F278837

General Info

Members Datasets Scaffolds Average Seq Length
182 109 364 312

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100242438|Ga0068864_1002424381
Length 337
Sequence MRAPDFWQKRDVWARLLAPLGALYGFSVAIKARLANPFDPGIPVICVGNLTAGGSGKTPIALAITEMLRAKGHKPYFLTRGYGGSERGPALATRGHSAEVMGDEALLLARAAPTIVARDRGAGARLAKEKGATVLVMDDGHQNFTLRKSLSLVVVDAQTGFGNGFQIPAGPLREPVAQGLARADAVMLVGSEHSEDGRAAVHSDSVWTAQGNGAPGLGGFRGPVLRAHLVSDGSAFTGQPVFAFAGIGRPEKFIASLEACGAHVIGSCFFADHHPYSEDEILELKAVAGEAALVTTEKDFVRLSIASREGIKVLKVSARFDDAAAIERLLDSALSRP

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
106 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
107 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 0
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100242438 3300005618 Bacteria 1670
2 rootH1_10199453 3300003323 Bacteria 1335
3 Ga0070658_10034014 3300005327 Bacteria 4102
4 Ga0070676_10034134 3300005328 Bacteria 2921
5 Ga0070683_100081088 3300005329 Bacteria 3038
6 Ga0070666_10242521 3300005335 Bacteria 1275
7 Ga0070680_100014586 3300005336 Bacteria 6146
8 Ga0070680_100045425 3300005336 Bacteria 3571
9 Ga0068868_100098200 3300005338 Bacteria 2368
10 Ga0070660_100012006 3300005339 Bacteria 6180
11 Ga0070660_100024911 3300005339 Bacteria 4443
12 Ga0070660_100073871 3300005339 Bacteria 2667
13 Ga0070675_100044935 3300005354 Bacteria 3613
14 Ga0070674_100137400 3300005356 Bacteria 1830
15 Ga0070667_100166096 3300005367 Bacteria 1947
16 Ga0070678_100158026 3300005456 Bacteria 1833
17 Ga0070681_10159525 3300005458 Unclassified 2179
18 Ga0070681_10185852 3300005458 Bacteria 1998
19 Ga0068867_100010890 3300005459 Bacteria 6414
20 Ga0070679_100033959 3300005530 Bacteria 5054
21 Ga0070679_100087293 3300005530 Bacteria 3106
22 Ga0068853_100057881 3300005539 Bacteria 3346
23 Ga0068853_100550661 3300005539 Bacteria 1093
24 Ga0070672_100436751 3300005543 Bacteria 1126
25 Ga0070693_100193064 3300005547 Bacteria 1318
26 Ga0070665_100000381 3300005548 Bacteria 65638
27 Ga0070665_100014878 3300005548 Bacteria 7810
28 Ga0070665_100034869 3300005548 Bacteria 5062
29 Ga0070665_100214744 3300005548 Bacteria 1925
30 Ga0070665_100325739 3300005548 Bacteria 1540
31 Ga0070665_100667636 3300005548 Bacteria 1052
32 Ga0068855_100017791 3300005563 Bacteria 8544
33 Ga0068855_100040532 3300005563 Bacteria 5527
34 Ga0068857_100033164 3300005577 Bacteria 4566
35 Ga0068854_100215429 3300005578 Bacteria 1517
36 Ga0068852_100028291 3300005616 Bacteria 4585
37 Ga0068870_10067634 3300005840 Bacteria 1938
38 Ga0068863_100171111 3300005841 Bacteria 2083
39 Ga0068858_100069796 3300005842 Bacteria 3257
40 Ga0068858_100088908 3300005842 Bacteria 2874
41 Ga0097621_100000209 3300006237 Bacteria 38414
42 Ga0097621_100019261 3300006237 Bacteria 5235
43 Ga0097621_100202604 3300006237 Bacteria 1723
44 Ga0097621_100230713 3300006237 Bacteria 1616
45 Ga0068871_100000755 3300006358 Bacteria 21836
46 Ga0068871_100020736 3300006358 Bacteria 5039
47 Ga0068871_100021954 3300006358 Bacteria 4916
48 Ga0068871_100045882 3300006358 Bacteria 3519
49 Ga0068865_100002231 3300006881 Bacteria 11409
50 Ga0105240_10004599 3300009093 Bacteria 20913
51 Ga0105240_10044403 3300009093 Bacteria 5647
52 Ga0105240_10146763 3300009093 Bacteria 2814
53 Ga0105240_10172196 3300009093 Bacteria 2562
54 Ga0105240_10453972 3300009093 Bacteria 1433
55 Ga0105245_10017456 3300009098 Bacteria 6260
56 Ga0105245_10081231 3300009098 Bacteria 2963
57 Ga0105243_10005721 3300009148 Bacteria 9657
58 Ga0105241_10010798 3300009174 Bacteria 6699
59 Ga0105241_10069577 3300009174 Bacteria 2729
60 Ga0105241_10076301 3300009174 Bacteria 2613
61 Ga0105241_10113570 3300009174 Bacteria 2171
62 Ga0105241_10205260 3300009174 Bacteria 1648
63 Ga0105242_10015932 3300009176 Bacteria 5841
64 Ga0105242_10095297 3300009176 Unclassified 2512
65 Ga0105242_10364558 3300009176 Bacteria 1338
66 Ga0105248_10000005 3300009177 Bacteria 673111
67 Ga0105248_10551649 3300009177 Bacteria 1300
68 Ga0105237_10053956 3300009545 Bacteria 4029
69 Ga0105237_10054187 3300009545 Bacteria 4019
70 Ga0105237_10078838 3300009545 Bacteria 3283
71 Ga0105237_10194550 3300009545 Bacteria 2027
72 Ga0105238_10042101 3300009551 Bacteria 4625
73 Ga0105238_10073507 3300009551 Bacteria 3413
74 Ga0105238_10095578 3300009551 Bacteria 2958
75 Ga0105238_10141642 3300009551 Bacteria 2381
76 Ga0105239_10008191 3300010375 Bacteria 11924
77 Ga0105239_10080833 3300010375 Bacteria 3576
78 Ga0105239_10081071 3300010375 Bacteria 3571
79 Ga0105239_10152781 3300010375 Unclassified 2576
80 Ga0105239_10269991 3300010375 Bacteria 1913
81 Ga0105239_10344204 3300010375 Bacteria 1683
82 Ga0105246_10008773 3300011119 Bacteria 6219
83 Ga0157370_10168534 3300013104 Bacteria 2036
84 Ga0157374_10193110 3300013296 Bacteria 1991
85 Ga0157374_10307554 3300013296 Bacteria 1569
86 Ga0157378_10042697 3300013297 Bacteria 4024
87 Ga0163162_10028095 3300013306 Bacteria 5564
88 Ga0163162_10187762 3300013306 Unclassified 2194
89 Ga0157375_10104043 3300013308 Bacteria 2927
90 Ga0163163_10000015 3300014325 Bacteria 214881
91 Ga0157380_10111199 3300014326 Bacteria 2302
92 Ga0157379_10000349 3300014968 Bacteria 37189
93 Ga0157379_10021825 3300014968 Bacteria 5673
94 Ga0157379_10219727 3300014968 Unclassified 1722
95 Ga0157376_10096332 3300014969 Bacteria 2575
96 Ga0163161_10067867 3300017792 Bacteria 2605
97 Ga0213874_10001460 3300021377 Bacteria 4901
98 Ga0207688_10036544 3300025901 Unclassified 2723
99 Ga0207645_10028684 3300025907 Bacteria 3592
100 Ga0207645_10155678 3300025907 Bacteria 1493
101 Ga0207643_10063910 3300025908 Bacteria 2106
102 Ga0207705_10062360 3300025909 Bacteria 2693
103 Ga0207654_10207280 3300025911 Bacteria 1294
104 Ga0207695_10003669 3300025913 Bacteria 21406
105 Ga0207695_10065404 3300025913 Bacteria 3739
106 Ga0207671_10029486 3300025914 Bacteria 4097
107 Ga0207671_10031450 3300025914 Bacteria 3955
108 Ga0207671_10111961 3300025914 Unclassified 2077
109 Ga0207671_10149969 3300025914 Bacteria 1801
110 Ga0207660_10006970 3300025917 Bacteria 7319
111 Ga0207660_10067021 3300025917 Bacteria 2599
112 Ga0207657_10009964 3300025919 Bacteria 9512
113 Ga0207649_10122837 3300025920 Bacteria 1753
114 Ga0207652_10041171 3300025921 Bacteria 3926
115 Ga0207694_10042371 3300025924 Bacteria 3511
116 Ga0207694_10098886 3300025924 Bacteria 2311
117 Ga0207694_10148252 3300025924 Unclassified 1889
118 Ga0207659_10029720 3300025926 Bacteria 3727
119 Ga0207659_10241882 3300025926 Bacteria 1460
120 Ga0207706_10049600 3300025933 Bacteria 3709
121 Ga0207686_10247349 3300025934 Bacteria 1301
122 Ga0207691_10233952 3300025940 Unclassified 1590
123 Ga0207711_10028826 3300025941 Bacteria 4676
124 Ga0207667_10055439 3300025949 Bacteria 4167
125 Ga0207712_10245642 3300025961 Bacteria 1444
126 Ga0207658_10512066 3300025986 Bacteria 1070
127 Ga0207677_10062093 3300026023 Bacteria 2590
128 Ga0207703_10012743 3300026035 Bacteria 6557
129 Ga0207639_10177554 3300026041 Bacteria 1809
130 Ga0207648_10014726 3300026089 Bacteria 7217
131 Ga0207648_10060573 3300026089 Bacteria 3301
132 Ga0207676_10129143 3300026095 Bacteria 2146
133 Ga0207674_10085775 3300026116 Bacteria 3143
134 Ga0207675_100255469 3300026118 Bacteria 1697
135 Ga0207683_10009686 3300026121 Bacteria 8214
136 Ga0207683_10085643 3300026121 Bacteria 2801
137 Ga0207683_10525147 3300026121 Bacteria 1094
138 Ga0268266_10002150 3300028379 Bacteria 21661
139 Ga0268266_10010812 3300028379 Bacteria 7950
140 Ga0268266_10027363 3300028379 Bacteria 4849
141 Ga0268266_10162905 3300028379 Bacteria 2019
142 Ga0268264_10116612 3300028381 Bacteria 2348
143 Ga0265340_10015651 3300031247 Bacteria 3939
144 Ga0265340_10025873 3300031247 Bacteria 2969
145 Ga0265331_10031440 3300031250 Bacteria 2638
146 Ga0265342_10030597 3300031712 Bacteria 3335
147 Ga0307516_10021298 3300031730 Bacteria 6676
148 Ga0373931_0109786 3300035691 Unclassified 1563
149 Ga0395900_0149460 3300037418 Bacteria 2387
150 Ga0436363_0903664 3300039450 Bacteria 9295
151 Ga0466963_0102237 3300044694 Bacteria 1963
152 Ga0495652_0024239 3300046529 Bacteria 5373
153 Ga0495640_0085673 3300046533 Bacteria 2088
154 Ga0495658_0074968 3300046683 Bacteria 1973
155 Ga0496121_0001509 3300048924 Bacteria 39104
156 Ga0501033_0033292 3300049570 Bacteria 3869
157 Ga0501034_0492118 3300049571 Bacteria 1141
158 Ga0501037_0049305 3300049573 Bacteria 3084
159 Ga0501038_0075592 3300049574 Bacteria 2847
160 Ga0501038_0098284 3300049574 Bacteria 2441
161 Ga0501038_0101510 3300049574 Bacteria 2395
162 Ga0501043_0351698 3300049579 Bacteria 1119
163 Ga0501046_0241326 3300049580 Bacteria 1332
164 Ga0501047_0014609 3300049581 Bacteria 7471
165 Ga0501047_0020524 3300049581 Bacteria 6343
166 Ga0501047_0029916 3300049581 Bacteria 5250
167 Ga0501047_0073755 3300049581 Bacteria 3286
168 Ga0501080_0002279 3300049742 Bacteria 16702
169 Ga0501080_0051093 3300049742 Bacteria 3846
170 Ga0501083_0037949 3300049744 Bacteria 3277
171 Ga0501035_0003567 3300049822 Bacteria 14870
172 Ga0501035_0010177 3300049822 Bacteria 8729
173 Ga0501035_0373142 3300049822 Bacteria 1191
174 Ga0501044_0001279 3300049823 Bacteria 29728
175 Ga0501044_0065434 3300049823 Bacteria 3707
176 Ga0501044_0079841 3300049823 Bacteria 3314
177 Ga0501044_0102472 3300049823 Bacteria 2878
178 Ga0500643_000003 3300053087 Bacteria 876659
179 Ga0500555_014984 3300053103 Bacteria 2235
180 Ga0500595_000431 3300053119 Bacteria 26251
181 Ga0500559_0013032 3300053136 Bacteria 3526
182 2523102829 2522572158 Bacteria 6514390
183 Ga0068864_100242438
184 rootH1_10199453
185 Ga0070658_10034014
186 Ga0070676_10034134
187 Ga0070683_100081088
188 Ga0070666_10242521
189 Ga0070680_100014586
190 Ga0070680_100045425
191 Ga0068868_100098200
192 Ga0070660_100012006
193 Ga0070660_100024911
194 Ga0070660_100073871
195 Ga0070675_100044935
196 Ga0070674_100137400
197 Ga0070667_100166096
198 Ga0070678_100158026
199 Ga0070681_10159525
200 Ga0070681_10185852
201 Ga0068867_100010890
202 Ga0070679_100033959
203 Ga0070679_100087293
204 Ga0068853_100057881
205 Ga0068853_100550661
206 Ga0070672_100436751
207 Ga0070693_100193064
208 Ga0070665_100000381
209 Ga0070665_100014878
210 Ga0070665_100034869
211 Ga0070665_100214744
212 Ga0070665_100325739
213 Ga0070665_100667636
214 Ga0068855_100017791
215 Ga0068855_100040532
216 Ga0068857_100033164
217 Ga0068854_100215429
218 Ga0068852_100028291
219 Ga0068870_10067634
220 Ga0068863_100171111
221 Ga0068858_100069796
222 Ga0068858_100088908
223 Ga0097621_100000209
224 Ga0097621_100019261
225 Ga0097621_100202604
226 Ga0097621_100230713
227 Ga0068871_100000755
228 Ga0068871_100020736
229 Ga0068871_100021954
230 Ga0068871_100045882
231 Ga0068865_100002231
232 Ga0105240_10004599
233 Ga0105240_10044403
234 Ga0105240_10146763
235 Ga0105240_10172196
236 Ga0105240_10453972
237 Ga0105245_10017456
238 Ga0105245_10081231
239 Ga0105243_10005721
240 Ga0105241_10010798
241 Ga0105241_10069577
242 Ga0105241_10076301
243 Ga0105241_10113570
244 Ga0105241_10205260
245 Ga0105242_10015932
246 Ga0105242_10095297
247 Ga0105242_10364558
248 Ga0105248_10000005
249 Ga0105248_10551649
250 Ga0105237_10053956
251 Ga0105237_10054187
252 Ga0105237_10078838
253 Ga0105237_10194550
254 Ga0105238_10042101
255 Ga0105238_10073507
256 Ga0105238_10095578
257 Ga0105238_10141642
258 Ga0105239_10008191
259 Ga0105239_10080833
260 Ga0105239_10081071
261 Ga0105239_10152781
262 Ga0105239_10269991
263 Ga0105239_10344204
264 Ga0105246_10008773
265 Ga0157370_10168534
266 Ga0157374_10193110
267 Ga0157374_10307554
268 Ga0157378_10042697
269 Ga0163162_10028095
270 Ga0163162_10187762
271 Ga0157375_10104043
272 Ga0163163_10000015
273 Ga0157380_10111199
274 Ga0157379_10000349
275 Ga0157379_10021825
276 Ga0157379_10219727
277 Ga0157376_10096332
278 Ga0163161_10067867
279 Ga0213874_10001460
280 Ga0207688_10036544
281 Ga0207645_10028684
282 Ga0207645_10155678
283 Ga0207643_10063910
284 Ga0207705_10062360
285 Ga0207654_10207280
286 Ga0207695_10003669
287 Ga0207695_10065404
288 Ga0207671_10029486
289 Ga0207671_10031450
290 Ga0207671_10111961
291 Ga0207671_10149969
292 Ga0207660_10006970
293 Ga0207660_10067021
294 Ga0207657_10009964
295 Ga0207649_10122837
296 Ga0207652_10041171
297 Ga0207694_10042371
298 Ga0207694_10098886
299 Ga0207694_10148252
300 Ga0207659_10029720
301 Ga0207659_10241882
302 Ga0207706_10049600
303 Ga0207686_10247349
304 Ga0207691_10233952
305 Ga0207711_10028826
306 Ga0207667_10055439
307 Ga0207712_10245642
308 Ga0207658_10512066
309 Ga0207677_10062093
310 Ga0207703_10012743
311 Ga0207639_10177554
312 Ga0207648_10014726
313 Ga0207648_10060573
314 Ga0207676_10129143
315 Ga0207674_10085775
316 Ga0207675_100255469
317 Ga0207683_10009686
318 Ga0207683_10085643
319 Ga0207683_10525147
320 Ga0268266_10002150
321 Ga0268266_10010812
322 Ga0268266_10027363
323 Ga0268266_10162905
324 Ga0268264_10116612
325 Ga0265340_10015651
326 Ga0265340_10025873
327 Ga0265331_10031440
328 Ga0265342_10030597
329 Ga0307516_10021298
330 Ga0373931_0109786
331 Ga0395900_0149460
332 Ga0436363_0903664
333 Ga0466963_0102237
334 Ga0495652_0024239
335 Ga0495640_0085673
336 Ga0495658_0074968
337 Ga0496121_0001509
338 Ga0501033_0033292
339 Ga0501034_0492118
340 Ga0501037_0049305
341 Ga0501038_0075592
342 Ga0501038_0098284
343 Ga0501038_0101510
344 Ga0501043_0351698
345 Ga0501046_0241326
346 Ga0501047_0014609
347 Ga0501047_0020524
348 Ga0501047_0029916
349 Ga0501047_0073755
350 Ga0501080_0002279
351 Ga0501080_0051093
352 Ga0501083_0037949
353 Ga0501035_0003567
354 Ga0501035_0010177
355 Ga0501035_0373142
356 Ga0501044_0001279
357 Ga0501044_0065434
358 Ga0501044_0079841
359 Ga0501044_0102472
360 Ga0500643_000003
361 Ga0500555_014984
362 Ga0500595_000431
363 Ga0500559_0013032
364 2523102829

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02606

LpxK

Tetraacyldisaccharide-1-P 4'-kinase

13

335

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.8284 13 314
4itm-assembly1.cif.gz_A "crystal structure of ""apo"" form lpxk from aquifex aeolicus in complex with atp at 2.2 angstrom resolution" 0.797 13 314
2ch2-assembly2.cif.gz_C structure of the anopheles gambiae 3-hydroxykynurenine transaminase in complex with inhibitor 0.6983 215 275
2hui-assembly1.cif.gz_A crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with glyoxylic acid 0.697 215 275
1vjo-assembly1.cif.gz_A-2 crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. at 1.70 a resolution 0.6893 215 275
ID Description Score Start End Superfamily
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8746 15 310 3.40.50.300
af_P27300_12_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8323 15 310 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8089 14 314 3.40.50.300
af_A0A1D6KF80_27_384_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7796 10 311 3.40.50.300
af_I1KYA1_28_391_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7757 14 314 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X4A5F9-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) 0.9658 1 164 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-Q2VZS8-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9562 1 311 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A813AX12-F1-model_v4 deleted 0.9523 18 309
AF-A0A5C8TDE0-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9512 208 311 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245
AF-A0A0D8CIX5-F1-model_v4 Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A 4'-kinase) 0.9504 1 312 GO:0005524
GO:0005886
GO:0009029
GO:0009244
GO:0009245

Map