F278749

General Info

Members Datasets Scaffolds Average Seq Length
182 133 364 376

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100004705|Ga0070698_1000047059
Length 400
Sequence VTIGILGGGQLGYMLALAGYPLGLHFRFFDPSPEAPVGRIASRVTADFTDESALEKFANGLELVTYEFENVPFAAARFLSDRLLVLPPPTALEAAQDRLREKQLFQQLGIATTEFAPVLNREGLDSAIEKIGLPAILKTCRMGYDGKGQSVLRTATDVARAKNELPGRHSAGPRHSTRSRASHDQAPFVLERFVAFRRELSILAVRGRAGETAMYPLVENHHRNGILRLSLAPAPQLDPAIQRVAEDAAQRVFQALEYVGVLAIEFFDHEGRLLANEMAPRVHNSGHWTIEGAVTNQFENHLRAVMGLPLGSTDVIGSSAMLNLIGDVPDSAEVLAVRDAHLHLYGKTPRPGRKLGHITLRAASSEALAAQLAELPAFFRQPDFCLDTVLSRAPSRASAD

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
60 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
61 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.1
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.4
Rhizosphere 92.86
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100004705 3300005471 Bacteria 14995
2 rootH1_10181501 3300003323 Bacteria 3177
3 Ga0070658_10000156 3300005327 Bacteria 60415
4 Ga0070680_100065791 3300005336 Bacteria 2971
5 Ga0068868_100093855 3300005338 Bacteria 2420
6 Ga0070703_10001471 3300005406 Bacteria 7073
7 Ga0070713_100012760 3300005436 Bacteria 6176
8 Ga0070711_100023623 3300005439 Bacteria 4001
9 Ga0070711_100126773 3300005439 Bacteria 1896
10 Ga0070705_100241190 3300005440 Unclassified 1263
11 Ga0070694_100028826 3300005444 Bacteria 3616
12 Ga0070708_100000413 3300005445 Bacteria 32082
13 Ga0070708_100001687 3300005445 Bacteria 16975
14 Ga0070708_100324487 3300005445 Unclassified 1450
15 Ga0070706_100039952 3300005467 Bacteria 4331
16 Ga0070706_100078689 3300005467 Bacteria 3052
17 Ga0070707_100003215 3300005468 Bacteria 15456
18 Ga0070707_100047153 3300005468 Bacteria 4124
19 Ga0070707_100156786 3300005468 Bacteria 2218
20 Ga0070707_100233015 3300005468 Bacteria 1792
21 Ga0070707_100281489 3300005468 Unclassified 1616
22 Ga0070698_100073629 3300005471 Bacteria 3422
23 Ga0070679_100081304 3300005530 Bacteria 3229
24 Ga0070697_100003448 3300005536 Bacteria 12157
25 Ga0070697_100014922 3300005536 Bacteria 6098
26 Ga0070697_100078635 3300005536 Bacteria 2714
27 Ga0070695_100019885 3300005545 Bacteria 4095
28 Ga0070693_100000024 3300005547 Bacteria 58381
29 Ga0070693_100000919 3300005547 Bacteria 13089
30 Ga0070704_100057729 3300005549 Bacteria 2761
31 Ga0070704_100076230 3300005549 Bacteria 2452
32 Ga0068855_100000124 3300005563 Bacteria 96975
33 Ga0068855_100003180 3300005563 Bacteria 20107
34 Ga0068866_10068141 3300005718 Bacteria 1870
35 Ga0068861_100291287 3300005719 Bacteria 1410
36 Ga0070717_10077228 3300006028 Bacteria 2788
37 Ga0070716_100014909 3300006173 Bacteria 3987
38 Ga0070716_100024654 3300006173 Bacteria 3204
39 Ga0070716_100049287 3300006173 Bacteria 2385
40 Ga0070712_100027598 3300006175 Bacteria 3792
41 Ga0070712_100179973 3300006175 Bacteria 1647
42 Ga0097621_100210564 3300006237 Bacteria 1691
43 Ga0075430_100163249 3300006846 Bacteria 1854
44 Ga0075433_10207029 3300006852 Bacteria 1744
45 Ga0075434_100003248 3300006871 Bacteria 14517
46 Ga0075436_100001504 3300006914 Bacteria 15905
47 Ga0075436_100090887 3300006914 Bacteria 2122
48 Ga0075435_100064637 3300007076 Bacteria 2973
49 Ga0099794_10002940 3300007265 Bacteria 6420
50 Ga0099794_10024760 3300007265 Bacteria 2758
51 Ga0099794_10025855 3300007265 Bacteria 2709
52 Ga0099794_10025887 3300007265 Bacteria 2707
53 Ga0105242_10081927 3300009176 Bacteria 2699
54 Ga0105242_10299113 3300009176 Bacteria 1468
55 Ga0105248_10083445 3300009177 Bacteria 3594
56 Ga0105237_10009400 3300009545 Bacteria 10470
57 Ga0105237_10026114 3300009545 Bacteria 5968
58 Ga0105249_10109056 3300009553 Bacteria 2614
59 Ga0105239_10017793 3300010375 Bacteria 7862
60 Ga0157374_10106397 3300013296 Bacteria 2695
61 Ga0157378_10000364 3300013297 Bacteria 44780
62 Ga0157378_10025051 3300013297 Bacteria 5256
63 Ga0157378_10034782 3300013297 Bacteria 4456
64 Ga0163162_10195868 3300013306 Bacteria 2149
65 Ga0157376_10004289 3300014969 Bacteria 9904
66 Ga0207685_10030674 3300025905 Bacteria 1917
67 Ga0207699_10001669 3300025906 Bacteria 10525
68 Ga0207699_10086887 3300025906 Bacteria 1954
69 Ga0207684_10014235 3300025910 Bacteria 6863
70 Ga0207684_10130947 3300025910 Bacteria 2153
71 Ga0207671_10026274 3300025914 Bacteria 4365
72 Ga0207693_10044080 3300025915 Bacteria 3506
73 Ga0207693_10047194 3300025915 Bacteria 3384
74 Ga0207663_10085015 3300025916 Bacteria 2082
75 Ga0207660_10207539 3300025917 Bacteria 1533
76 Ga0207652_10161561 3300025921 Bacteria 2008
77 Ga0207646_10001868 3300025922 Bacteria 25391
78 Ga0207646_10074282 3300025922 Bacteria 3037
79 Ga0207700_10012973 3300025928 Bacteria 5399
80 Ga0207664_10267865 3300025929 Bacteria 1496
81 Ga0207665_10002849 3300025939 Bacteria 11613
82 Ga0207665_10019655 3300025939 Bacteria 4442
83 Ga0207711_10071331 3300025941 Bacteria 3014
84 Ga0207667_10000168 3300025949 Bacteria 97016
85 Ga0207677_10126108 3300026023 Bacteria 1935
86 Ga0207675_100140118 3300026118 Bacteria 2297
87 Ga0209179_1004127 3300027512 Bacteria 2165
88 Ga0209588_1002328 3300027671 Bacteria 5145
89 Ga0265354_1000157 3300028016 Bacteria 12417
90 Ga0265357_1000219 3300028023 Bacteria 2780
91 Ga0265765_1000489 3300030879 Bacteria 3131
92 Ga0265760_10003957 3300031090 Bacteria 4276
93 Ga0265327_10016927 3300031251 Bacteria 4602
94 Ga0307516_10007568 3300031730 Bacteria 12455
95 Ga0373926_0068453 3300035083 Bacteria 1301
96 Ga0373934_0000697 3300035086 Bacteria 11984
97 Ga0373923_0002175 3300035111 Bacteria 5947
98 Ga0373953_0000396 3300035117 Bacteria 11847
99 Ga0373954_0000274 3300035118 Bacteria 18782
100 Ga0373954_0043722 3300035118 Bacteria 2089
101 Ga0373956_0002779 3300035119 Bacteria 7080
102 Ga0373956_0006168 3300035119 Bacteria 4796
103 Ga0373946_0004611 3300035171 Bacteria 4941
104 Ga0373924_0064813 3300035410 Bacteria 1534
105 Ga0373927_0000599 3300035695 Bacteria 27498
106 Ga0373927_0012784 3300035695 Bacteria 5584
107 Ga0373927_0050836 3300035695 Bacteria 2681
108 Ga0373933_0000491 3300035724 Bacteria 24661
109 Ga0373933_0093106 3300035724 Bacteria 1862
110 Ga0373947_0004699 3300035725 Bacteria 8005
111 Ga0373937_0000216 3300036401 Bacteria 55804
112 Ga0373937_0003295 3300036401 Bacteria 13554
113 Ga0373925_0000260 3300037068 Bacteria 55009
114 Ga0373925_0011327 3300037068 Bacteria 6472
115 Ga0373925_0149834 3300037068 Bacteria 1831
116 Ga0395905_0236822 3300037471 Bacteria 1706
117 Ga0436363_0174074 3300039450 Bacteria 2361
118 Ga0451793_0301636 3300041452 Bacteria 3273
119 Ga0451807_1005314 3300041486 Bacteria 7482
120 Ga0451853_0480588 3300041512 Bacteria 10739
121 Ga0451577_0003130 3300042876 Bacteria 18664
122 Ga0466972_0000617 3300044658 Bacteria 17384
123 Ga0453683_0002073 3300044673 Bacteria 16046
124 Ga0466965_0000826 3300044683 Bacteria 11707
125 Ga0466968_0008224 3300044735 Bacteria 3990
126 Ga0466968_0065757 3300044735 Bacteria 1570
127 Ga0451576_0254480 3300045051 Bacteria 1835
128 Ga0495592_0088851 3300046454 Bacteria 2220
129 Ga0495603_0005273 3300046455 Bacteria 7711
130 Ga0495651_0012090 3300046462 Bacteria 6643
131 Ga0495653_0026528 3300046463 Bacteria 4644
132 Ga0495580_0100122 3300046472 Bacteria 2016
133 Ga0495582_0006817 3300046473 Bacteria 6355
134 Ga0495594_0053925 3300046499 Bacteria 2215
135 Ga0495608_0023639 3300046511 Bacteria 4210
136 Ga0495618_0034039 3300046514 Bacteria 3194
137 Ga0495628_0146046 3300046516 Bacteria 1803
138 Ga0495630_0004220 3300046517 Bacteria 10068
139 Ga0495630_0030343 3300046517 Bacteria 4021
140 Ga0495666_0010221 3300046526 Bacteria 4682
141 Ga0495652_0047835 3300046529 Bacteria 3668
142 Ga0495665_0057271 3300046531 Bacteria 2057
143 Ga0495640_0008100 3300046533 Bacteria 8254
144 Ga0495587_0005672 3300046536 Bacteria 8137
145 Ga0495587_0009230 3300046536 Bacteria 6329
146 Ga0495635_0085666 3300046663 Bacteria 2156
147 Ga0495624_0009340 3300046690 Bacteria 6795
148 Ga0495604_0000554 3300047317 Bacteria 32893
149 Ga0495604_0065991 3300047317 Bacteria 2754
150 Ga0495676_0017738 3300047321 Bacteria 6287
151 Ga0495676_0093038 3300047321 Bacteria 2249
152 Ga0495680_0018617 3300047322 Bacteria 5887
153 Ga0495680_0131059 3300047322 Bacteria 1842
154 Ga0495680_0149028 3300047322 Bacteria 1707
155 Ga0495684_0009492 3300047471 Bacteria 7505
156 Ga0495684_0071260 3300047471 Bacteria 2641
157 Ga0495602_0006907 3300048088 Bacteria 11928
158 Ga0496100_0062789 3300048903 Bacteria 2453
159 Ga0496103_0120977 3300048906 Bacteria 1667
160 Ga0496104_0130764 3300048907 Bacteria 2411
161 Ga0496104_0314870 3300048907 Bacteria 1478
162 Ga0496107_0046603 3300048910 Bacteria 3120
163 Ga0496112_0464188 3300048915 Bacteria 1203
164 Ga0501034_0088487 3300049571 Bacteria 3095
165 Ga0501043_0056857 3300049579 Bacteria 3073
166 Ga0501046_0120897 3300049580 Bacteria 1992
167 Ga0501047_0074921 3300049581 Bacteria 3258
168 Ga0501047_0111892 3300049581 Bacteria 2613
169 Ga0501067_0007171 3300049583 Bacteria 6193
170 Ga0501069_0121984 3300049585 Bacteria 1489
171 Ga0501253_013990 3300049683 Bacteria 1290
172 Ga0501035_0063782 3300049822 Bacteria 3276
173 nmdc:mga0qj67_266661_c1 3300050509 Bacteria 1389
174 nmdc:mga0n895_28355_c1 3300050512 Bacteria 5324
175 nmdc:mga0n895_9724_c1 3300050512 Bacteria 8434
176 nmdc:mga0rr50_30260_c2 3300050513 Bacteria 3433
177 nmdc:mga08x19_2257_c1 3300050514 Bacteria 11736
178 nmdc:mga0a205_198845_c1 3300050515 Bacteria 1895
179 Ga0495601_0020520 3300053077 Bacteria 4037
180 Ga0495612_0071538 3300053078 Bacteria 1447
181 Ga0495619_0050866 3300053085 Bacteria 2737
182 2673167201 2671180531 Bacteria 9045424
183 Ga0070698_100004705
184 rootH1_10181501
185 Ga0070658_10000156
186 Ga0070680_100065791
187 Ga0068868_100093855
188 Ga0070703_10001471
189 Ga0070713_100012760
190 Ga0070711_100023623
191 Ga0070711_100126773
192 Ga0070705_100241190
193 Ga0070694_100028826
194 Ga0070708_100000413
195 Ga0070708_100001687
196 Ga0070708_100324487
197 Ga0070706_100039952
198 Ga0070706_100078689
199 Ga0070707_100003215
200 Ga0070707_100047153
201 Ga0070707_100156786
202 Ga0070707_100233015
203 Ga0070707_100281489
204 Ga0070698_100073629
205 Ga0070679_100081304
206 Ga0070697_100003448
207 Ga0070697_100014922
208 Ga0070697_100078635
209 Ga0070695_100019885
210 Ga0070693_100000024
211 Ga0070693_100000919
212 Ga0070704_100057729
213 Ga0070704_100076230
214 Ga0068855_100000124
215 Ga0068855_100003180
216 Ga0068866_10068141
217 Ga0068861_100291287
218 Ga0070717_10077228
219 Ga0070716_100014909
220 Ga0070716_100024654
221 Ga0070716_100049287
222 Ga0070712_100027598
223 Ga0070712_100179973
224 Ga0097621_100210564
225 Ga0075430_100163249
226 Ga0075433_10207029
227 Ga0075434_100003248
228 Ga0075436_100001504
229 Ga0075436_100090887
230 Ga0075435_100064637
231 Ga0099794_10002940
232 Ga0099794_10024760
233 Ga0099794_10025855
234 Ga0099794_10025887
235 Ga0105242_10081927
236 Ga0105242_10299113
237 Ga0105248_10083445
238 Ga0105237_10009400
239 Ga0105237_10026114
240 Ga0105249_10109056
241 Ga0105239_10017793
242 Ga0157374_10106397
243 Ga0157378_10000364
244 Ga0157378_10025051
245 Ga0157378_10034782
246 Ga0163162_10195868
247 Ga0157376_10004289
248 Ga0207685_10030674
249 Ga0207699_10001669
250 Ga0207699_10086887
251 Ga0207684_10014235
252 Ga0207684_10130947
253 Ga0207671_10026274
254 Ga0207693_10044080
255 Ga0207693_10047194
256 Ga0207663_10085015
257 Ga0207660_10207539
258 Ga0207652_10161561
259 Ga0207646_10001868
260 Ga0207646_10074282
261 Ga0207700_10012973
262 Ga0207664_10267865
263 Ga0207665_10002849
264 Ga0207665_10019655
265 Ga0207711_10071331
266 Ga0207667_10000168
267 Ga0207677_10126108
268 Ga0207675_100140118
269 Ga0209179_1004127
270 Ga0209588_1002328
271 Ga0265354_1000157
272 Ga0265357_1000219
273 Ga0265765_1000489
274 Ga0265760_10003957
275 Ga0265327_10016927
276 Ga0307516_10007568
277 Ga0373926_0068453
278 Ga0373934_0000697
279 Ga0373923_0002175
280 Ga0373953_0000396
281 Ga0373954_0000274
282 Ga0373954_0043722
283 Ga0373956_0002779
284 Ga0373956_0006168
285 Ga0373946_0004611
286 Ga0373924_0064813
287 Ga0373927_0000599
288 Ga0373927_0012784
289 Ga0373927_0050836
290 Ga0373933_0000491
291 Ga0373933_0093106
292 Ga0373947_0004699
293 Ga0373937_0000216
294 Ga0373937_0003295
295 Ga0373925_0000260
296 Ga0373925_0011327
297 Ga0373925_0149834
298 Ga0395905_0236822
299 Ga0436363_0174074
300 Ga0451793_0301636
301 Ga0451807_1005314
302 Ga0451853_0480588
303 Ga0451577_0003130
304 Ga0466972_0000617
305 Ga0453683_0002073
306 Ga0466965_0000826
307 Ga0466968_0008224
308 Ga0466968_0065757
309 Ga0451576_0254480
310 Ga0495592_0088851
311 Ga0495603_0005273
312 Ga0495651_0012090
313 Ga0495653_0026528
314 Ga0495580_0100122
315 Ga0495582_0006817
316 Ga0495594_0053925
317 Ga0495608_0023639
318 Ga0495618_0034039
319 Ga0495628_0146046
320 Ga0495630_0004220
321 Ga0495630_0030343
322 Ga0495666_0010221
323 Ga0495652_0047835
324 Ga0495665_0057271
325 Ga0495640_0008100
326 Ga0495587_0005672
327 Ga0495587_0009230
328 Ga0495635_0085666
329 Ga0495624_0009340
330 Ga0495604_0000554
331 Ga0495604_0065991
332 Ga0495676_0017738
333 Ga0495676_0093038
334 Ga0495680_0018617
335 Ga0495680_0131059
336 Ga0495680_0149028
337 Ga0495684_0009492
338 Ga0495684_0071260
339 Ga0495602_0006907
340 Ga0496100_0062789
341 Ga0496103_0120977
342 Ga0496104_0130764
343 Ga0496104_0314870
344 Ga0496107_0046603
345 Ga0496112_0464188
346 Ga0501034_0088487
347 Ga0501043_0056857
348 Ga0501046_0120897
349 Ga0501047_0074921
350 Ga0501047_0111892
351 Ga0501067_0007171
352 Ga0501069_0121984
353 Ga0501253_013990
354 Ga0501035_0063782
355 nmdc:mga0qj67_266661_c1
356 nmdc:mga0n895_28355_c1
357 nmdc:mga0n895_9724_c1
358 nmdc:mga0rr50_30260_c2
359 nmdc:mga08x19_2257_c1
360 nmdc:mga0a205_198845_c1
361 Ga0495601_0020520
362 Ga0495612_0071538
363 Ga0495619_0050866
364 2673167201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22660

RS_preATP-grasp-like

Ribonucleotide synthetase preATP-grasp domain

1

96

0.99

PF02222

ATP-grasp

ATP-grasp domain

105

293

0.97

PF17769

PurK_C

Phosphoribosylaminoimidazole carboxylase C-terminal domain

319

371

0.95

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

97

298

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aw8-assembly1.cif.gz_B crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8 0.9529 15 364
4ma0-assembly1.cif.gz_A the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with partially hydrolysed atp 0.95 14 363
4e4t-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazole carboxylase, atpase subunit from burkholderia ambifaria 0.9399 12 363
4ma5-assembly1.cif.gz_A-2 the crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. tularensis schu s4 in complex with an atp analog, amp-pnp. 0.9391 14 363
3qff-assembly1.cif.gz_B crystal structure of adp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase 0.9341 12 358
ID Description Score Start End Superfamily
3aw8B03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9873 177 364 3.30.470.20
3aw8B03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9619 177 364 3.30.470.20
4izoA03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9571 177 364 3.30.470.20
3etjA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.952 177 360 3.30.470.20
4mamA02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9499 98 176 3.30.1490.20
ID Description Score Start End GO Terms
AF-T1BPF7-F1-model_v4 Phosphoribosylaminoimidazole carboxylase, ATPase subunit 0.9887 174 324 GO:0005524
GO:0046872
AF-A0A651I4T0-F1-model_v4 ATP-grasp domain-containing protein 0.9885 184 362 GO:0003824
GO:0005524
GO:0005829
GO:0046872
AF-A0A539E3W6-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.983 262 362
AF-A0A455V992-F1-model_v4 deleted 0.9818 153 362
AF-A0A3D5Q029-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide synthase 0.9812 214 362 GO:0003824
GO:0005524
GO:0005829
GO:0046872

Map