F277762

General Info

Members Datasets Scaffolds Average Seq Length
181 140 181 138

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1127535|Ga0436365_1127535_3990_4466
Length 158
Sequence VNAQVLRLSPDRFRLAAVRPQPLISVADVERSSRFYQELLACESGHGGAEYERLFRDGTLVLQLHAFHIEHHHGRIGDPSRRPYGNGVALWFEIDDFDAAVGRAQALEAETVMPAHRNPPDGPGGPAHRELWLRDPDGYLVVLASPDGESPWPDPRVG

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 9.94
Rhizosphere 77.35
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10050232 3300003323 Bacteria 1179
2 Ga0070668_100908521 3300005347 Archaea 787
3 Ga0070674_100234513 3300005356 Bacteria 1434
4 Ga0070674_100734320 3300005356 Archaea 847
5 Ga0070700_100689726 3300005441 Bacteria 811
6 Ga0070694_101581895 3300005444 Unclassified 556
7 Ga0070698_100196080 3300005471 Unclassified 1956
8 Ga0070684_100220099 3300005535 Bacteria 1732
9 Ga0068853_100374888 3300005539 Bacteria 1328
10 Ga0070665_100938207 3300005548 Bacteria 878
11 Ga0070704_100107160 3300005549 Bacteria 2119
12 Ga0068852_100569535 3300005616 Unclassified 1134
13 Ga0068859_100109826 3300005617 Unclassified 2819
14 Ga0068861_100032759 3300005719 Bacteria 3829
15 Ga0068863_101438924 3300005841 Bacteria 697
16 Ga0068858_100000895 3300005842 Bacteria 30882
17 Ga0068862_100363171 3300005844 Unclassified 1346
18 Ga0068862_100646126 3300005844 Bacteria 1020
19 Ga0081538_10000337 3300005981 Bacteria 53196
20 Ga0081538_10072022 3300005981 Unclassified 1897
21 Ga0081540_1248404 3300005983 Bacteria 622
22 Ga0075363_100654259 3300006048 Unclassified 632
23 Ga0075366_10021054 3300006195 Bacteria 3790
24 Ga0097621_100294774 3300006237 Bacteria 1431
25 Ga0075430_100851801 3300006846 Bacteria 751
26 Ga0075431_100188696 3300006847 Bacteria 2112
27 Ga0075429_100214579 3300006880 Bacteria 1686
28 Ga0075429_100311976 3300006880 Bacteria 1377
29 Ga0075429_101001337 3300006880 Bacteria 731
30 Ga0097620_100109826 3300006931 Unclassified 2819
31 Ga0111539_10259491 3300009094 Bacteria 2023
32 Ga0111539_11585461 3300009094 Unclassified 759
33 Ga0105245_10193348 3300009098 Bacteria 1950
34 Ga0114129_10129964 3300009147 Bacteria 3460
35 Ga0105243_10635670 3300009148 Bacteria 1032
36 Ga0105241_10602586 3300009174 Unclassified 992
37 Ga0105242_10805295 3300009176 Bacteria 930
38 Ga0105237_12089652 3300009545 Bacteria 575
39 Ga0105238_10000150 3300009551 Bacteria 76417
40 Ga0105249_10018348 3300009553 Bacteria 6221
41 Ga0105249_10437179 3300009553 Unclassified 1345
42 Ga0157373_10194143 3300013100 Unclassified 1431
43 Ga0157370_10066694 3300013104 Unclassified 3403
44 Ga0157370_11183427 3300013104 Bacteria 690
45 Ga0157374_10013395 3300013296 Bacteria 7159
46 Ga0157378_10067135 3300013297 Bacteria 3213
47 Ga0163162_10004120 3300013306 Bacteria 13951
48 Ga0157375_10031339 3300013308 Bacteria 5025
49 Ga0163163_10331964 3300014325 Bacteria 1575
50 Ga0157380_10012977 3300014326 Bacteria 6057
51 Ga0157380_10149498 3300014326 Bacteria 2017
52 Ga0157380_10877803 3300014326 Bacteria 921
53 Ga0157379_10177803 3300014968 Bacteria 1922
54 Ga0157376_12416357 3300014969 Unclassified 565
55 Ga0213876_10001037 3300021384 Bacteria 17956
56 Ga0213876_10022695 3300021384 Bacteria 3316
57 Ga0213876_10073647 3300021384 Bacteria 1804
58 Ga0213875_10032846 3300021388 Bacteria 2451
59 Ga0213875_10035234 3300021388 Bacteria 2362
60 Ga0207654_11101867 3300025911 Unclassified 578
61 Ga0207671_10839933 3300025914 Bacteria 727
62 Ga0207671_11219417 3300025914 Bacteria 588
63 Ga0207694_10111338 3300025924 Bacteria 2178
64 Ga0207687_10041894 3300025927 Bacteria 3147
65 Ga0207687_10253475 3300025927 Bacteria 1400
66 Ga0207700_11590999 3300025928 Bacteria 578
67 Ga0207669_10256540 3300025937 Bacteria 1305
68 Ga0207704_10986892 3300025938 Bacteria 712
69 Ga0207667_10224774 3300025949 Unclassified 1923
70 Ga0207668_10519200 3300025972 Bacteria 1027
71 Ga0207678_10033774 3300026067 Bacteria 4455
72 Ga0207678_10215354 3300026067 Bacteria 1643
73 Ga0207708_10876355 3300026075 Bacteria 776
74 Ga0207641_10547835 3300026088 Unclassified 1128
75 Ga0207648_10081042 3300026089 Unclassified 2831
76 Ga0207675_100020978 3300026118 Bacteria 6092
77 Ga0207698_10038722 3300026142 Unclassified 3525
78 Ga0207428_10802676 3300027907 Bacteria 668
79 Ga0268266_10305634 3300028379 Bacteria 1485
80 Ga0268266_10371382 3300028379 Bacteria 1347
81 Ga0268265_10631905 3300028380 Unclassified 1027
82 Ga0268264_10047514 3300028381 Unclassified 3569
83 Ga0307515_10624186 3300028794 Bacteria 689
84 Ga0307408_100084807 3300031548 Bacteria 2377
85 Ga0307508_10147640 3300031616 Bacteria 1956
86 Ga0307413_11008689 3300031824 Unclassified 714
87 Ga0307416_100026786 3300032002 Bacteria 4255
88 Ga0373946_0437194 3300035171 Unclassified 665
89 Ga0373933_0399219 3300035724 Unclassified 897
90 Ga0373937_0568228 3300036401 Unclassified 1077
91 Ga0395899_0117040 3300037312 Unclassified 1912
92 Ga0395900_0124531 3300037418 Bacteria 2643
93 Ga0395900_0490174 3300037418 Bacteria 1181
94 Ga0395898_0020034 3300037466 Bacteria 6799
95 Ga0395898_0666596 3300037466 Bacteria 982
96 Ga0395898_1007321 3300037466 Bacteria 769
97 Ga0395905_0018006 3300037471 Bacteria 6707
98 Ga0395905_1892754 3300037471 Bacteria 503
99 Ga0436364_0091112 3300037853 Bacteria 37001
100 Ga0436364_0300362 3300037853 Bacteria 4062
101 Ga0436364_1061918 3300037853 Bacteria 1025
102 Ga0436364_1371345 3300037853 Bacteria 785
103 Ga0395901_0230830 3300038443 Bacteria 1932
104 Ga0395901_0407440 3300038443 Unclassified 1396
105 Ga0436365_0467984 3300039437 Bacteria 6090
106 Ga0436365_0551689 3300039437 Bacteria 2476
107 Ga0436365_1127535 3300039437 Bacteria 5159
108 Ga0436365_1445277 3300039437 Bacteria 25708
109 Ga0436365_1891706 3300039437 Bacteria 1268
110 Ga0436362_0569840 3300039453 Bacteria 552
111 Ga0451807_1914825 3300041486 Bacteria 563
112 Ga0451853_0210456 3300041512 Bacteria 706
113 Ga0466966_0853406 3300044684 Bacteria 549
114 Ga0466968_0504914 3300044735 Unclassified 603
115 Ga0466957_0586560 3300044842 Bacteria 779
116 Ga0466959_0149683 3300045049 Bacteria 1646
117 Ga0495592_0047421 3300046454 Bacteria 3200
118 Ga0495651_0028868 3300046462 Bacteria 4325
119 Ga0495582_0604208 3300046473 Unclassified 635
120 Ga0495618_0181557 3300046514 Bacteria 1337
121 Ga0495652_0087695 3300046529 Bacteria 2552
122 Ga0495586_0700899 3300046535 Bacteria 585
123 Ga0495645_0007419 3300046543 Bacteria 7630
124 Ga0495667_0425978 3300046559 Bacteria 835
125 Ga0495634_0102213 3300046642 Bacteria 1851
126 Ga0495635_0117846 3300046663 Bacteria 1812
127 Ga0495599_0496740 3300046678 Unclassified 718
128 Ga0495646_0008186 3300046680 Bacteria 6644
129 Ga0495613_0717594 3300046689 Bacteria 657
130 Ga0495624_0137190 3300046690 Bacteria 1499
131 Ga0495600_0604075 3300046809 Bacteria 666
132 Ga0495604_0007171 3300047317 Bacteria 8832
133 Ga0495680_0640800 3300047322 Unclassified 707
134 Ga0495684_0060178 3300047471 Bacteria 2892
135 Ga0495602_0043315 3300048088 Bacteria 4094
136 Ga0496100_0037895 3300048903 Bacteria 3052
137 Ga0496101_0125464 3300048904 Bacteria 1945
138 Ga0496104_0009700 3300048907 Bacteria 8579
139 Ga0496104_1133848 3300048907 Bacteria 685
140 Ga0496105_0141991 3300048908 Bacteria 1976
141 Ga0496105_0310354 3300048908 Bacteria 1266
142 Ga0496106_0096481 3300048909 Bacteria 2288
143 Ga0496108_0013229 3300048911 Bacteria 6725
144 Ga0496109_0002085 3300048912 Bacteria 16614
145 Ga0496109_1975518 3300048912 Unclassified 515
146 Ga0496110_0020479 3300048913 Bacteria 5586
147 Ga0496110_0111419 3300048913 Bacteria 2460
148 Ga0496111_0000861 3300048914 Bacteria 16447
149 Ga0496111_0639959 3300048914 Unclassified 776
150 Ga0496112_0201889 3300048915 Bacteria 1947
151 Ga0496113_0084981 3300048916 Bacteria 2430
152 Ga0496114_0035667 3300048917 Bacteria 4108
153 Ga0501036_0427170 3300049572 Bacteria 1105
154 Ga0501036_0500870 3300049572 Unclassified 1011
155 Ga0501038_0670574 3300049574 Unclassified 779
156 Ga0501040_0949857 3300049576 Bacteria 623
157 Ga0501042_0809968 3300049578 Bacteria 682
158 Ga0501071_0145444 3300049587 Unclassified 1767
159 Ga0501071_0554622 3300049587 Bacteria 883
160 Ga0501072_0770462 3300049588 Bacteria 754
161 Ga0501073_0186636 3300049589 Bacteria 1435
162 Ga0501074_1193386 3300049590 Unclassified 534
163 Ga0501075_0256015 3300049591 Unclassified 1334
164 Ga0501079_0233510 3300049741 Bacteria 1437
165 Ga0501079_0249679 3300049741 Unclassified 1387
166 Ga0501079_1547488 3300049741 Unclassified 522
167 Ga0501080_1645665 3300049742 Bacteria 543
168 Ga0501081_1150210 3300049743 Bacteria 588
169 Ga0501081_1234761 3300049743 Bacteria 566
170 Ga0501081_1286124 3300049743 Bacteria 555
171 nmdc:mga03n38_518950_c1 3300050490 Unclassified 670
172 nmdc:mga0k408_18882_c1 3300050493 Bacteria 3849
173 nmdc:mga0k408_31577_c1 3300050493 Bacteria 3024
174 nmdc:mga06r32_813545_c1 3300050510 Bacteria 894
175 nmdc:mga08y16_405368_c1 3300050511 Bacteria 1395
176 Ga0495601_0611838 3300053077 Unclassified 699
177 Ga0495595_0239078 3300053084 Bacteria 908
178 Ga0495619_0089870 3300053085 Bacteria 2078
179 Ga0501084_0001201 3300054114 Bacteria 20295
180 Ga0501082_1154383 3300060353 Unclassified 677
181 Ga0530510_0087505 3300061734 Bacteria 2270

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0586560 Ga0466957_0586560_35_478 117
2 3300049741 Ga0501079_0233510 Ga0501079_0233510_643_1005 118
3 3300021384 Ga0213876_10073647 Ga0213876_100736472 120
4 3300037853 Ga0436364_0091112 Ga0436364_0091112_8107_8508 120
5 3300037853 Ga0436364_0300362 Ga0436364_0300362_932_1324 120
6 3300039437 Ga0436365_0551689 Ga0436365_0551689_1130_1522 120
7 3300009545 Ga0105237_12089652 Ga0105237_120896521 122
8 3300035171 Ga0373946_0437194 Ga0373946_0437194_80_493 122
9 3300046473 Ga0495582_0604208 Ga0495582_0604208_68_481 122
10 3300046690 Ga0495624_0137190 Ga0495624_0137190_24_437 122
11 3300037418 Ga0395900_0490174 Ga0395900_0490174_232_609 123
12 3300037466 Ga0395898_1007321 Ga0395898_1007321_199_576 123
13 3300037471 Ga0395905_1892754 Ga0395905_1892754_56_433 123
14 3300038443 Ga0395901_0230830 Ga0395901_0230830_586_963 123
15 3300049572 Ga0501036_0500870 Ga0501036_0500870_149_526 123
16 3300049578 Ga0501042_0809968 Ga0501042_0809968_245_622 123
17 3300049591 Ga0501075_0256015 Ga0501075_0256015_54_431 123
18 3300050490 nmdc:mga03n38_518950_c1 nmdc:mga03n38_518950_c1_90_488 125
19 3300050493 nmdc:mga0k408_31577_c1 nmdc:mga0k408_31577_c1_742_1119 125
20 3300009174 Ga0105241_10602586 Ga0105241_106025861 126
21 3300013100 Ga0157373_10194143 Ga0157373_101941432 126
22 3300021388 Ga0213875_10035234 Ga0213875_100352342 126
23 3300025911 Ga0207654_11101867 Ga0207654_111018671 126
24 3300005471 Ga0070698_100196080 Ga0070698_1001960803 127
25 3300005616 Ga0068852_100569535 Ga0068852_1005695352 127
26 3300006846 Ga0075430_100851801 Ga0075430_1008518011 127
27 3300006847 Ga0075431_100188696 Ga0075431_1001886963 127
28 3300006880 Ga0075429_100311976 Ga0075429_1003119762 127
29 3300009147 Ga0114129_10129964 Ga0114129_101299642 127
30 3300013104 Ga0157370_10066694 Ga0157370_100666941 127
31 3300025928 Ga0207700_11590999 Ga0207700_115909991 127
32 3300025949 Ga0207667_10224774 Ga0207667_102247743 127
33 3300026067 Ga0207678_10033774 Ga0207678_100337746 127
34 3300026067 Ga0207678_10215354 Ga0207678_102153542 127
35 3300026142 Ga0207698_10038722 Ga0207698_100387222 127
36 3300031616 Ga0307508_10147640 Ga0307508_101476403 127
37 3300046514 Ga0495618_0181557 Ga0495618_0181557_667_1071 127
38 3300046642 Ga0495634_0102213 Ga0495634_0102213_680_1084 127
39 3300049741 Ga0501079_1547488 Ga0501079_1547488_55_459 127
40 3300049742 Ga0501080_1645665 Ga0501080_1645665_88_492 127
41 3300049743 Ga0501081_1286124 Ga0501081_1286124_38_442 127
42 3300053085 Ga0495619_0089870 Ga0495619_0089870_822_1226 127
43 3300005356 Ga0070674_100234513 Ga0070674_1002345132 128
44 3300005441 Ga0070700_100689726 Ga0070700_1006897262 128
45 3300005444 Ga0070694_101581895 Ga0070694_1015818951 128
46 3300005535 Ga0070684_100220099 Ga0070684_1002200992 128
47 3300005549 Ga0070704_100107160 Ga0070704_1001071602 128
48 3300005981 Ga0081538_10000337 Ga0081538_1000033728 128
49 3300005981 Ga0081538_10072022 Ga0081538_100720224 128
50 3300005983 Ga0081540_1248404 Ga0081540_12484041 128
51 3300006195 Ga0075366_10021054 Ga0075366_100210544 128
52 3300009148 Ga0105243_10635670 Ga0105243_106356702 128
53 3300009551 Ga0105238_10000150 Ga0105238_1000015015 128
54 3300013104 Ga0157370_11183427 Ga0157370_111834272 128
55 3300014326 Ga0157380_10877803 Ga0157380_108778031 128
56 3300014969 Ga0157376_12416357 Ga0157376_124163571 128
57 3300021384 Ga0213876_10022695 Ga0213876_100226953 128
58 3300021388 Ga0213875_10032846 Ga0213875_100328462 128
59 3300025924 Ga0207694_10111338 Ga0207694_101113382 128
60 3300025937 Ga0207669_10256540 Ga0207669_102565402 128
61 3300025938 Ga0207704_10986892 Ga0207704_109868922 128
62 3300028379 Ga0268266_10305634 Ga0268266_103056342 128
63 3300037312 Ga0395899_0117040 Ga0395899_0117040_147_572 128
64 3300037418 Ga0395900_0124531 Ga0395900_0124531_1059_1484 128
65 3300037466 Ga0395898_0666596 Ga0395898_0666596_403_828 128
66 3300037471 Ga0395905_0018006 Ga0395905_0018006_470_895 128
67 3300037853 Ga0436364_1061918 Ga0436364_1061918_407_829 128
68 3300038443 Ga0395901_0407440 Ga0395901_0407440_568_993 128
69 3300039437 Ga0436365_0467984 Ga0436365_0467984_599_1024 128
70 3300039437 Ga0436365_1891706 Ga0436365_1891706_503_928 128
71 3300048903 Ga0496100_0037895 Ga0496100_0037895_1986_2411 128
72 3300048904 Ga0496101_0125464 Ga0496101_0125464_142_567 128
73 3300048907 Ga0496104_0009700 Ga0496104_0009700_7809_8234 128
74 3300048907 Ga0496104_1133848 Ga0496104_1133848_215_640 128
75 3300048908 Ga0496105_0141991 Ga0496105_0141991_826_1251 128
76 3300048908 Ga0496105_0310354 Ga0496105_0310354_529_954 128
77 3300048909 Ga0496106_0096481 Ga0496106_0096481_1055_1480 128
78 3300048911 Ga0496108_0013229 Ga0496108_0013229_2579_3004 128
79 3300048912 Ga0496109_0002085 Ga0496109_0002085_4855_5280 128
80 3300048912 Ga0496109_1975518 Ga0496109_1975518_36_467 128
81 3300048913 Ga0496110_0020479 Ga0496110_0020479_2511_2936 128
82 3300048913 Ga0496110_0111419 Ga0496110_0111419_279_710 128
83 3300048914 Ga0496111_0000861 Ga0496111_0000861_12996_13421 128
84 3300048914 Ga0496111_0639959 Ga0496111_0639959_20_451 128
85 3300048915 Ga0496112_0201889 Ga0496112_0201889_470_895 128
86 3300048916 Ga0496113_0084981 Ga0496113_0084981_830_1255 128
87 3300048917 Ga0496114_0035667 Ga0496114_0035667_1564_1989 128
88 3300049589 Ga0501073_0186636 Ga0501073_0186636_263_682 128
89 3300050493 nmdc:mga0k408_18882_c1 nmdc:mga0k408_18882_c1_2896_3288 128
90 3300054114 Ga0501084_0001201 Ga0501084_0001201_15772_16191 128
91 3300006880 Ga0075429_101001337 Ga0075429_1010013372 129
92 3300009094 Ga0111539_10259491 Ga0111539_102594913 129
93 3300009094 Ga0111539_11585461 Ga0111539_115854611 129
94 3300027907 Ga0207428_10802676 Ga0207428_108026762 129
95 3300031548 Ga0307408_100084807 Ga0307408_1000848072 129
96 3300031824 Ga0307413_11008689 Ga0307413_110086892 129
97 3300032002 Ga0307416_100026786 Ga0307416_1000267864 129
98 3300037853 Ga0436364_1371345 Ga0436364_1371345_51_446 129
99 3300049574 Ga0501038_0670574 Ga0501038_0670574_305_715 129
100 3300050511 nmdc:mga08y16_405368_c1 nmdc:mga08y16_405368_c1_290_700 129
101 3300005539 Ga0068853_100374888 Ga0068853_1003748883 130
102 3300005548 Ga0070665_100938207 Ga0070665_1009382071 130
103 3300005617 Ga0068859_100109826 Ga0068859_1001098262 130
104 3300005841 Ga0068863_101438924 Ga0068863_1014389241 130
105 3300005842 Ga0068858_100000895 Ga0068858_1000008955 130
106 3300005844 Ga0068862_100363171 Ga0068862_1003631712 130
107 3300006048 Ga0075363_100654259 Ga0075363_1006542592 130
108 3300006880 Ga0075429_100214579 Ga0075429_1002145793 130
109 3300006931 Ga0097620_100109826 Ga0097620_1001098262 130
110 3300021384 Ga0213876_10001037 Ga0213876_100010379 130
111 3300025914 Ga0207671_10839933 Ga0207671_108399332 130
112 3300025927 Ga0207687_10253475 Ga0207687_102534752 130
113 3300026075 Ga0207708_10876355 Ga0207708_108763551 130
114 3300026089 Ga0207648_10081042 Ga0207648_100810423 130
115 3300028379 Ga0268266_10371382 Ga0268266_103713823 130
116 3300028381 Ga0268264_10047514 Ga0268264_100475141 130
117 3300028794 Ga0307515_10624186 Ga0307515_106241862 130
118 3300035724 Ga0373933_0399219 Ga0373933_0399219_151_570 130
119 3300036401 Ga0373937_0568228 Ga0373937_0568228_405_824 130
120 3300037466 Ga0395898_0020034 Ga0395898_0020034_4091_4522 130
121 3300039437 Ga0436365_1445277 Ga0436365_1445277_16645_17085 130
122 3300039453 Ga0436362_0569840 Ga0436362_0569840_45_485 130
123 3300046454 Ga0495592_0047421 Ga0495592_0047421_1006_1425 130
124 3300046462 Ga0495651_0028868 Ga0495651_0028868_2022_2441 130
125 3300046529 Ga0495652_0087695 Ga0495652_0087695_927_1346 130
126 3300046535 Ga0495586_0700899 Ga0495586_0700899_94_519 130
127 3300046543 Ga0495645_0007419 Ga0495645_0007419_3452_3871 130
128 3300046559 Ga0495667_0425978 Ga0495667_0425978_109_528 130
129 3300046663 Ga0495635_0117846 Ga0495635_0117846_316_735 130
130 3300046678 Ga0495599_0496740 Ga0495599_0496740_263_682 130
131 3300046680 Ga0495646_0008186 Ga0495646_0008186_3307_3726 130
132 3300046689 Ga0495613_0717594 Ga0495613_0717594_152_571 130
133 3300046809 Ga0495600_0604075 Ga0495600_0604075_152_571 130
134 3300047317 Ga0495604_0007171 Ga0495604_0007171_5275_5694 130
135 3300047322 Ga0495680_0640800 Ga0495680_0640800_276_695 130
136 3300047471 Ga0495684_0060178 Ga0495684_0060178_220_639 130
137 3300048088 Ga0495602_0043315 Ga0495602_0043315_1133_1552 130
138 3300053077 Ga0495601_0611838 Ga0495601_0611838_261_680 130
139 3300053084 Ga0495595_0239078 Ga0495595_0239078_79_498 130
140 3300025914 Ga0207671_11219417 Ga0207671_112194171 131
141 3300041512 Ga0451853_0210456 Ga0451853_0210456_25_420 131
142 3300044684 Ga0466966_0853406 Ga0466966_0853406_101_496 131
143 3300039437 Ga0436365_1127535 Ga0436365_1127535_3990_4466 132
144 3300045049 Ga0466959_0149683 Ga0466959_0149683_170_625 132
145 3300049576 Ga0501040_0949857 Ga0501040_0949857_117_521 132
146 3300049587 Ga0501071_0145444 Ga0501071_0145444_285_689 132
147 3300049741 Ga0501079_0249679 Ga0501079_0249679_39_443 132
148 3300049743 Ga0501081_1150210 Ga0501081_1150210_42_446 132
149 3300060353 Ga0501082_1154383 Ga0501082_1154383_185_589 132
150 3300061734 Ga0530510_0087505 Ga0530510_0087505_1031_1435 132
151 3300049572 Ga0501036_0427170 Ga0501036_0427170_267_683 133
152 3300049587 Ga0501071_0554622 Ga0501071_0554622_222_653 133
153 3300049588 Ga0501072_0770462 Ga0501072_0770462_264_671 133
154 3300049590 Ga0501074_1193386 Ga0501074_1193386_88_504 133
155 3300049743 Ga0501081_1234761 Ga0501081_1234761_55_477 133
156 3300009098 Ga0105245_10193348 Ga0105245_101933482 134
157 3300009176 Ga0105242_10805295 Ga0105242_108052951 134
158 3300009553 Ga0105249_10437179 Ga0105249_104371792 134
159 3300013296 Ga0157374_10013395 Ga0157374_100133953 134
160 3300013297 Ga0157378_10067135 Ga0157378_100671352 134
161 3300013306 Ga0163162_10004120 Ga0163162_100041206 134
162 3300013308 Ga0157375_10031339 Ga0157375_100313394 134
163 3300014968 Ga0157379_10177803 Ga0157379_101778031 134
164 3300025927 Ga0207687_10041894 Ga0207687_100418942 134
165 3300050510 nmdc:mga06r32_813545_c1 nmdc:mga06r32_813545_c1_339_809 134
166 3300014325 Ga0163163_10331964 Ga0163163_103319642 139
167 3300026088 Ga0207641_10547835 Ga0207641_105478352 139
168 3300041486 Ga0451807_1914825 Ga0451807_1914825_50_472 139
169 3300005347 Ga0070668_100908521 Ga0070668_1009085211 140
170 3300005356 Ga0070674_100734320 Ga0070674_1007343201 140
171 3300005719 Ga0068861_100032759 Ga0068861_1000327593 140
172 3300005844 Ga0068862_100646126 Ga0068862_1006461262 140
173 3300006237 Ga0097621_100294774 Ga0097621_1002947742 140
174 3300009553 Ga0105249_10018348 Ga0105249_100183483 140
175 3300014326 Ga0157380_10012977 Ga0157380_100129777 140
176 3300014326 Ga0157380_10149498 Ga0157380_101494983 140
177 3300025972 Ga0207668_10519200 Ga0207668_105192002 140
178 3300026118 Ga0207675_100020978 Ga0207675_1000209783 140
179 3300028380 Ga0268265_10631905 Ga0268265_106319052 140
180 3300003323 rootH1_10050232 rootH1_100502322 141
181 3300044735 Ga0466968_0504914 Ga0466968_0504914_71_526 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

143

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7r-assembly1.cif.gz_B conserved domain protein 0.7761 4 133
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7732 7 133
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7683 8 132
2i7r-assembly1.cif.gz_B conserved domain protein 0.7646 4 133
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7619 4 132
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9312 81 132 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9173 81 131 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.87 81 130 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8394 81 132 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.815 81 133 3.30.720.110
ID Description Score Start End GO Terms
AF-Q1DBE4-F1-model_v4 Glyoxalase family protein 0.9522 4 138
AF-A0A848LFY2-F1-model_v4 VOC family protein 0.9465 1 137
AF-A0A2V6RCJ0-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9361 3 132 GO:0051213
AF-A0A352VRT7-F1-model_v4 VOC domain-containing protein 0.9338 5 135
AF-A0A5M4A801-F1-model_v4 VOC domain-containing protein 0.9296 77 132

Feature Viewer

pLDDT pTM Quality
87.36 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map