679260 3300049741 Unclassified 811
173 Ga0501045_0350303 3300049824 Bacteria 1099
174 nmdc:mga0a205_1249_c1 3300050515 Bacteria 21321
175 Ga0495601_0000120 3300053077 Bacteria 43540
176 Ga0495601_0011663 3300053077 Bacteria 5268
177 Ga0495601_0097122 3300053077 Bacteria 1900
178 Ga0495612_0001747 3300053078 Bacteria 8905
179 Ga0495595_0000109 3300053084 Bacteria 37617
180 Ga0495619_0011820 3300053085 Bacteria 5499
181 Ga0495619_0148392 3300053085 Bacteria 1617
182 Ga0500614_000177 3300053123 Bacteria 16403
183 Ga0501082_0856946 3300060353 Bacteria 795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_100221116 Ga0097621_1002211162 143
2 3300006358 Ga0068871_100200328 Ga0068871_1002003282 143
3 3300046517 Ga0495630_0034097 Ga0495630_0034097_1873_2358 144
4 3300049741 Ga0501079_0679260 Ga0501079_0679260_292_741 144
5 3300046529 Ga0495652_0619576 Ga0495652_0619576_212_682 148
6 3300046684 Ga0495669_0363933 Ga0495669_0363933_57_545 149
7 3300049577 Ga0501041_0608295 Ga0501041_0608295_101_562 150
8 3300049592 Ga0501076_1101960 Ga0501076_1101960_24_485 150
9 3300060353 Ga0501082_0856946 Ga0501082_0856946_276_737 150
10 3300005457 Ga0070662_100000008 Ga0070662_100000008110 151
11 3300013308 Ga0157375_10006804 Ga0157375_100068049 151
12 3300025933 Ga0207706_10000016 Ga0207706_1000001664 151
13 3300046679 Ga0495623_0107035 Ga0495623_0107035_55_549 151
14 3300046681 Ga0495647_0000013 Ga0495647_0000013_86085_86579 151
15 3300046690 Ga0495624_0000013 Ga0495624_0000013_95594_96091 151
16 3300047317 Ga0495604_0351428 Ga0495604_0351428_364_861 151
17 3300048907 Ga0496104_0001015 Ga0496104_0001015_12230_12706 151
18 3300048908 Ga0496105_0000209 Ga0496105_0000209_2139_2615 151
19 3300048915 Ga0496112_1720924 Ga0496112_1720924_17_502 151
20 3300049591 Ga0501075_0000855 Ga0501075_0000855_14356_14865 151
21 3300053077 Ga0495601_0011663 Ga0495601_0011663_3812_4288 151
22 3300053077 Ga0495601_0097122 Ga0495601_0097122_232_708 151
23 3300005366 Ga0070659_100143279 Ga0070659_1001432793 152
24 3300005455 Ga0070663_100156707 Ga0070663_1001567073 152
25 3300005456 Ga0070678_100785732 Ga0070678_1007857322 152
26 3300005547 Ga0070693_100012182 Ga0070693_1000121824 152
27 3300005618 Ga0068864_100000044 Ga0068864_100000044111 152
28 3300009176 Ga0105242_10011835 Ga0105242_100118353 152
29 3300013296 Ga0157374_10000668 Ga0157374_1000066818 152
30 3300013308 Ga0157375_10000723 Ga0157375_100007237 152
31 3300025934 Ga0207686_10005499 Ga0207686_100054994 152
32 3300026067 Ga0207678_10183374 Ga0207678_101833742 152
33 3300026075 Ga0207708_10083159 Ga0207708_100831593 152
34 3300026095 Ga0207676_10000043 Ga0207676_10000043110 152
35 3300026121 Ga0207683_10821181 Ga0207683_108211812 152
36 3300046455 Ga0495603_0004805 Ga0495603_0004805_5784_6272 152
37 3300046475 Ga0495639_0196784 Ga0495639_0196784_94_579 152
38 3300046476 Ga0495662_0268230 Ga0495662_0268230_246_704 152
39 3300046520 Ga0495637_0094348 Ga0495637_0094348_29_520 152
40 3300046535 Ga0495586_0023067 Ga0495586_0023067_409_894 152
41 3300046681 Ga0495647_0194069 Ga0495647_0194069_242_700 152
42 3300047317 Ga0495604_0000033 Ga0495604_0000033_31709_32188 152
43 3300048911 Ga0496108_0246965 Ga0496108_0246965_194_655 152
44 3300048912 Ga0496109_0056558 Ga0496109_0056558_390_851 152
45 3300049568 Ga0501031_0240160 Ga0501031_0240160_273_752 152
46 3300049572 Ga0501036_0155772 Ga0501036_0155772_337_816 152
47 3300049576 Ga0501040_0053062 Ga0501040_0053062_2048_2527 152
48 3300049588 Ga0501072_0260767 Ga0501072_0260767_391_870 152
49 3300049591 Ga0501075_0408660 Ga0501075_0408660_123_602 152
50 3300049592 Ga0501076_0413866 Ga0501076_0413866_535_1014 152
51 3300049824 Ga0501045_0350303 Ga0501045_0350303_313_792 152
52 3300046516 Ga0495628_0038496 Ga0495628_0038496_2228_2737 157
53 3300046531 Ga0495665_0421654 Ga0495665_0421654_125_631 157
54 3300046615 Ga0495656_0009659 Ga0495656_0009659_931_1425 157
55 3300046681 Ga0495647_0003993 Ga0495647_0003993_2968_3477 157
56 3300005329 Ga0070683_100020417 Ga0070683_1000204173 158
57 3300005333 Ga0070677_10000048 Ga0070677_1000004810 158
58 3300005364 Ga0070673_100000245 Ga0070673_10000024519 158
59 3300005535 Ga0070684_100054463 Ga0070684_1000544633 158
60 3300005539 Ga0068853_100055822 Ga0068853_1000558222 158
61 3300005548 Ga0070665_100000120 Ga0070665_10000012026 158
62 3300005578 Ga0068854_100065537 Ga0068854_1000655373 158
63 3300005842 Ga0068858_100000035 Ga0068858_10000003524 158
64 3300009098 Ga0105245_10000327 Ga0105245_1000032721 158
65 3300009176 Ga0105242_10002594 Ga0105242_1000259411 158
66 3300025893 Ga0207682_10000168 Ga0207682_1000016823 158
67 3300025927 Ga0207687_10000021 Ga0207687_1000002121 158
68 3300025944 Ga0207661_10013560 Ga0207661_100135604 158
69 3300026035 Ga0207703_10000067 Ga0207703_1000006757 158
70 3300026041 Ga0207639_10015952 Ga0207639_100159523 158
71 3300028379 Ga0268266_10000023 Ga0268266_10000023386 158
72 3300041512 Ga0451853_3713106 Ga0451853_3713106_2962_3465 158
73 3300046694 Ga0495649_0000828 Ga0495649_0000828_3811_4326 158
74 3300048088 Ga0495602_0162065 Ga0495602_0162065_1214_1711 158
75 3300048903 Ga0496100_0000003 Ga0496100_0000003_352373_352888 158
76 3300048904 Ga0496101_0000003 Ga0496101_0000003_352373_352888 158
77 3300048907 Ga0496104_0000003 Ga0496104_0000003_128836_129348 158
78 3300048908 Ga0496105_0000031 Ga0496105_0000031_7873_8385 158
79 3300048909 Ga0496106_0000048 Ga0496106_0000048_7918_8433 158
80 3300048910 Ga0496107_0000008 Ga0496107_0000008_243433_243948 158
81 3300048911 Ga0496108_0000002 Ga0496108_0000002_216565_217077 158
82 3300048912 Ga0496109_0000001 Ga0496109_0000001_216527_217039 158
83 3300048916 Ga0496113_0080793 Ga0496113_0080793_1451_1954 158
84 3300049576 Ga0501040_0705626 Ga0501040_0705626_88_582 158
85 3300053077 Ga0495601_0000120 Ga0495601_0000120_206_709 158
86 3300005336 Ga0070680_100392538 Ga0070680_1003925382 159
87 3300005337 Ga0070682_100000029 Ga0070682_100000029143 159
88 3300005353 Ga0070669_100068368 Ga0070669_1000683682 159
89 3300005458 Ga0070681_10788110 Ga0070681_107881102 159
90 3300005530 Ga0070679_100000823 Ga0070679_10000082311 159
91 3300005614 Ga0068856_100618330 Ga0068856_1006183302 159
92 3300005719 Ga0068861_100096377 Ga0068861_1000963773 159
93 3300009098 Ga0105245_10000150 Ga0105245_1000015020 159
94 3300009101 Ga0105247_10000712 Ga0105247_1000071213 159
95 3300009176 Ga0105242_10164987 Ga0105242_101649872 159
96 3300009551 Ga0105238_10000240 Ga0105238_1000024031 159
97 3300009553 Ga0105249_10000095 Ga0105249_1000009517 159
98 3300013308 Ga0157375_10008069 Ga0157375_100080697 159
99 3300017792 Ga0163161_10000058 Ga0163161_1000005869 159
100 3300025900 Ga0207710_10000103 Ga0207710_1000010313 159
101 3300025912 Ga0207707_10023305 Ga0207707_100233056 159
102 3300025923 Ga0207681_10054746 Ga0207681_100547463 159
103 3300025924 Ga0207694_10000067 Ga0207694_1000006795 159
104 3300025927 Ga0207687_10000099 Ga0207687_1000009919 159
105 3300025961 Ga0207712_10000003 Ga0207712_10000003511 159
106 3300026078 Ga0207702_10009270 Ga0207702_100092706 159
107 3300026118 Ga0207675_100236769 Ga0207675_1002367693 159
108 3300028380 Ga0268265_10730674 Ga0268265_107306742 159
109 3300041491 Ga0451833_0776297 Ga0451833_0776297_27_539 159
110 3300046454 Ga0495592_0367192 Ga0495592_0367192_13_528 159
111 3300046455 Ga0495603_0002055 Ga0495603_0002055_10866_11390 159
112 3300046458 Ga0495591_062709 Ga0495591_062709_116_616 159
113 3300046461 Ga0495641_0000187 Ga0495641_0000187_44454_44960 159
114 3300046463 Ga0495653_0080445 Ga0495653_0080445_1713_2228 159
115 3300046473 Ga0495582_0000005 Ga0495582_0000005_133128_133643 159
116 3300046476 Ga0495662_0000022 Ga0495662_0000022_42474_42989 159
117 3300046511 Ga0495608_0000702 Ga0495608_0000702_12206_12721 159
118 3300046511 Ga0495608_0082218 Ga0495608_0082218_299_805 159
119 3300046516 Ga0495628_0002703 Ga0495628_0002703_7626_8141 159
120 3300046516 Ga0495628_0445075 Ga0495628_0445075_208_705 159
121 3300046533 Ga0495640_0018395 Ga0495640_0018395_1033_1548 159
122 3300046533 Ga0495640_0659139 Ga0495640_0659139_115_612 159
123 3300046642 Ga0495634_0182392 Ga0495634_0182392_286_801 159
124 3300046678 Ga0495599_0012575 Ga0495599_0012575_114_617 159
125 3300046683 Ga0495658_0000019 Ga0495658_0000019_22538_23053 159
126 3300046684 Ga0495669_0000163 Ga0495669_0000163_7928_8446 159
127 3300046689 Ga0495613_0000257 Ga0495613_0000257_12068_12583 159
128 3300046809 Ga0495600_0353859 Ga0495600_0353859_80_598 159
129 3300047319 Ga0495674_0000007 Ga0495674_0000007_18286_18783 159
130 3300047321 Ga0495676_0000091 Ga0495676_0000091_11159_11665 159
131 3300047322 Ga0495680_0320169 Ga0495680_0320169_105_617 159
132 3300048907 Ga0496104_0000063 Ga0496104_0000063_23747_24274 159
133 3300048908 Ga0496105_0000041 Ga0496105_0000041_92345_92872 159
134 3300048913 Ga0496110_0031609 Ga0496110_0031609_2040_2546 159
135 3300048917 Ga0496114_0017181 Ga0496114_0017181_4113_4619 159
136 3300048918 Ga0496115_0686450 Ga0496115_0686450_44_550 159
137 3300048922 Ga0496119_0007318 Ga0496119_0007318_9351_9878 159
138 3300048923 Ga0496120_0026756 Ga0496120_0026756_2669_3196 159
139 3300053078 Ga0495612_0001747 Ga0495612_0001747_5009_5527 159
140 3300053084 Ga0495595_0000109 Ga0495595_0000109_238_753 159
141 3300053123 Ga0500614_000177 Ga0500614_000177_12240_12746 159
142 3300001977 JGI24746J21847_1000969 JGI24746J21847_10009692 160
143 3300005329 Ga0070683_100134769 Ga0070683_1001347693 160
144 3300005438 Ga0070701_10584459 Ga0070701_105844591 160
145 3300005535 Ga0070684_100709685 Ga0070684_1007096852 160
146 3300006852 Ga0075433_10009223 Ga0075433_100092236 160
147 3300009098 Ga0105245_10959319 Ga0105245_109593192 160
148 3300011119 Ga0105246_10693554 Ga0105246_106935541 160
149 3300025916 Ga0207663_10011424 Ga0207663_100114243 160
150 3300026075 Ga0207708_10162864 Ga0207708_101628641 160
151 3300035725 Ga0373947_0847877 Ga0373947_0847877_45_560 160
152 3300036401 Ga0373937_0005645 Ga0373937_0005645_6575_7078 160
153 3300046454 Ga0495592_0417801 Ga0495592_0417801_239_751 160
154 3300046461 Ga0495641_0200953 Ga0495641_0200953_296_811 160
155 3300046462 Ga0495651_0239204 Ga0495651_0239204_182_700 160
156 3300046616 Ga0495668_0110988 Ga0495668_0110988_755_1273 160
157 3300046663 Ga0495635_0000106 Ga0495635_0000106_47395_47913 160
158 3300046674 Ga0495588_0116944 Ga0495588_0116944_384_902 160
159 3300046675 Ga0495657_0065503 Ga0495657_0065503_1160_1684 160
160 3300046683 Ga0495658_0147304 Ga0495658_0147304_71_553 160
161 3300046690 Ga0495624_0026298 Ga0495624_0026298_672_1193 160
162 3300046809 Ga0495600_0116204 Ga0495600_0116204_685_1188 160
163 3300046809 Ga0495600_0185168 Ga0495600_0185168_68_571 160
164 3300047321 Ga0495676_0922359 Ga0495676_0922359_13_528 160
165 3300047322 Ga0495680_0000023 Ga0495680_0000023_59086_59604 160
166 3300047322 Ga0495680_0110520 Ga0495680_0110520_528_1031 160
167 3300047469 Ga0495673_0068305 Ga0495673_0068305_763_1281 160
168 3300047471 Ga0495684_0418887 Ga0495684_0418887_363_881 160
169 3300047673 Ga0495593_0044691 Ga0495593_0044691_1482_1985 160
170 3300048088 Ga0495602_0024048 Ga0495602_0024048_297_812 160
171 3300048089 Ga0495614_0026726 Ga0495614_0026726_1440_1937 160
172 3300048907 Ga0496104_0434965 Ga0496104_0434965_347_916 160
173 3300048908 Ga0496105_0013957 Ga0496105_0013957_2291_2860 160
174 3300048911 Ga0496108_0313993 Ga0496108_0313993_101_604 160
175 3300048912 Ga0496109_0109589 Ga0496109_0109589_1888_2391 160
176 3300048913 Ga0496110_0300702 Ga0496110_0300702_677_1180 160
177 3300048914 Ga0496111_0033906 Ga0496111_0033906_1411_1914 160
178 3300048914 Ga0496111_0388561 Ga0496111_0388561_518_1009 160
179 3300048915 Ga0496112_0000002 Ga0496112_0000002_671745_672257 160
180 3300049568 Ga0501031_0239220 Ga0501031_0239220_498_1022 160
181 3300050515 nmdc:mga0a205_1249_c1 nmdc:mga0a205_1249_c1_1560_2045 160
182 3300053085 Ga0495619_0011820 Ga0495619_0011820_3711_4214 160
183 3300053085 Ga0495619_0148392 Ga0495619_0148392_383_886 160

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xf1-assembly1.cif.gz_B structure of c5a peptidase- a key virulence factor from streptococcus 0.7169 56 150
5xxz-assembly1.cif.gz_A crystal structure of a serine protease from streptococcus species 0.6821 47 148
3osv-assembly1.cif.gz_A the crytsal structure of flgd from p. aeruginosa 0.6753 66 140
6foa-assembly1.cif.gz_A human xylosyltransferase 1 apo structure 0.6687 66 132
6ejc-assembly1.cif.gz_A human xylosyltransferase 1 in complex with peptide qeeegsgvgqgg 0.6644 66 132
ID Description Score Start End Superfamily
af_Q6IE52_125_219_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.7219 33 151 2.60.40.1930
af_Q6IE52_125_219_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.7156 33 151 2.60.40.1930
af_A0A0R4ITJ9_559_652_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6783 33 151 2.60.40.10
af_Q8R422_128_225_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6687 39 151 2.60.40.1930
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6639 66 145 2.60.40.4070
ID Description Score Start End GO Terms
AF-A0A7W0UT15-F1-model_v4 N,N-dimethylformamidase beta subunit-like C-terminal domain-containing protein 0.8793 34 151
AF-A0A660YQB0-F1-model_v4 FlgD Ig-like domain-containing protein 0.875 56 149
AF-A0A661UHT1-F1-model_v4 T9SS type A sorting domain-containing protein 0.8719 66 149
AF-A0A496ZTL1-F1-model_v4 T9SS type A sorting domain-containing protein 0.8692 57 149
AF-A0A7D5T0Z8-F1-model_v4 FlgD Ig-like domain-containing protein 0.8649 56 148

Feature Viewer

pLDDT pTM Quality
85.38 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map