F280571

General Info

Members Datasets Scaffolds Average Seq Length
183 114 367 370

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000253|Ga0068860_10000025384
Length 409
Sequence MTAVRRGLGIAAVAAALVLSACTADDGNPSADPTGGPAPGGGSSATPTIEQNHTVPAPGPRQPGVVAPADIQVVGADTLDPDKVAAVDAIHGVTTLQLALSQSTIENRSYSVAAVDPGAYRTFTPLKYADFQDAWDRVAGGELALKERLTKQVPTDAKGYLRLGTAADAPTVHVGAYVQQQPLVDMVVNETWVKTLGMVPGNALLVRTGKKAPKEVAKQIREIFGDEASVTLVDKATRIGLQPGAKQIAVVTGSVADAVGVFRYTVLGGGHIAPDPAWVRDHITTEVVPILGAVTCNKLIFDQLKAALRDVIDQGLADKIHPDQYAGCYYPRFIAGTSTLSNHAFGLALDINAVENQRGTAGLIDRGVVAIFEKWGFTWGGDWHYTDPMHFEMNSIRTPAPESAAAKKK

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
53 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
92 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
93 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
94 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 2643221561 Nocardioides sp. Root151 Isolate Unclassified
111 2643221641 Nocardioides sp. Root122 Isolate Unclassified
112 2643221696 Nocardioides sp. Root140 Isolate Unclassified
113 2739367898 Nocardioides sp. CF479 Isolate Unclassified
114 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.55
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.66
Nodule 0.55
Rhizoplane 14.75
Rhizosphere 67.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100000253 3300005843 Bacteria 79802
2 JGI24740J21852_10021698 3300001979 Bacteria 2222
3 rootH1_10085543 3300003316 Bacteria 2165
4 rootH1_10085543 3300003323 Bacteria 1447
5 Ga0070658_10012373 3300005327 Bacteria 6851
6 Ga0070683_100128463 3300005329 Bacteria 2397
7 Ga0068869_100222330 3300005334 Bacteria 1497
8 Ga0068868_100259608 3300005338 Bacteria 1464
9 Ga0070660_100006504 3300005339 Bacteria 8106
10 Ga0070660_100211948 3300005339 Bacteria 1573
11 Ga0070692_10056628 3300005345 Bacteria 2053
12 Ga0070667_100078649 3300005367 Bacteria 2818
13 Ga0070678_100086523 3300005456 Bacteria 2391
14 Ga0070679_100010114 3300005530 Bacteria 8941
15 Ga0070684_100007235 3300005535 Bacteria 8625
16 Ga0070665_100001727 3300005548 Bacteria 24986
17 Ga0068857_100062642 3300005577 Bacteria 3306
18 Ga0068852_100199091 3300005616 Bacteria 1895
19 Ga0068864_100234458 3300005618 Bacteria 1698
20 Ga0075365_10004238 3300006038 Bacteria 7560
21 Ga0075365_10027537 3300006038 Bacteria 3618
22 Ga0075365_10068493 3300006038 Bacteria 2384
23 Ga0075365_10082295 3300006038 Bacteria 2182
24 Ga0075365_10100648 3300006038 Bacteria 1978
25 Ga0075365_10166819 3300006038 Bacteria 1536
26 Ga0075368_10012148 3300006042 Bacteria 3145
27 Ga0075363_100003605 3300006048 Bacteria 6629
28 Ga0075363_100018100 3300006048 Bacteria 3504
29 Ga0075363_100045208 3300006048 Bacteria 2335
30 Ga0075363_100057780 3300006048 Bacteria 2083
31 Ga0075364_10022453 3300006051 Bacteria 3985
32 Ga0075367_10003430 3300006178 Bacteria 7558
33 Ga0075367_10119116 3300006178 Bacteria 1626
34 Ga0075370_10079182 3300006353 Bacteria 1887
35 Ga0068865_100037877 3300006881 Bacteria 3260
36 Ga0105243_10292390 3300009148 Bacteria 1473
37 Ga0105249_10048388 3300009553 Bacteria 3876
38 Ga0105239_10007684 3300010375 Bacteria 12348
39 Ga0105246_10002197 3300011119 Bacteria 11771
40 Ga0157374_10266604 3300013296 Bacteria 1688
41 Ga0163162_10036776 3300013306 Bacteria 4882
42 Ga0157375_10112682 3300013308 Bacteria 2821
43 Ga0157379_10014367 3300014968 Bacteria 6947
44 Ga0206353_10291558 3300020082 Bacteria 3255
45 Ga0207688_10019614 3300025901 Bacteria 3686
46 Ga0207647_10005197 3300025904 Bacteria 9575
47 Ga0207657_10011855 3300025919 Bacteria 8629
48 Ga0207657_10207582 3300025919 Bacteria 1573
49 Ga0207659_10155104 3300025926 Bacteria 1792
50 Ga0207661_10070185 3300025944 Bacteria 2859
51 Ga0207658_10060872 3300025986 Bacteria 2819
52 Ga0207675_100016130 3300026118 Bacteria 6978
53 Ga0207675_100275454 3300026118 Bacteria 1634
54 Ga0207683_10127599 3300026121 Bacteria 2287
55 Ga0268266_10002459 3300028379 Bacteria 19815
56 Ga0268266_10089703 3300028379 Bacteria 2693
57 Ga0268264_10000220 3300028381 Bacteria 111692
58 Ga0307405_10094989 3300031731 Bacteria 1984
59 Ga0307413_10167547 3300031824 Bacteria 1551
60 Ga0307412_10117436 3300031911 Bacteria 1910
61 Ga0307409_100037192 3300031995 Bacteria 3587
62 Ga0307409_100329789 3300031995 Bacteria 1432
63 Ga0307416_100013794 3300032002 Bacteria 5507
64 Ga0307411_10029098 3300032005 Bacteria 3369
65 Ga0307415_100019056 3300032126 Bacteria 4158
66 Ga0307415_100025952 3300032126 Bacteria 3687
67 Ga0307415_100079269 3300032126 Bacteria 2339
68 Ga0436365_0799666 3300039437 Bacteria 1461
69 Ga0451791_1568508 3300041451 Bacteria 1171
70 Ga0451843_0235866 3300041509 Bacteria 1212
71 Ga0466965_0012136 3300044683 Bacteria 4047
72 Ga0466963_0081945 3300044694 Bacteria 2186
73 Ga0466963_0128162 3300044694 Bacteria 1751
74 Ga0466964_0068826 3300044706 Bacteria 1491
75 Ga0466964_0097496 3300044706 Bacteria 1290
76 Ga0466968_0029893 3300044735 Bacteria 2255
77 Ga0466970_0002772 3300044765 Bacteria 8455
78 Ga0466960_0000142 3300044901 Bacteria 24451
79 Ga0466958_0040624 3300045836 Bacteria 2796
80 Ga0466967_0222157 3300045976 Bacteria 1795
81 Ga0496101_0033483 3300048904 Bacteria 3624
82 Ga0496101_0181748 3300048904 Bacteria 1620
83 Ga0496102_0049349 3300048905 Bacteria 3829
84 Ga0496103_0015161 3300048906 Bacteria 4582
85 Ga0496103_0170219 3300048906 Bacteria 1399
86 Ga0496104_0077928 3300048907 Bacteria 3158
87 Ga0496105_0000226 3300048908 Bacteria 37984
88 Ga0496105_0027425 3300048908 Bacteria 4653
89 Ga0496106_0148465 3300048909 Bacteria 1848
90 Ga0496107_0032659 3300048910 Bacteria 3720
91 Ga0496108_0301180 3300048911 Bacteria 1396
92 Ga0496109_0001917 3300048912 Bacteria 17273
93 Ga0496109_0010268 3300048912 Bacteria 7995
94 Ga0496109_0035794 3300048912 Bacteria 4481
95 Ga0496109_0108270 3300048912 Bacteria 2583
96 Ga0496110_0032043 3300048913 Bacteria 4537
97 Ga0496110_0231200 3300048913 Bacteria 1682
98 Ga0496110_0271205 3300048913 Bacteria 1545
99 Ga0496111_0050378 3300048914 Bacteria 3004
100 Ga0496111_0109650 3300048914 Bacteria 2032
101 Ga0496114_0016773 3300048917 Bacteria 5905
102 Ga0496114_0049609 3300048917 Bacteria 3493
103 Ga0496114_0067991 3300048917 Bacteria 2990
104 Ga0496115_0001062 3300048918 Bacteria 19909
105 Ga0496115_0085667 3300048918 Bacteria 2570
106 Ga0496115_0139725 3300048918 Bacteria 1998
107 Ga0501031_0032636 3300049568 Bacteria 3395
108 Ga0501031_0078257 3300049568 Bacteria 2155
109 Ga0501032_0030930 3300049569 Bacteria 3672
110 Ga0501032_0139032 3300049569 Bacteria 1600
111 Ga0501033_0001464 3300049570 Bacteria 20930
112 Ga0501034_0074629 3300049571 Bacteria 3399
113 Ga0501034_0078117 3300049571 Bacteria 3315
114 Ga0501036_0017018 3300049572 Bacteria 6076
115 Ga0501036_0060796 3300049572 Bacteria 3200
116 Ga0501036_0080719 3300049572 Bacteria 2749
117 Ga0501037_0032345 3300049573 Bacteria 3862
118 Ga0501037_0161200 3300049573 Bacteria 1599
119 Ga0501038_0000962 3300049574 Bacteria 25777
120 Ga0501038_0010085 3300049574 Bacteria 8651
121 Ga0501038_0067677 3300049574 Bacteria 3038
122 Ga0501038_0209601 3300049574 Bacteria 1560
123 Ga0501039_0001625 3300049575 Bacteria 16560
124 Ga0501039_0018300 3300049575 Bacteria 5377
125 Ga0501039_0050800 3300049575 Bacteria 3208
126 Ga0501039_0221811 3300049575 Bacteria 1486
127 Ga0501040_0116122 3300049576 Bacteria 1875
128 Ga0501040_0139096 3300049576 Bacteria 1710
129 Ga0501041_0036726 3300049577 Bacteria 2968
130 Ga0501042_0020457 3300049578 Bacteria 4606
131 Ga0501042_0226375 3300049578 Bacteria 1349
132 Ga0501043_0045731 3300049579 Bacteria 3442
133 Ga0501046_0002276 3300049580 Bacteria 18102
134 Ga0501046_0006660 3300049580 Bacteria 10200
135 Ga0501047_0013659 3300049581 Bacteria 7707
136 Ga0501048_0011151 3300049582 Bacteria 6700
137 Ga0501048_0074173 3300049582 Bacteria 2401
138 Ga0501067_0000214 3300049583 Bacteria 32127
139 Ga0501067_0002645 3300049583 Bacteria 9921
140 Ga0501067_0027484 3300049583 Bacteria 3153
141 Ga0501068_0054285 3300049584 Bacteria 2427
142 Ga0501068_0127310 3300049584 Bacteria 1591
143 Ga0501069_0014641 3300049585 Bacteria 4195
144 Ga0501070_0005522 3300049586 Bacteria 10783
145 Ga0501070_0010576 3300049586 Bacteria 7799
146 Ga0501071_0005919 3300049587 Bacteria 7912
147 Ga0501072_0008184 3300049588 Bacteria 7939
148 Ga0501072_0051967 3300049588 Bacteria 3227
149 Ga0501073_0000962 3300049589 Bacteria 20736
150 Ga0501073_0044908 3300049589 Bacteria 3113
151 Ga0501073_0071499 3300049589 Bacteria 2417
152 Ga0501074_0000209 3300049590 Bacteria 32209
153 Ga0501074_0033290 3300049590 Bacteria 3735
154 Ga0501074_0045438 3300049590 Bacteria 3178
155 Ga0501077_0002278 3300049593 Bacteria 11562
156 Ga0501077_0048030 3300049593 Bacteria 2711
157 Ga0501079_0007369 3300049741 Bacteria 8321
158 Ga0501079_0011382 3300049741 Bacteria 6790
159 Ga0501079_0378667 3300049741 Bacteria 1110
160 Ga0501080_0002035 3300049742 Bacteria 17484
161 Ga0501080_0059111 3300049742 Bacteria 3568
162 Ga0501080_0112697 3300049742 Bacteria 2521
163 Ga0501080_0113083 3300049742 Bacteria 2517
164 Ga0501083_0008006 3300049744 Bacteria 7486
165 Ga0501083_0008253 3300049744 Bacteria 7363
166 Ga0501035_0042880 3300049822 Bacteria 4078
167 nmdc:mga03n38_4795_c1 3300050490 Bacteria 4528
168 nmdc:mga03n38_88297_c1 3300050490 Bacteria 1471
169 nmdc:mga00v17_30533_c1 3300050491 Bacteria 3172
170 nmdc:mga0yw44_1986_c1 3300050492 Bacteria 8488
171 nmdc:mga0yw44_284689_c1 3300050492 Bacteria 1105
172 nmdc:mga0yw44_6771_c1 3300050492 Bacteria 5568
173 nmdc:mga0yw44_76721_c1 3300050492 Bacteria 2086
174 nmdc:mga0yw44_99160_c1 3300050492 Bacteria 1853
175 nmdc:mga06z11_29545_c1 3300050494 Bacteria 2641
176 nmdc:mga07m45_88286_c1 3300050496 Bacteria 1774
177 Ga0501084_0133335 3300054114 Bacteria 2091
178 Ga0501082_0015925 3300060353 Bacteria 6467
179 Ga0501082_0067620 3300060353 Bacteria 3077
180 2643825137 2643221561 Bacteria 4984412
181 2644231821 2643221641 Bacteria 4490190
182 2644534559 2643221696 Bacteria 5431823
183 2740168805 2739367898 Bacteria 4367674
184 8054611723 8054609563 Bacteria 5170090
185 Ga0068860_100000253
186 JGI24740J21852_10021698
187 rootH1_10085543
188 Ga0070658_10012373
189 Ga0070683_100128463
190 Ga0068869_100222330
191 Ga0068868_100259608
192 Ga0070660_100006504
193 Ga0070660_100211948
194 Ga0070692_10056628
195 Ga0070667_100078649
196 Ga0070678_100086523
197 Ga0070679_100010114
198 Ga0070684_100007235
199 Ga0070665_100001727
200 Ga0068857_100062642
201 Ga0068852_100199091
202 Ga0068864_100234458
203 Ga0075365_10004238
204 Ga0075365_10027537
205 Ga0075365_10068493
206 Ga0075365_10082295
207 Ga0075365_10100648
208 Ga0075365_10166819
209 Ga0075368_10012148
210 Ga0075363_100003605
211 Ga0075363_100018100
212 Ga0075363_100045208
213 Ga0075363_100057780
214 Ga0075364_10022453
215 Ga0075367_10003430
216 Ga0075367_10119116
217 Ga0075370_10079182
218 Ga0068865_100037877
219 Ga0105243_10292390
220 Ga0105249_10048388
221 Ga0105239_10007684
222 Ga0105246_10002197
223 Ga0157374_10266604
224 Ga0163162_10036776
225 Ga0157375_10112682
226 Ga0157379_10014367
227 Ga0206353_10291558
228 Ga0207688_10019614
229 Ga0207647_10005197
230 Ga0207657_10011855
231 Ga0207657_10207582
232 Ga0207659_10155104
233 Ga0207661_10070185
234 Ga0207658_10060872
235 Ga0207675_100016130
236 Ga0207675_100275454
237 Ga0207683_10127599
238 Ga0268266_10002459
239 Ga0268266_10089703
240 Ga0268264_10000220
241 Ga0307405_10094989
242 Ga0307413_10167547
243 Ga0307412_10117436
244 Ga0307409_100037192
245 Ga0307409_100329789
246 Ga0307416_100013794
247 Ga0307411_10029098
248 Ga0307415_100019056
249 Ga0307415_100025952
250 Ga0307415_100079269
251 Ga0436365_0799666
252 Ga0451791_1568508
253 Ga0451843_0235866
254 Ga0466965_0012136
255 Ga0466963_0081945
256 Ga0466963_0128162
257 Ga0466964_0068826
258 Ga0466964_0097496
259 Ga0466968_0029893
260 Ga0466970_0002772
261 Ga0466960_0000142
262 Ga0466958_0040624
263 Ga0466967_0222157
264 Ga0496101_0033483
265 Ga0496101_0181748
266 Ga0496102_0049349
267 Ga0496103_0015161
268 Ga0496103_0170219
269 Ga0496104_0077928
270 Ga0496105_0000226
271 Ga0496105_0027425
272 Ga0496106_0148465
273 Ga0496107_0032659
274 Ga0496108_0301180
275 Ga0496109_0001917
276 Ga0496109_0010268
277 Ga0496109_0035794
278 Ga0496109_0108270
279 Ga0496110_0032043
280 Ga0496110_0231200
281 Ga0496110_0271205
282 Ga0496111_0050378
283 Ga0496111_0109650
284 Ga0496114_0016773
285 Ga0496114_0049609
286 Ga0496114_0067991
287 Ga0496115_0001062
288 Ga0496115_0085667
289 Ga0496115_0139725
290 Ga0501031_0032636
291 Ga0501031_0078257
292 Ga0501032_0030930
293 Ga0501032_0139032
294 Ga0501033_0001464
295 Ga0501034_0074629
296 Ga0501034_0078117
297 Ga0501036_0017018
298 Ga0501036_0060796
299 Ga0501036_0080719
300 Ga0501037_0032345
301 Ga0501037_0161200
302 Ga0501038_0000962
303 Ga0501038_0010085
304 Ga0501038_0067677
305 Ga0501038_0209601
306 Ga0501039_0001625
307 Ga0501039_0018300
308 Ga0501039_0050800
309 Ga0501039_0221811
310 Ga0501040_0116122
311 Ga0501040_0139096
312 Ga0501041_0036726
313 Ga0501042_0020457
314 Ga0501042_0226375
315 Ga0501043_0045731
316 Ga0501046_0002276
317 Ga0501046_0006660
318 Ga0501047_0013659
319 Ga0501048_0011151
320 Ga0501048_0074173
321 Ga0501067_0000214
322 Ga0501067_0002645
323 Ga0501067_0027484
324 Ga0501068_0054285
325 Ga0501068_0127310
326 Ga0501069_0014641
327 Ga0501070_0005522
328 Ga0501070_0010576
329 Ga0501071_0005919
330 Ga0501072_0008184
331 Ga0501072_0051967
332 Ga0501073_0000962
333 Ga0501073_0044908
334 Ga0501073_0071499
335 Ga0501074_0000209
336 Ga0501074_0033290
337 Ga0501074_0045438
338 Ga0501077_0002278
339 Ga0501077_0048030
340 Ga0501079_0007369
341 Ga0501079_0011382
342 Ga0501079_0378667
343 Ga0501080_0002035
344 Ga0501080_0059111
345 Ga0501080_0112697
346 Ga0501080_0113083
347 Ga0501083_0008006
348 Ga0501083_0008253
349 Ga0501035_0042880
350 nmdc:mga03n38_4795_c1
351 nmdc:mga03n38_88297_c1
352 nmdc:mga00v17_30533_c1
353 nmdc:mga0yw44_1986_c1
354 nmdc:mga0yw44_284689_c1
355 nmdc:mga0yw44_6771_c1
356 nmdc:mga0yw44_76721_c1
357 nmdc:mga0yw44_99160_c1
358 nmdc:mga06z11_29545_c1
359 nmdc:mga07m45_88286_c1
360 Ga0501084_0133335
361 Ga0501082_0015925
362 Ga0501082_0067620
363 2643825137
364 2644231821
365 2644534559
366 2740168805
367 8054611723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13539

Peptidase_M15_4

D-alanyl-D-alanine carboxypeptidase

335

393

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6514 13 176
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6505 13 178
7du7-assembly2.cif.gz_B crystal structure of the rationally designed mkdpbb_sym1 protein 0.6263 84 152
5e7p-assembly1.cif.gz_A crystal structure of msmeg_0858 (uniprot a0qqs4), a aaa atpase. 0.6164 87 152
7du6-assembly1.cif.gz_A crystal structure of the rationally designed mkdpbb_sym2 protein 0.6152 89 152
ID Description Score Start End Superfamily
3e0mA01 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.7076 15 52 3.30.1060.10
af_Q8I3L7_53_159_2.40.40.50 Mainly Beta;Beta Barrel;Barwin-like endoglucanases;Ubiquitin fusion degradation protein UFD1, N-terminal domain 0.6497 88 141 2.40.40.50
af_Q54XA2_1_100_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.6212 88 151 2.40.40.20
1cr5A01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.6091 85 152 2.40.40.20
af_Q9C5D3_71_143_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6077 145 177 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7K0ZZZ3-F1-model_v4 M15 family peptidase 0.9665 1 335 GO:0008233
AF-A0A7K0ZZZ3-F1-model_v4 M15 family peptidase 0.9637 1 335 GO:0008233
AF-A0A1I1P8B4-F1-model_v4 D-alanyl-D-alanine carboxypeptidase 0.9627 1 335 GO:0004180
AF-A0A1I1P8B4-F1-model_v4 D-alanyl-D-alanine carboxypeptidase 0.9599 1 335 GO:0004180
AF-A0A417Y6M3-F1-model_v4 M15 family peptidase 0.9582 1 335 GO:0008233

Map