F280287

General Info

Members Datasets Scaffolds Average Seq Length
183 120 366 172

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100676368|Ga0070670_1006763682
Length 196
Sequence VNVWVPFGTIVRVGVVIARRLRAFGANPTVLIIGLLIVSSIVVVLFAGLGKDPQHIDSPLIGKPAPPFALKSVNTGETIDLESLRGKPVIVNFWATWCVPCYEEHPTLVANARQLPNVQFIGVVFNDSEDKINRFLAERGSAYPTLLDANGKTAIAYGVGGVPETYFINPAGTIVAKFEGPLSTEQLQANLEKALR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.55
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100676368 3300005331 Bacteria 927
2 Ga0070658_10024607 3300005327 Bacteria 4829
3 Ga0070676_10831430 3300005328 Bacteria 683
4 Ga0070683_100002422 3300005329 Bacteria 14832
5 Ga0070690_100178048 3300005330 Bacteria 1468
6 Ga0070690_100934643 3300005330 Bacteria 680
7 Ga0070670_100000111 3300005331 Bacteria 76659
8 Ga0070670_100070867 3300005331 Unclassified 2992
9 Ga0070677_10022243 3300005333 Bacteria 2333
10 Ga0068869_100008946 3300005334 Bacteria 6482
11 Ga0070682_100000036 3300005337 Bacteria 149965
12 Ga0070682_100499953 3300005337 Unclassified 942
13 Ga0068868_100000232 3300005338 Bacteria 38001
14 Ga0068868_100000654 3300005338 Bacteria 23327
15 Ga0070689_100001510 3300005340 Bacteria 14849
16 Ga0070689_100211353 3300005340 Bacteria 1588
17 Ga0070689_100639946 3300005340 Bacteria 924
18 Ga0070689_100769434 3300005340 Bacteria 845
19 Ga0070687_100021423 3300005343 Bacteria 3038
20 Ga0070692_10013907 3300005345 Bacteria 3762
21 Ga0070675_100000026 3300005354 Bacteria 113553
22 Ga0070675_100488704 3300005354 Bacteria 1108
23 Ga0070713_100002691 3300005436 Bacteria 11594
24 Ga0070701_10003399 3300005438 Bacteria 6288
25 Ga0070705_100121485 3300005440 Bacteria 1687
26 Ga0070700_100000050 3300005441 Bacteria 88421
27 Ga0070708_100055122 3300005445 Bacteria 3534
28 Ga0070708_100730941 3300005445 Bacteria 931
29 Ga0070708_100834372 3300005445 Bacteria 866
30 Ga0070678_100602083 3300005456 Bacteria 981
31 Ga0068867_100129005 3300005459 Bacteria 1963
32 Ga0070685_10205938 3300005466 Bacteria 1281
33 Ga0070706_100022372 3300005467 Bacteria 5821
34 Ga0070707_100005825 3300005468 Bacteria 11493
35 Ga0070707_100045649 3300005468 Bacteria 4193
36 Ga0070707_100215055 3300005468 Bacteria 1873
37 Ga0070707_100709700 3300005468 Bacteria 969
38 Ga0070707_101322710 3300005468 Bacteria 687
39 Ga0070698_100082191 3300005471 Bacteria 3214
40 Ga0070698_100098348 3300005471 Bacteria 2900
41 Ga0070698_100159523 3300005471 Bacteria 2200
42 Ga0070698_100215615 3300005471 Bacteria 1854
43 Ga0070698_100320026 3300005471 Bacteria 1482
44 Ga0070698_100443436 3300005471 Bacteria 1233
45 Ga0070698_101571479 3300005471 Unclassified 610
46 Ga0070699_100016341 3300005518 Bacteria 6373
47 Ga0070699_100423227 3300005518 Bacteria 1205
48 Ga0070699_101460900 3300005518 Unclassified 627
49 Ga0070684_100005148 3300005535 Bacteria 9998
50 Ga0070697_100166727 3300005536 Bacteria 1863
51 Ga0068853_100087786 3300005539 Bacteria 2729
52 Ga0068853_100448470 3300005539 Bacteria 1213
53 Ga0070672_100001927 3300005543 Bacteria 13028
54 Ga0070672_100557538 3300005543 Bacteria 995
55 Ga0070686_100125449 3300005544 Bacteria 1768
56 Ga0070686_100460957 3300005544 Bacteria 979
57 Ga0070696_100067160 3300005546 Unclassified 2516
58 Ga0070664_101046895 3300005564 Bacteria 768
59 Ga0068857_100025053 3300005577 Bacteria 5255
60 Ga0068854_100170544 3300005578 Bacteria 1693
61 Ga0068864_100000349 3300005618 Bacteria 40495
62 Ga0068851_10160760 3300005834 Bacteria 1234
63 Ga0068851_10204144 3300005834 Bacteria 1104
64 Ga0068870_10062996 3300005840 Bacteria 1999
65 Ga0068858_100000660 3300005842 Bacteria 36058
66 Ga0068858_100264038 3300005842 Bacteria 1637
67 Ga0070717_10000064 3300006028 Bacteria 89273
68 Ga0070717_10326427 3300006028 Bacteria 1368
69 Ga0070717_10954744 3300006028 Unclassified 781
70 Ga0097621_100182095 3300006237 Unclassified 1816
71 Ga0097621_101504443 3300006237 Bacteria 639
72 Ga0075428_100010975 3300006844 Bacteria 10075
73 Ga0075431_100003149 3300006847 Bacteria 15948
74 Ga0075431_100458104 3300006847 Bacteria 1270
75 Ga0075434_100198321 3300006871 Bacteria 2027
76 Ga0075434_100904910 3300006871 Bacteria 897
77 Ga0075429_100020365 3300006880 Bacteria 5754
78 Ga0075429_100169717 3300006880 Bacteria 1911
79 Ga0068865_100090744 3300006881 Bacteria 2216
80 Ga0075436_100001925 3300006914 Bacteria 14260
81 Ga0075435_100000385 3300007076 Bacteria 26933
82 Ga0105244_10013705 3300009036 Bacteria 4720
83 Ga0105240_10080696 3300009093 Bacteria 4000
84 Ga0111539_10000022 3300009094 Bacteria 240838
85 Ga0105245_10000052 3300009098 Bacteria 126402
86 Ga0105245_10000197 3300009098 Bacteria 57534
87 Ga0105245_10257873 3300009098 Bacteria 1696
88 Ga0105245_10399244 3300009098 Bacteria 1373
89 Ga0105245_10731918 3300009098 Bacteria 1024
90 Ga0114129_10546016 3300009147 Bacteria 1508
91 Ga0114129_11480669 3300009147 Bacteria 835
92 Ga0105248_10662624 3300009177 Unclassified 1177
93 Ga0105238_10000002 3300009551 Bacteria 772711
94 Ga0157369_10000626 3300013105 Bacteria 45888
95 Ga0157374_10000005 3300013296 Bacteria 646767
96 Ga0157378_10000241 3300013297 Bacteria 53256
97 Ga0157378_10000271 3300013297 Bacteria 50385
98 Ga0157378_10509976 3300013297 Bacteria 1203
99 Ga0163162_10024460 3300013306 Bacteria 5962
100 Ga0157375_10000029 3300013308 Bacteria 199310
101 Ga0157375_10000055 3300013308 Bacteria 126704
102 Ga0157375_10000396 3300013308 Bacteria 39655
103 Ga0157380_10174927 3300014326 Bacteria 1880
104 Ga0157377_10000001 3300014745 Bacteria 623098
105 Ga0157377_10000129 3300014745 Bacteria 48882
106 Ga0157377_10241462 3300014745 Bacteria 1166
107 Ga0157376_10000003 3300014969 Bacteria 568634
108 Ga0213874_10177099 3300021377 Bacteria 757
109 Ga0213876_10000009 3300021384 Bacteria 496136
110 Ga0213876_10017947 3300021384 Bacteria 3733
111 Ga0207656_10480730 3300025321 Bacteria 629
112 Ga0207655_1055641 3300025728 Bacteria 1565
113 Ga0207699_10692831 3300025906 Bacteria 745
114 Ga0207645_10134144 3300025907 Bacteria 1612
115 Ga0207645_10645411 3300025907 Bacteria 719
116 Ga0207643_10043385 3300025908 Bacteria 2538
117 Ga0207705_10054374 3300025909 Bacteria 2886
118 Ga0207684_10021287 3300025910 Bacteria 5537
119 Ga0207684_10130464 3300025910 Unclassified 2157
120 Ga0207695_10062705 3300025913 Bacteria 3836
121 Ga0207662_10035742 3300025918 Bacteria 2903
122 Ga0207646_10034707 3300025922 Bacteria 4559
123 Ga0207646_10351194 3300025922 Bacteria 1333
124 Ga0207646_10368950 3300025922 Bacteria 1297
125 Ga0207646_10777593 3300025922 Unclassified 853
126 Ga0207694_10000001 3300025924 Bacteria 4078485
127 Ga0207650_10000114 3300025925 Bacteria 105111
128 Ga0207650_10052251 3300025925 Unclassified 3027
129 Ga0207659_10000002 3300025926 Bacteria 619441
130 Ga0207659_10318269 3300025926 Unclassified 1283
131 Ga0207687_10000005 3300025927 Bacteria 770649
132 Ga0207687_10004692 3300025927 Bacteria 9091
133 Ga0207687_11104551 3300025927 Bacteria 681
134 Ga0207700_10001461 3300025928 Bacteria 13412
135 Ga0207644_10050615 3300025931 Bacteria 2979
136 Ga0207670_10001008 3300025936 Bacteria 14874
137 Ga0207704_10050957 3300025938 Bacteria 2500
138 Ga0207665_10034028 3300025939 Bacteria 3381
139 Ga0207691_10005275 3300025940 Bacteria 12477
140 Ga0207711_10612963 3300025941 Bacteria 1016
141 Ga0207689_10004372 3300025942 Bacteria 12862
142 Ga0207661_10000006 3300025944 Bacteria 537727
143 Ga0207640_10006506 3300025981 Bacteria 6416
144 Ga0207640_10438160 3300025981 Bacteria 1074
145 Ga0207677_10000101 3300026023 Bacteria 70739
146 Ga0207677_10000141 3300026023 Bacteria 59003
147 Ga0207703_10000431 3300026035 Bacteria 44157
148 Ga0207639_10000118 3300026041 Bacteria 60793
149 Ga0207639_10512250 3300026041 Unclassified 1098
150 Ga0207708_10000041 3300026075 Bacteria 126142
151 Ga0207648_10732983 3300026089 Bacteria 917
152 Ga0207648_11009760 3300026089 Bacteria 779
153 Ga0207676_10000023 3300026095 Bacteria 266848
154 Ga0207674_10024839 3300026116 Bacteria 6396
155 Ga0207428_10000030 3300027907 Bacteria 240846
156 Ga0307511_10001419 3300030521 Bacteria 25268
157 Ga0307516_10815582 3300031730 Unclassified 595
158 Ga0307409_102057224 3300031995 Bacteria 601
159 Ga0307416_101611746 3300032002 Unclassified 754
160 Ga0373932_0000721 3300035112 Bacteria 9963
161 Ga0373943_0032593 3300035170 Bacteria 2478
162 Ga0373947_0167291 3300035725 Bacteria 1425
163 Ga0436365_0532810 3300039437 Bacteria 21559
164 Ga0436365_0821274 3300039437 Bacteria 598
165 Ga0436365_0982586 3300039437 Bacteria 715
166 Ga0436365_1703283 3300039437 Bacteria 22585
167 Ga0436362_1167445 3300039453 Bacteria 17138
168 Ga0451839_0372416 3300041496 Bacteria 2427
169 Ga0451577_0106130 3300042876 Bacteria 2511
170 Ga0453683_0094713 3300044673 Bacteria 1873
171 Ga0495621_0101282 3300046539 Bacteria 1096
172 Ga0495679_012163 3300047446 Bacteria 3286
173 Ga0496112_1060643 3300048915 Bacteria 729
174 Ga0501074_0294574 3300049590 Bacteria 1153
175 nmdc:mga05p37_249326_c1 3300050507 Bacteria 2130
176 nmdc:mga05p37_957054_c1 3300050507 Bacteria 915
177 nmdc:mga09592_13940_c1 3300050508 Bacteria 6565
178 nmdc:mga06r32_3799_c1 3300050510 Bacteria 13520
179 nmdc:mga08y16_24_c1 3300050511 Bacteria 240846
180 nmdc:mga0n895_217393_c1 3300050512 Bacteria 1940
181 nmdc:mga0rr50_88_c1 3300050513 Bacteria 52121
182 nmdc:mga08x19_1078_c1 3300050514 Bacteria 17009
183 Ga0495655_0000088 3300053083 Bacteria 17531
184 Ga0070670_100676368
185 Ga0070658_10024607
186 Ga0070676_10831430
187 Ga0070683_100002422
188 Ga0070690_100178048
189 Ga0070690_100934643
190 Ga0070670_100000111
191 Ga0070670_100070867
192 Ga0070677_10022243
193 Ga0068869_100008946
194 Ga0070682_100000036
195 Ga0070682_100499953
196 Ga0068868_100000232
197 Ga0068868_100000654
198 Ga0070689_100001510
199 Ga0070689_100211353
200 Ga0070689_100639946
201 Ga0070689_100769434
202 Ga0070687_100021423
203 Ga0070692_10013907
204 Ga0070675_100000026
205 Ga0070675_100488704
206 Ga0070713_100002691
207 Ga0070701_10003399
208 Ga0070705_100121485
209 Ga0070700_100000050
210 Ga0070708_100055122
211 Ga0070708_100730941
212 Ga0070708_100834372
213 Ga0070678_100602083
214 Ga0068867_100129005
215 Ga0070685_10205938
216 Ga0070706_100022372
217 Ga0070707_100005825
218 Ga0070707_100045649
219 Ga0070707_100215055
220 Ga0070707_100709700
221 Ga0070707_101322710
222 Ga0070698_100082191
223 Ga0070698_100098348
224 Ga0070698_100159523
225 Ga0070698_100215615
226 Ga0070698_100320026
227 Ga0070698_100443436
228 Ga0070698_101571479
229 Ga0070699_100016341
230 Ga0070699_100423227
231 Ga0070699_101460900
232 Ga0070684_100005148
233 Ga0070697_100166727
234 Ga0068853_100087786
235 Ga0068853_100448470
236 Ga0070672_100001927
237 Ga0070672_100557538
238 Ga0070686_100125449
239 Ga0070686_100460957
240 Ga0070696_100067160
241 Ga0070664_101046895
242 Ga0068857_100025053
243 Ga0068854_100170544
244 Ga0068864_100000349
245 Ga0068851_10160760
246 Ga0068851_10204144
247 Ga0068870_10062996
248 Ga0068858_100000660
249 Ga0068858_100264038
250 Ga0070717_10000064
251 Ga0070717_10326427
252 Ga0070717_10954744
253 Ga0097621_100182095
254 Ga0097621_101504443
255 Ga0075428_100010975
256 Ga0075431_100003149
257 Ga0075431_100458104
258 Ga0075434_100198321
259 Ga0075434_100904910
260 Ga0075429_100020365
261 Ga0075429_100169717
262 Ga0068865_100090744
263 Ga0075436_100001925
264 Ga0075435_100000385
265 Ga0105244_10013705
266 Ga0105240_10080696
267 Ga0111539_10000022
268 Ga0105245_10000052
269 Ga0105245_10000197
270 Ga0105245_10257873
271 Ga0105245_10399244
272 Ga0105245_10731918
273 Ga0114129_10546016
274 Ga0114129_11480669
275 Ga0105248_10662624
276 Ga0105238_10000002
277 Ga0157369_10000626
278 Ga0157374_10000005
279 Ga0157378_10000241
280 Ga0157378_10000271
281 Ga0157378_10509976
282 Ga0163162_10024460
283 Ga0157375_10000029
284 Ga0157375_10000055
285 Ga0157375_10000396
286 Ga0157380_10174927
287 Ga0157377_10000001
288 Ga0157377_10000129
289 Ga0157377_10241462
290 Ga0157376_10000003
291 Ga0213874_10177099
292 Ga0213876_10000009
293 Ga0213876_10017947
294 Ga0207656_10480730
295 Ga0207655_1055641
296 Ga0207699_10692831
297 Ga0207645_10134144
298 Ga0207645_10645411
299 Ga0207643_10043385
300 Ga0207705_10054374
301 Ga0207684_10021287
302 Ga0207684_10130464
303 Ga0207695_10062705
304 Ga0207662_10035742
305 Ga0207646_10034707
306 Ga0207646_10351194
307 Ga0207646_10368950
308 Ga0207646_10777593
309 Ga0207694_10000001
310 Ga0207650_10000114
311 Ga0207650_10052251
312 Ga0207659_10000002
313 Ga0207659_10318269
314 Ga0207687_10000005
315 Ga0207687_10004692
316 Ga0207687_11104551
317 Ga0207700_10001461
318 Ga0207644_10050615
319 Ga0207670_10001008
320 Ga0207704_10050957
321 Ga0207665_10034028
322 Ga0207691_10005275
323 Ga0207711_10612963
324 Ga0207689_10004372
325 Ga0207661_10000006
326 Ga0207640_10006506
327 Ga0207640_10438160
328 Ga0207677_10000101
329 Ga0207677_10000141
330 Ga0207703_10000431
331 Ga0207639_10000118
332 Ga0207639_10512250
333 Ga0207708_10000041
334 Ga0207648_10732983
335 Ga0207648_11009760
336 Ga0207676_10000023
337 Ga0207674_10024839
338 Ga0207428_10000030
339 Ga0307511_10001419
340 Ga0307516_10815582
341 Ga0307409_102057224
342 Ga0307416_101611746
343 Ga0373932_0000721
344 Ga0373943_0032593
345 Ga0373947_0167291
346 Ga0436365_0532810
347 Ga0436365_0821274
348 Ga0436365_0982586
349 Ga0436365_1703283
350 Ga0436362_1167445
351 Ga0451839_0372416
352 Ga0451577_0106130
353 Ga0453683_0094713
354 Ga0495621_0101282
355 Ga0495679_012163
356 Ga0496112_1060643
357 Ga0501074_0294574
358 nmdc:mga05p37_249326_c1
359 nmdc:mga05p37_957054_c1
360 nmdc:mga09592_13940_c1
361 nmdc:mga06r32_3799_c1
362 nmdc:mga08y16_24_c1
363 nmdc:mga0n895_217393_c1
364 nmdc:mga0rr50_88_c1
365 nmdc:mga08x19_1078_c1
366 Ga0495655_0000088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

86

174

0.96

PF00578

AhpC-TSA

AhpC/TSA family

61

177

0.95

PF08534

Redoxin

Redoxin

60

195

0.93

PF13098

Thioredoxin_2

Thioredoxin-like domain

83

191

0.82

PF00085

Thioredoxin

Thioredoxin

77

147

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.9614 36 165
2h1b-assembly2.cif.gz_B resa e80q 0.9569 35 165
2h1a-assembly1.cif.gz_A resa c74a variant 0.955 36 165
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.9532 36 165
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.9529 36 165
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9628 35 165 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9353 41 167 3.40.30.10
2yp6D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9324 34 166 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9178 29 150 3.40.30.10
af_I6YGW6_98_222_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9169 45 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A535WHR5-F1-model_v4 Redoxin domain-containing protein 0.9787 33 167 GO:0016209
GO:0016491
GO:0046872
AF-A0A536A096-F1-model_v4 TlpA family protein disulfide reductase 0.9749 29 165 GO:0016209
GO:0016491
AF-A0A7V9RWV8-F1-model_v4 TlpA family protein disulfide reductase 0.9737 37 167 GO:0016209
GO:0016491
AF-A0A538U7K3-F1-model_v4 TlpA family protein disulfide reductase 0.9734 32 167 GO:0016209
GO:0016491
AF-A0A2V7HQ72-F1-model_v4 Thioredoxin domain-containing protein 0.9726 33 164 GO:0016209
GO:0016491

Map