F279623

General Info

Members Datasets Scaffolds Average Seq Length
182 120 364 284

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0016003|Ga0466957_0016003_3286_4137
Length 283
Sequence MPPMPPMLKAALPVVPGVNRLPGVRKTGGDLPELTLTRHDVAIEAGHVAAYASLCGFPLKDTLPLPYPHLLAFGLHMQLMTDRSFPFPAIGTVHVGNTITQHRPIRLDERLQVVARAENLRPHPKGRVFDVVTTVHSRGELVWEETSAFLRRGSGDASAGSAERVAFPDAPPTGAVWKLSGNLGRRYAAVSGDHNPIHLHPLTAKAFGFPRHIAHGMWSMARCVGALENRLGDAVRVDVAFKKPILLPGKVAFGSRRLDDGYAFSLTSPGSGAPHLSGVTRDL

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
81 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
82 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
114 2643221615 Nocardioides sp. Root224 Isolate Unclassified
115 2643221641 Nocardioides sp. Root122 Isolate Unclassified
116 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
117 2739367898 Nocardioides sp. CF479 Isolate Unclassified
118 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
119 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
120 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 1.1
Bulb 0
Endosphere 25.27
Nodule 0.55
Rhizoplane 4.95
Rhizosphere 64.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0016003 3300044842 Bacteria 4382
2 rootH1_10012611 3300003316 Bacteria 1214
3 rootL2_10084214 3300003322 Bacteria 1630
4 Ga0070658_10035528 3300005327 Bacteria 4015
5 Ga0070683_100005822 3300005329 Bacteria 10314
6 Ga0070680_100083028 3300005336 Bacteria 2645
7 Ga0068868_100117381 3300005338 Bacteria 2168
8 Ga0070687_100211023 3300005343 Bacteria 1183
9 Ga0070661_100190282 3300005344 Bacteria 1565
10 Ga0070692_10088998 3300005345 Bacteria 1675
11 Ga0070659_100016822 3300005366 Bacteria 5495
12 Ga0070667_100099599 3300005367 Bacteria 2509
13 Ga0070678_100030062 3300005456 Bacteria 3729
14 Ga0070679_100022498 3300005530 Bacteria 6161
15 Ga0070679_100461582 3300005530 Bacteria 1215
16 Ga0070679_100570911 3300005530 Bacteria 1075
17 Ga0070684_100074255 3300005535 Bacteria 2997
18 Ga0070684_100136530 3300005535 Bacteria 2216
19 Ga0070684_100483687 3300005535 Bacteria 1146
20 Ga0070686_100197778 3300005544 Bacteria 1439
21 Ga0070665_100000273 3300005548 Bacteria 84592
22 Ga0070665_100254201 3300005548 Bacteria 1758
23 Ga0068855_100388197 3300005563 Bacteria 1532
24 Ga0070664_100107107 3300005564 Bacteria 2436
25 Ga0068857_100028359 3300005577 Bacteria 4940
26 Ga0068864_100028623 3300005618 Bacteria 4712
27 Ga0068858_100263070 3300005842 Bacteria 1640
28 Ga0068860_100000334 3300005843 Bacteria 63958
29 Ga0081539_10043441 3300005985 Bacteria 2605
30 Ga0075365_10000543 3300006038 Bacteria 14519
31 Ga0075365_10001497 3300006038 Bacteria 10659
32 Ga0075365_10024624 3300006038 Bacteria 3799
33 Ga0075365_10026596 3300006038 Bacteria 3675
34 Ga0075365_10034048 3300006038 Bacteria 3288
35 Ga0075365_10037202 3300006038 Bacteria 3158
36 Ga0075365_10091284 3300006038 Bacteria 2075
37 Ga0075365_10096043 3300006038 Bacteria 2025
38 Ga0075365_10150891 3300006038 Bacteria 1616
39 Ga0075365_10216482 3300006038 Bacteria 1343
40 Ga0075365_10217077 3300006038 Bacteria 1341
41 Ga0075368_10000592 3300006042 Bacteria 10936
42 Ga0075368_10004219 3300006042 Bacteria 4849
43 Ga0075363_100014149 3300006048 Bacteria 3889
44 Ga0075363_100017066 3300006048 Bacteria 3594
45 Ga0075363_100047990 3300006048 Bacteria 2269
46 Ga0075363_100137535 3300006048 Bacteria 1374
47 Ga0075364_10021258 3300006051 Bacteria 4088
48 Ga0075364_10035911 3300006051 Bacteria 3203
49 Ga0075364_10041086 3300006051 Bacteria 3001
50 Ga0075364_10091196 3300006051 Bacteria 2021
51 Ga0075367_10023585 3300006178 Bacteria 3464
52 Ga0075367_10038332 3300006178 Bacteria 2790
53 Ga0075367_10043737 3300006178 Bacteria 2623
54 Ga0075367_10096353 3300006178 Bacteria 1804
55 Ga0075370_10024859 3300006353 Bacteria 3311
56 Ga0075370_10038058 3300006353 Bacteria 2707
57 Ga0068871_100522341 3300006358 Bacteria 1072
58 Ga0105245_10013520 3300009098 Bacteria 7107
59 Ga0105242_10087701 3300009176 Bacteria 2613
60 Ga0105239_10052968 3300010375 Bacteria 4451
61 Ga0105246_10010166 3300011119 Bacteria 5810
62 Ga0157369_10243109 3300013105 Bacteria 1880
63 Ga0163162_10016809 3300013306 Bacteria 7151
64 Ga0157372_10059032 3300013307 Bacteria 4290
65 Ga0157372_10065647 3300013307 Bacteria 4076
66 Ga0157375_10146419 3300013308 Bacteria 2493
67 Ga0157379_10071066 3300014968 Bacteria 3114
68 Ga0163161_10213727 3300017792 Bacteria 1491
69 Ga0207688_10007226 3300025901 Bacteria 6042
70 Ga0207647_10017813 3300025904 Bacteria 4820
71 Ga0207705_10018059 3300025909 Bacteria 5044
72 Ga0207662_10240852 3300025918 Bacteria 1184
73 Ga0207657_10003212 3300025919 Bacteria 17497
74 Ga0207657_10034245 3300025919 Bacteria 4570
75 Ga0207652_10331368 3300025921 Bacteria 1374
76 Ga0207652_10606495 3300025921 Bacteria 981
77 Ga0207690_10013295 3300025932 Bacteria 4944
78 Ga0207686_10087820 3300025934 Bacteria 2046
79 Ga0207704_10024202 3300025938 Bacteria 3289
80 Ga0207689_10112030 3300025942 Bacteria 2243
81 Ga0207661_10245939 3300025944 Bacteria 1588
82 Ga0207679_10136330 3300025945 Bacteria 1977
83 Ga0207679_10259631 3300025945 Bacteria 1481
84 Ga0207658_10029623 3300025986 Bacteria 3869
85 Ga0207658_10068428 3300025986 Bacteria 2679
86 Ga0207702_10210055 3300026078 Bacteria 1809
87 Ga0207676_10215609 3300026095 Bacteria 1706
88 Ga0207674_10010129 3300026116 Bacteria 10718
89 Ga0207675_100019913 3300026118 Bacteria 6262
90 Ga0207683_10041819 3300026121 Bacteria 4002
91 Ga0209813_10001346 3300027866 Bacteria 5507
92 Ga0268266_10002137 3300028379 Bacteria 21775
93 Ga0268264_10000417 3300028381 Bacteria 60164
94 Ga0268264_10274780 3300028381 Bacteria 1575
95 Ga0307405_10117373 3300031731 Bacteria 1814
96 Ga0307407_10445442 3300031903 Bacteria 939
97 Ga0307409_100010040 3300031995 Bacteria 5856
98 Ga0307409_100117433 3300031995 Bacteria 2245
99 Ga0307409_100157718 3300031995 Bacteria 1980
100 Ga0307416_100069412 3300032002 Bacteria 2916
101 Ga0307416_100317843 3300032002 Bacteria 1557
102 Ga0307411_10165242 3300032005 Bacteria 1663
103 Ga0307415_100027351 3300032126 Bacteria 3612
104 Ga0307415_100223294 3300032126 Bacteria 1512
105 Ga0450907_007338 3300042146 Bacteria 1842
106 Ga0466965_0032434 3300044683 Bacteria 2551
107 Ga0466961_0310183 3300044693 Bacteria 963
108 Ga0466963_0006599 3300044694 Bacteria 6882
109 Ga0466964_0016914 3300044706 Bacteria 2788
110 Ga0466960_0095328 3300044901 Bacteria 1523
111 Ga0466958_0039505 3300045836 Bacteria 2836
112 Ga0495658_0036602 3300046683 Bacteria 2709
113 Ga0496103_0019044 3300048906 Bacteria 4122
114 Ga0496106_0191820 3300048909 Bacteria 1625
115 Ga0496106_0280591 3300048909 Bacteria 1335
116 Ga0496107_0100723 3300048910 Bacteria 2118
117 Ga0496109_0022746 3300048912 Bacteria 5554
118 Ga0496109_0132756 3300048912 Bacteria 2325
119 Ga0496110_0104082 3300048913 Bacteria 2546
120 Ga0496111_0089657 3300048914 Bacteria 2252
121 Ga0496114_0007926 3300048917 Bacteria 8406
122 Ga0501031_0063567 3300049568 Bacteria 2404
123 Ga0501032_0003539 3300049569 Bacteria 11917
124 Ga0501032_0202813 3300049569 Bacteria 1294
125 Ga0501033_0009971 3300049570 Bacteria 7294
126 Ga0501034_0418497 3300049571 Bacteria 1261
127 Ga0501034_0521431 3300049571 Bacteria 1100
128 Ga0501036_0005447 3300049572 Bacteria 10311
129 Ga0501036_0089302 3300049572 Bacteria 2604
130 Ga0501037_0001474 3300049573 Bacteria 17236
131 Ga0501037_0117799 3300049573 Bacteria 1911
132 Ga0501038_0005127 3300049574 Bacteria 12169
133 Ga0501039_0010398 3300049575 Bacteria 7092
134 Ga0501039_0112089 3300049575 Bacteria 2132
135 Ga0501039_0154419 3300049575 Bacteria 1803
136 Ga0501042_0010410 3300049578 Bacteria 6236
137 Ga0501043_0001478 3300049579 Bacteria 20554
138 Ga0501046_0000617 3300049580 Bacteria 34979
139 Ga0501046_0002401 3300049580 Bacteria 17573
140 Ga0501046_0131871 3300049580 Bacteria 1895
141 Ga0501047_0093697 3300049581 Bacteria 2882
142 Ga0501048_0012557 3300049582 Bacteria 6301
143 Ga0501067_0102466 3300049583 Bacteria 1590
144 Ga0501069_0073791 3300049585 Bacteria 1914
145 Ga0501070_0018939 3300049586 Bacteria 5774
146 Ga0501070_0257170 3300049586 Bacteria 1428
147 Ga0501072_0313817 3300049588 Bacteria 1246
148 Ga0501073_0031366 3300049589 Bacteria 3792
149 Ga0501073_0087372 3300049589 Bacteria 2168
150 Ga0501074_0029203 3300049590 Bacteria 3994
151 Ga0501075_0069999 3300049591 Bacteria 2652
152 Ga0501035_0014912 3300049822 Bacteria 7170
153 Ga0501035_0179816 3300049822 Bacteria 1823
154 Ga0501044_0031491 3300049823 Bacteria 5582
155 nmdc:mga03n38_76541_c1 3300050490 Bacteria 1562
156 nmdc:mga00v17_48981_c1 3300050491 Bacteria 2562
157 nmdc:mga00v17_51939_c1 3300050491 Bacteria 2493
158 nmdc:mga0yw44_120841_c1 3300050492 Bacteria 1687
159 nmdc:mga0yw44_130445_c1 3300050492 Bacteria 1627
160 nmdc:mga0yw44_205181_c1 3300050492 Bacteria 1303
161 nmdc:mga0yw44_217647_c1 3300050492 Bacteria 1265
162 nmdc:mga0yw44_266056_c1 3300050492 Bacteria 1144
163 nmdc:mga0yw44_364932_c1 3300050492 Bacteria 974
164 nmdc:mga0yw44_38041_c1 3300050492 Bacteria 2844
165 nmdc:mga0yw44_82797_c1 3300050492 Bacteria 2014
166 nmdc:mga0yw44_83401_c1 3300050492 Bacteria 2008
167 nmdc:mga06z11_20870_c1 3300050494 Bacteria 3034
168 nmdc:mga06z11_24005_c1 3300050494 Bacteria 2872
169 nmdc:mga06z11_97243_c1 3300050494 Bacteria 1609
170 nmdc:mga04h51_5375_c1 3300050495 Bacteria 3262
171 Ga0500644_0000014 3300053088 Bacteria 109650
172 Ga0500644_0011436 3300053088 Bacteria 2426
173 Ga0501084_0150524 3300054114 Bacteria 1961
174 Ga0530510_0449758 3300061734 Bacteria 974
175 Ga0530510_0468253 3300061734 Bacteria 954
176 2644089371 2643221615 Bacteria 5487866
177 2644230329 2643221641 Bacteria 4490190
178 2644319216 2643221657 Bacteria 5490246
179 2740168999 2739367898 Bacteria 4367674
180 2984580286 2984576629 Bacteria 4248407
181 2990259136 2990256926 Bacteria 4252839
182 8054611169 8054609563 Bacteria 5170090
183 Ga0466957_0016003
184 rootH1_10012611
185 rootL2_10084214
186 Ga0070658_10035528
187 Ga0070683_100005822
188 Ga0070680_100083028
189 Ga0068868_100117381
190 Ga0070687_100211023
191 Ga0070661_100190282
192 Ga0070692_10088998
193 Ga0070659_100016822
194 Ga0070667_100099599
195 Ga0070678_100030062
196 Ga0070679_100022498
197 Ga0070679_100461582
198 Ga0070679_100570911
199 Ga0070684_100074255
200 Ga0070684_100136530
201 Ga0070684_100483687
202 Ga0070686_100197778
203 Ga0070665_100000273
204 Ga0070665_100254201
205 Ga0068855_100388197
206 Ga0070664_100107107
207 Ga0068857_100028359
208 Ga0068864_100028623
209 Ga0068858_100263070
210 Ga0068860_100000334
211 Ga0081539_10043441
212 Ga0075365_10000543
213 Ga0075365_10001497
214 Ga0075365_10024624
215 Ga0075365_10026596
216 Ga0075365_10034048
217 Ga0075365_10037202
218 Ga0075365_10091284
219 Ga0075365_10096043
220 Ga0075365_10150891
221 Ga0075365_10216482
222 Ga0075365_10217077
223 Ga0075368_10000592
224 Ga0075368_10004219
225 Ga0075363_100014149
226 Ga0075363_100017066
227 Ga0075363_100047990
228 Ga0075363_100137535
229 Ga0075364_10021258
230 Ga0075364_10035911
231 Ga0075364_10041086
232 Ga0075364_10091196
233 Ga0075367_10023585
234 Ga0075367_10038332
235 Ga0075367_10043737
236 Ga0075367_10096353
237 Ga0075370_10024859
238 Ga0075370_10038058
239 Ga0068871_100522341
240 Ga0105245_10013520
241 Ga0105242_10087701
242 Ga0105239_10052968
243 Ga0105246_10010166
244 Ga0157369_10243109
245 Ga0163162_10016809
246 Ga0157372_10059032
247 Ga0157372_10065647
248 Ga0157375_10146419
249 Ga0157379_10071066
250 Ga0163161_10213727
251 Ga0207688_10007226
252 Ga0207647_10017813
253 Ga0207705_10018059
254 Ga0207662_10240852
255 Ga0207657_10003212
256 Ga0207657_10034245
257 Ga0207652_10331368
258 Ga0207652_10606495
259 Ga0207690_10013295
260 Ga0207686_10087820
261 Ga0207704_10024202
262 Ga0207689_10112030
263 Ga0207661_10245939
264 Ga0207679_10136330
265 Ga0207679_10259631
266 Ga0207658_10029623
267 Ga0207658_10068428
268 Ga0207702_10210055
269 Ga0207676_10215609
270 Ga0207674_10010129
271 Ga0207675_100019913
272 Ga0207683_10041819
273 Ga0209813_10001346
274 Ga0268266_10002137
275 Ga0268264_10000417
276 Ga0268264_10274780
277 Ga0307405_10117373
278 Ga0307407_10445442
279 Ga0307409_100010040
280 Ga0307409_100117433
281 Ga0307409_100157718
282 Ga0307416_100069412
283 Ga0307416_100317843
284 Ga0307411_10165242
285 Ga0307415_100027351
286 Ga0307415_100223294
287 Ga0450907_007338
288 Ga0466965_0032434
289 Ga0466961_0310183
290 Ga0466963_0006599
291 Ga0466964_0016914
292 Ga0466960_0095328
293 Ga0466958_0039505
294 Ga0495658_0036602
295 Ga0496103_0019044
296 Ga0496106_0191820
297 Ga0496106_0280591
298 Ga0496107_0100723
299 Ga0496109_0022746
300 Ga0496109_0132756
301 Ga0496110_0104082
302 Ga0496111_0089657
303 Ga0496114_0007926
304 Ga0501031_0063567
305 Ga0501032_0003539
306 Ga0501032_0202813
307 Ga0501033_0009971
308 Ga0501034_0418497
309 Ga0501034_0521431
310 Ga0501036_0005447
311 Ga0501036_0089302
312 Ga0501037_0001474
313 Ga0501037_0117799
314 Ga0501038_0005127
315 Ga0501039_0010398
316 Ga0501039_0112089
317 Ga0501039_0154419
318 Ga0501042_0010410
319 Ga0501043_0001478
320 Ga0501046_0000617
321 Ga0501046_0002401
322 Ga0501046_0131871
323 Ga0501047_0093697
324 Ga0501048_0012557
325 Ga0501067_0102466
326 Ga0501069_0073791
327 Ga0501070_0018939
328 Ga0501070_0257170
329 Ga0501072_0313817
330 Ga0501073_0031366
331 Ga0501073_0087372
332 Ga0501074_0029203
333 Ga0501075_0069999
334 Ga0501035_0014912
335 Ga0501035_0179816
336 Ga0501044_0031491
337 nmdc:mga03n38_76541_c1
338 nmdc:mga00v17_48981_c1
339 nmdc:mga00v17_51939_c1
340 nmdc:mga0yw44_120841_c1
341 nmdc:mga0yw44_130445_c1
342 nmdc:mga0yw44_205181_c1
343 nmdc:mga0yw44_217647_c1
344 nmdc:mga0yw44_266056_c1
345 nmdc:mga0yw44_364932_c1
346 nmdc:mga0yw44_38041_c1
347 nmdc:mga0yw44_82797_c1
348 nmdc:mga0yw44_83401_c1
349 nmdc:mga06z11_20870_c1
350 nmdc:mga06z11_24005_c1
351 nmdc:mga06z11_97243_c1
352 nmdc:mga04h51_5375_c1
353 Ga0500644_0000014
354 Ga0500644_0011436
355 Ga0501084_0150524
356 Ga0530510_0449758
357 Ga0530510_0468253
358 2644089371
359 2644230329
360 2644319216
361 2740168999
362 2984580286
363 2990259136
364 8054611169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

169

259

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.9149 30 273
3wew-assembly1.cif.gz_A crystal structure of htdx (rv0241c) of mycobacterium tuberculosis at 2.4 a resolution 0.9111 30 273
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8699 32 273
4oob-assembly1.cif.gz_A crystal structure of htdx(rv0241c) from mycobacterium tuberculosis 0.8564 32 273
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.8452 27 148
ID Description Score Start End Superfamily
af_Q2G0K0_1_89_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8851 171 274 3.10.129.10
af_Q2G0K0_1_89_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8759 171 274 3.10.129.10
4oobA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8699 32 273 3.10.129.10
4oobA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8564 32 273 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8456 27 148 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A562IXF8-F1-model_v4 Acyl dehydratase 0.9624 19 273 GO:0004312
GO:0005835
GO:0006633
AF-A0A5B1L845-F1-model_v4 MaoC-like domain-containing protein 0.9622 6 273
AF-A0A1Q9LG53-F1-model_v4 MaoC-like domain-containing protein 0.9482 13 273 GO:0004312
GO:0005835
GO:0006633
AF-D3QAA5-F1-model_v4 MaoC domain protein dehydratase 0.9482 25 274
AF-A0A838K8J7-F1-model_v4 MaoC-like domain-containing protein 0.9475 13 274 GO:0004312
GO:0005835
GO:0006633

Map