F277590

General Info

Members Datasets Scaffolds Average Seq Length
181 91 181 108

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10077012|Ga0265338_100770122
Length 118
Sequence LSLPVIANESMNPAPLYNQLDIYLIAAAFLLAIGIYGLIRRRTLIGMLISGELIFSAASLNLMAFNRFTARDPVVGQIFVLFLMGLAAAEVAIALSIIVAVYRNYRSVTTRELSELKG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
13 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
26 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
27 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
28 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
29 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
30 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
31 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
32 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
33 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
34 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
35 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
36 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
42 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
43 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
50 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
51 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
52 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
69 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
79 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
85 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.45
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10123107 3300005327 Bacteria 2156
2 Ga0070666_10897927 3300005335 Bacteria 655
3 Ga0070689_100066327 3300005340 Unclassified 2812
4 Ga0070661_100794083 3300005344 Unclassified 776
5 Ga0070668_101592284 3300005347 Unclassified 598
6 Ga0070713_100067981 3300005436 Bacteria 3002
7 Ga0070679_100553632 3300005530 Unclassified 1094
8 Ga0068859_101362540 3300005617 Bacteria 782
9 Ga0068861_100800861 3300005719 Bacteria 884
10 Ga0068858_100549040 3300005842 Bacteria 1118
11 Ga0070717_10616716 3300006028 Unclassified 984
12 Ga0068871_101149403 3300006358 Unclassified 727
13 Ga0068871_101820416 3300006358 Unclassified 578
14 Ga0097620_101362946 3300006931 Bacteria 782
15 Ga0105240_10002417 3300009093 Bacteria 30006
16 Ga0105240_10258674 3300009093 Unclassified 2009
17 Ga0157374_10061697 3300013296 Bacteria 3512
18 Ga0157375_10486297 3300013308 Bacteria 1399
19 Ga0207705_10101256 3300025909 Bacteria 2119
20 Ga0207695_10025137 3300025913 Bacteria 6678
21 Ga0207695_10325696 3300025913 Unclassified 1425
22 Ga0207652_11229719 3300025921 Unclassified 651
23 Ga0207700_10281352 3300025928 Bacteria 1431
24 Ga0207670_10150626 3300025936 Unclassified 1726
25 Ga0207703_10313330 3300026035 Bacteria 1435
26 Ga0207641_12408925 3300026088 Bacteria 525
27 Ga0207675_101521779 3300026118 Bacteria 690
28 Ga0265337_1104796 3300028556 Bacteria 769
29 Ga0265326_10107429 3300028558 Unclassified 792
30 Ga0265319_1006605 3300028563 Bacteria 5352
31 Ga0265334_10004098 3300028573 Bacteria 6535
32 Ga0265334_10072386 3300028573 Bacteria 1282
33 Ga0265323_10000078 3300028653 Bacteria 54941
34 Ga0265323_10000525 3300028653 Bacteria 21261
35 Ga0265323_10001066 3300028653 Bacteria 14201
36 Ga0265323_10001853 3300028653 Bacteria 10010
37 Ga0265323_10011932 3300028653 Bacteria 3492
38 Ga0265323_10014211 3300028653 Bacteria 3159
39 Ga0265323_10017545 3300028653 Bacteria 2778
40 Ga0265323_10024200 3300028653 Bacteria 2311
41 Ga0265323_10043240 3300028653 Bacteria 1627
42 Ga0265323_10082741 3300028653 Bacteria 1082
43 Ga0265323_10115392 3300028653 Bacteria 878
44 Ga0265322_10000870 3300028654 Bacteria 10720
45 Ga0265322_10161746 3300028654 Bacteria 640
46 Ga0265322_10211091 3300028654 Bacteria 556
47 Ga0265338_10041746 3300028800 Bacteria 4286
48 Ga0265338_10077012 3300028800 Bacteria 2821
49 Ga0265338_10456872 3300028800 Bacteria 904
50 Ga0265324_10252364 3300029957 Unclassified 599
51 Ga0265324_10340939 3300029957 Unclassified 511
52 Ga0265330_10010402 3300031235 Bacteria 4387
53 Ga0265330_10023806 3300031235 Bacteria 2780
54 Ga0265330_10079822 3300031235 Bacteria 1410
55 Ga0265330_10116113 3300031235 Bacteria 1141
56 Ga0265332_10155845 3300031238 Unclassified 955
57 Ga0265328_10018664 3300031239 Bacteria 2671
58 Ga0265328_10134195 3300031239 Bacteria 927
59 Ga0265328_10139429 3300031239 Bacteria 910
60 Ga0265320_10032342 3300031240 Bacteria 2680
61 Ga0265325_10120238 3300031241 Bacteria 1267
62 Ga0265329_10002096 3300031242 Bacteria 9277
63 Ga0265329_10033543 3300031242 Unclassified 1660
64 Ga0265329_10075103 3300031242 Bacteria 1069
65 Ga0265340_10258118 3300031247 Unclassified 776
66 Ga0265340_10540983 3300031247 Unclassified 513
67 Ga0265340_10560573 3300031247 Unclassified 503
68 Ga0265316_10005522 3300031344 Bacteria 12267
69 Ga0265316_10010863 3300031344 Bacteria 8268
70 Ga0265316_10020682 3300031344 Bacteria 5594
71 Ga0265316_10062613 3300031344 Bacteria 2887
72 Ga0265316_10131535 3300031344 Unclassified 1884
73 Ga0265316_10143742 3300031344 Bacteria 1790
74 Ga0265316_10157477 3300031344 Unclassified 1699
75 Ga0265316_10386462 3300031344 Bacteria 1009
76 Ga0265313_10002649 3300031595 Bacteria 15218
77 Ga0265314_10000827 3300031711 Bacteria 36791
78 Ga0265314_10136142 3300031711 Unclassified 1525
79 Ga0265314_10189332 3300031711 Unclassified 1226
80 Ga0265342_10006443 3300031712 Bacteria 8740
81 Ga0265342_10022942 3300031712 Bacteria 3958
82 Ga0265342_10083253 3300031712 Bacteria 1844
83 Ga0265342_10083465 3300031712 Bacteria 1841
84 Ga0265342_10236659 3300031712 Unclassified 979
85 Ga0265342_10434527 3300031712 Unclassified 675
86 Ga0316578_10190977 3300031728 Bacteria 1234
87 Ga0316583_10096490 3300032133 Bacteria 1031
88 Ga0316585_10161450 3300032137 Bacteria 740
89 Ga0316580_10134153 3300032139 Unclassified 759
90 Ga0307507_10418836 3300033179 Bacteria 753
91 Ga0373926_0017949 3300035083 Bacteria 2431
92 Ga0373951_0038774 3300035091 Unclassified 1143
93 Ga0373945_0325541 3300035116 Unclassified 662
94 Ga0373943_0038480 3300035170 Bacteria 2300
95 Ga0316574_0237745 3300035398 Bacteria 1165
96 Ga0373935_0010935 3300035692 Bacteria 5448
97 Ga0373927_0002558 3300035695 Bacteria 13250
98 Ga0373927_0348049 3300035695 Unclassified 977
99 Ga0373927_0514694 3300035695 Unclassified 791
100 Ga0373947_0009151 3300035725 Bacteria 5693
101 Ga0373937_0757267 3300036401 Unclassified 919
102 Ga0316582_0627738 3300036647 Unclassified 739
103 Ga0316584_0016808 3300036712 Bacteria 5250
104 Ga0373925_0003541 3300037068 Bacteria 12045
105 Ga0373925_0252481 3300037068 Bacteria 1415
106 Ga0373925_0564159 3300037068 Bacteria 937
107 Ga0451577_0000245 3300042876 Bacteria 106824
108 Ga0451577_0001284 3300042876 Bacteria 34527
109 Ga0451577_0005240 3300042876 Bacteria 13337
110 Ga0451577_0022140 3300042876 Bacteria 5804
111 Ga0451577_0050020 3300042876 Bacteria 3731
112 Ga0451577_0062672 3300042876 Bacteria 3316
113 Ga0451577_0132554 3300042876 Bacteria 2236
114 Ga0451577_0590505 3300042876 Bacteria 1008
115 Ga0451577_0713927 3300042876 Unclassified 908
116 Ga0451577_0865148 3300042876 Unclassified 815
117 Ga0451577_1358339 3300042876 Bacteria 631
118 Ga0466969_0288454 3300044656 Bacteria 743
119 Ga0453683_0242090 3300044673 Unclassified 1149
120 Ga0453683_0764342 3300044673 Bacteria 635
121 Ga0466966_0247879 3300044684 Bacteria 1073
122 Ga0466961_0064790 3300044693 Bacteria 2322
123 Ga0453684_0000001 3300044712 Bacteria 2623166
124 Ga0453684_0000807 3300044712 Bacteria 106824
125 Ga0453684_0005655 3300044712 Bacteria 24563
126 Ga0453684_0006016 3300044712 Bacteria 23491
127 Ga0453684_0014193 3300044712 Bacteria 12792
128 Ga0453684_0018850 3300044712 Bacteria 10558
129 Ga0453684_0135688 3300044712 Bacteria 2947
130 Ga0453684_0180444 3300044712 Bacteria 2479
131 Ga0453684_0330754 3300044712 Bacteria 1723
132 Ga0453684_0409652 3300044712 Bacteria 1517
133 Ga0453684_0678093 3300044712 Bacteria 1122
134 Ga0453684_0696532 3300044712 Bacteria 1104
135 Ga0453684_1116570 3300044712 Bacteria 832
136 Ga0453684_1281640 3300044712 Unclassified 765
137 Ga0453684_1916222 3300044712 Unclassified 599
138 Ga0451576_0000538 3300045051 Bacteria 81512
139 Ga0451576_0004789 3300045051 Bacteria 17345
140 Ga0451576_0005068 3300045051 Bacteria 16701
141 Ga0451576_0020773 3300045051 Bacteria 7147
142 Ga0451576_0116576 3300045051 Bacteria 2781
143 Ga0451576_0189600 3300045051 Bacteria 2147
144 Ga0451576_0286163 3300045051 Bacteria 1723
145 Ga0451576_0293164 3300045051 Bacteria 1701
146 Ga0451576_0396776 3300045051 Bacteria 1446
147 Ga0451576_0565058 3300045051 Bacteria 1195
148 Ga0451576_0844600 3300045051 Unclassified 961
149 Ga0451576_1587146 3300045051 Unclassified 679
150 Ga0451576_2697443 3300045051 Bacteria 506
151 Ga0495641_0391061 3300046461 Bacteria 630
152 Ga0495582_0203280 3300046473 Bacteria 1131
153 Ga0495662_0079158 3300046476 Bacteria 1598
154 Ga0495618_0094627 3300046514 Bacteria 1910
155 Ga0495630_0000339 3300046517 Bacteria 37123
156 Ga0495630_0015368 3300046517 Bacteria 5589
157 Ga0495630_0955752 3300046517 Bacteria 652
158 Ga0495666_0004195 3300046526 Bacteria 7269
159 Ga0495665_0031837 3300046531 Bacteria 2822
160 Ga0495640_0133596 3300046533 Bacteria 1604
161 Ga0495586_0000228 3300046535 Bacteria 37266
162 Ga0495586_0551684 3300046535 Unclassified 665
163 Ga0495586_0862642 3300046535 Unclassified 522
164 Ga0495634_0048407 3300046642 Bacteria 2862
165 Ga0495647_0047639 3300046681 Bacteria 1655
166 Ga0495658_0059509 3300046683 Bacteria 2188
167 Ga0495624_0505904 3300046690 Bacteria 723
168 Ga0495581_0135722 3300047315 Bacteria 1434
169 Ga0495581_0530670 3300047315 Unclassified 684
170 Ga0495674_0014120 3300047319 Bacteria 7481
171 Ga0495676_0067062 3300047321 Bacteria 2778
172 Ga0495676_0199165 3300047321 Bacteria 1392
173 Ga0495684_0384576 3300047471 Bacteria 989
174 Ga0495614_0344443 3300048089 Bacteria 694
175 Ga0501031_0678063 3300049568 Bacteria 662
176 Ga0501036_0810112 3300049572 Bacteria 771
177 Ga0501047_0592381 3300049581 Bacteria 931
178 Ga0501070_0255460 3300049586 Bacteria 1433
179 Ga0501083_0009683 3300049744 Bacteria 6806
180 Ga0501083_0152411 3300049744 Bacteria 1513
181 Ga0501044_0005151 3300049823 Bacteria 14571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1358339 Ga0451577_1358339_251_538 95
2 3300042876 Ga0451577_0050020 Ga0451577_0050020_1028_1345 105
3 3300005340 Ga0070689_100066327 Ga0070689_1000663274 106
4 3300005347 Ga0070668_101592284 Ga0070668_1015922842 106
5 3300009093 Ga0105240_10258674 Ga0105240_102586744 106
6 3300025913 Ga0207695_10325696 Ga0207695_103256962 106
7 3300025936 Ga0207670_10150626 Ga0207670_101506262 106
8 3300042876 Ga0451577_0713927 Ga0451577_0713927_521_841 106
9 3300044673 Ga0453683_0242090 Ga0453683_0242090_255_575 106
10 3300044712 Ga0453684_0135688 Ga0453684_0135688_519_839 106
11 3300044712 Ga0453684_0330754 Ga0453684_0330754_608_928 106
12 3300044712 Ga0453684_1916222 Ga0453684_1916222_177_497 106
13 3300045051 Ga0451576_0116576 Ga0451576_0116576_2242_2562 106
14 3300045051 Ga0451576_0189600 Ga0451576_0189600_1032_1352 106
15 3300045051 Ga0451576_0286163 Ga0451576_0286163_1306_1626 106
16 3300045051 Ga0451576_0565058 Ga0451576_0565058_243_563 106
17 3300046535 Ga0495586_0862642 Ga0495586_0862642_18_338 106
18 3300005335 Ga0070666_10897927 Ga0070666_108979272 107
19 3300005617 Ga0068859_101362540 Ga0068859_1013625401 107
20 3300005719 Ga0068861_100800861 Ga0068861_1008008612 107
21 3300005842 Ga0068858_100549040 Ga0068858_1005490402 107
22 3300006931 Ga0097620_101362946 Ga0097620_1013629461 107
23 3300013308 Ga0157375_10486297 Ga0157375_104862972 107
24 3300026035 Ga0207703_10313330 Ga0207703_103133303 107
25 3300026088 Ga0207641_12408925 Ga0207641_124089251 107
26 3300026118 Ga0207675_101521779 Ga0207675_1015217792 107
27 3300028563 Ga0265319_1006605 Ga0265319_10066055 107
28 3300028653 Ga0265323_10000525 Ga0265323_1000052517 107
29 3300028654 Ga0265322_10000870 Ga0265322_100008706 107
30 3300028654 Ga0265322_10161746 Ga0265322_101617462 107
31 3300029957 Ga0265324_10340939 Ga0265324_103409392 107
32 3300031238 Ga0265332_10155845 Ga0265332_101558452 107
33 3300031239 Ga0265328_10139429 Ga0265328_101394292 107
34 3300031240 Ga0265320_10032342 Ga0265320_100323424 107
35 3300031241 Ga0265325_10120238 Ga0265325_101202381 107
36 3300031242 Ga0265329_10033543 Ga0265329_100335433 107
37 3300031242 Ga0265329_10075103 Ga0265329_100751032 107
38 3300031247 Ga0265340_10258118 Ga0265340_102581181 107
39 3300031344 Ga0265316_10131535 Ga0265316_101315352 107
40 3300031344 Ga0265316_10157477 Ga0265316_101574772 107
41 3300031595 Ga0265313_10002649 Ga0265313_1000264915 107
42 3300031711 Ga0265314_10136142 Ga0265314_101361422 107
43 3300031712 Ga0265342_10083465 Ga0265342_100834652 107
44 3300037068 Ga0373925_0252481 Ga0373925_0252481_1036_1359 107
45 3300042876 Ga0451577_0001284 Ga0451577_0001284_15059_15382 107
46 3300042876 Ga0451577_0590505 Ga0451577_0590505_396_719 107
47 3300042876 Ga0451577_0865148 Ga0451577_0865148_281_604 107
48 3300044712 Ga0453684_0409652 Ga0453684_0409652_213_536 107
49 3300044712 Ga0453684_1116570 Ga0453684_1116570_370_693 107
50 3300045051 Ga0451576_0396776 Ga0451576_0396776_198_521 107
51 3300045051 Ga0451576_0844600 Ga0451576_0844600_403_726 107
52 3300005327 Ga0070658_10123107 Ga0070658_101231072 108
53 3300005344 Ga0070661_100794083 Ga0070661_1007940832 108
54 3300005436 Ga0070713_100067981 Ga0070713_1000679813 108
55 3300005530 Ga0070679_100553632 Ga0070679_1005536322 108
56 3300006028 Ga0070717_10616716 Ga0070717_106167162 108
57 3300006358 Ga0068871_101149403 Ga0068871_1011494032 108
58 3300006358 Ga0068871_101820416 Ga0068871_1018204162 108
59 3300009093 Ga0105240_10002417 Ga0105240_100024174 108
60 3300013296 Ga0157374_10061697 Ga0157374_100616974 108
61 3300025909 Ga0207705_10101256 Ga0207705_101012562 108
62 3300025913 Ga0207695_10025137 Ga0207695_100251377 108
63 3300025921 Ga0207652_11229719 Ga0207652_112297192 108
64 3300025928 Ga0207700_10281352 Ga0207700_102813522 108
65 3300028556 Ga0265337_1104796 Ga0265337_11047962 108
66 3300028558 Ga0265326_10107429 Ga0265326_101074292 108
67 3300028573 Ga0265334_10004098 Ga0265334_100040986 108
68 3300028573 Ga0265334_10072386 Ga0265334_100723862 108
69 3300028653 Ga0265323_10000078 Ga0265323_1000007846 108
70 3300028653 Ga0265323_10001066 Ga0265323_1000106611 108
71 3300028653 Ga0265323_10001853 Ga0265323_1000185310 108
72 3300028653 Ga0265323_10011932 Ga0265323_100119322 108
73 3300028653 Ga0265323_10014211 Ga0265323_100142114 108
74 3300028653 Ga0265323_10017545 Ga0265323_100175454 108
75 3300028653 Ga0265323_10024200 Ga0265323_100242004 108
76 3300028653 Ga0265323_10043240 Ga0265323_100432402 108
77 3300028653 Ga0265323_10082741 Ga0265323_100827412 108
78 3300028653 Ga0265323_10115392 Ga0265323_101153921 108
79 3300028654 Ga0265322_10211091 Ga0265322_102110912 108
80 3300028800 Ga0265338_10041746 Ga0265338_100417464 108
81 3300028800 Ga0265338_10077012 Ga0265338_100770122 108
82 3300028800 Ga0265338_10456872 Ga0265338_104568722 108
83 3300029957 Ga0265324_10252364 Ga0265324_102523642 108
84 3300031235 Ga0265330_10010402 Ga0265330_100104025 108
85 3300031235 Ga0265330_10023806 Ga0265330_100238064 108
86 3300031235 Ga0265330_10079822 Ga0265330_100798222 108
87 3300031235 Ga0265330_10116113 Ga0265330_101161131 108
88 3300031239 Ga0265328_10018664 Ga0265328_100186644 108
89 3300031239 Ga0265328_10134195 Ga0265328_101341952 108
90 3300031242 Ga0265329_10002096 Ga0265329_100020962 108
91 3300031247 Ga0265340_10540983 Ga0265340_105409831 108
92 3300031247 Ga0265340_10560573 Ga0265340_105605732 108
93 3300031344 Ga0265316_10005522 Ga0265316_100055224 108
94 3300031344 Ga0265316_10010863 Ga0265316_100108637 108
95 3300031344 Ga0265316_10020682 Ga0265316_100206825 108
96 3300031344 Ga0265316_10062613 Ga0265316_100626133 108
97 3300031344 Ga0265316_10143742 Ga0265316_101437422 108
98 3300031344 Ga0265316_10386462 Ga0265316_103864622 108
99 3300031711 Ga0265314_10000827 Ga0265314_1000082714 108
100 3300031711 Ga0265314_10189332 Ga0265314_101893322 108
101 3300031712 Ga0265342_10006443 Ga0265342_100064438 108
102 3300031712 Ga0265342_10022942 Ga0265342_100229422 108
103 3300031712 Ga0265342_10083253 Ga0265342_100832532 108
104 3300031712 Ga0265342_10236659 Ga0265342_102366592 108
105 3300031712 Ga0265342_10434527 Ga0265342_104345272 108
106 3300031728 Ga0316578_10190977 Ga0316578_101909772 108
107 3300032133 Ga0316583_10096490 Ga0316583_100964902 108
108 3300032137 Ga0316585_10161450 Ga0316585_101614502 108
109 3300032139 Ga0316580_10134153 Ga0316580_101341532 108
110 3300033179 Ga0307507_10418836 Ga0307507_104188362 108
111 3300035083 Ga0373926_0017949 Ga0373926_0017949_1655_1981 108
112 3300035091 Ga0373951_0038774 Ga0373951_0038774_66_392 108
113 3300035116 Ga0373945_0325541 Ga0373945_0325541_257_583 108
114 3300035170 Ga0373943_0038480 Ga0373943_0038480_886_1212 108
115 3300035398 Ga0316574_0237745 Ga0316574_0237745_503_829 108
116 3300035692 Ga0373935_0010935 Ga0373935_0010935_357_683 108
117 3300035695 Ga0373927_0002558 Ga0373927_0002558_1655_1981 108
118 3300035695 Ga0373927_0348049 Ga0373927_0348049_328_654 108
119 3300035695 Ga0373927_0514694 Ga0373927_0514694_320_646 108
120 3300035725 Ga0373947_0009151 Ga0373947_0009151_746_1072 108
121 3300036401 Ga0373937_0757267 Ga0373937_0757267_420_746 108
122 3300036647 Ga0316582_0627738 Ga0316582_0627738_83_409 108
123 3300036712 Ga0316584_0016808 Ga0316584_0016808_1850_2176 108
124 3300037068 Ga0373925_0003541 Ga0373925_0003541_7241_7567 108
125 3300037068 Ga0373925_0564159 Ga0373925_0564159_43_369 108
126 3300042876 Ga0451577_0000245 Ga0451577_0000245_68306_68632 108
127 3300042876 Ga0451577_0005240 Ga0451577_0005240_7837_8163 108
128 3300042876 Ga0451577_0022140 Ga0451577_0022140_789_1118 108
129 3300042876 Ga0451577_0062672 Ga0451577_0062672_1446_1772 108
130 3300042876 Ga0451577_0132554 Ga0451577_0132554_1015_1356 108
131 3300044656 Ga0466969_0288454 Ga0466969_0288454_357_683 108
132 3300044673 Ga0453683_0764342 Ga0453683_0764342_160_501 108
133 3300044684 Ga0466966_0247879 Ga0466966_0247879_343_669 108
134 3300044693 Ga0466961_0064790 Ga0466961_0064790_1341_1667 108
135 3300044712 Ga0453684_0000001 Ga0453684_0000001_294982_295323 108
136 3300044712 Ga0453684_0000807 Ga0453684_0000807_38193_38519 108
137 3300044712 Ga0453684_0005655 Ga0453684_0005655_381_707 108
138 3300044712 Ga0453684_0006016 Ga0453684_0006016_7951_8277 108
139 3300044712 Ga0453684_0014193 Ga0453684_0014193_699_1025 108
140 3300044712 Ga0453684_0018850 Ga0453684_0018850_417_743 108
141 3300044712 Ga0453684_0180444 Ga0453684_0180444_1274_1603 108
142 3300044712 Ga0453684_0678093 Ga0453684_0678093_143_469 108
143 3300044712 Ga0453684_0696532 Ga0453684_0696532_113_439 108
144 3300044712 Ga0453684_1281640 Ga0453684_1281640_387_713 108
145 3300045051 Ga0451576_0000538 Ga0451576_0000538_8095_8421 108
146 3300045051 Ga0451576_0004789 Ga0451576_0004789_3419_3745 108
147 3300045051 Ga0451576_0005068 Ga0451576_0005068_8100_8429 108
148 3300045051 Ga0451576_0020773 Ga0451576_0020773_4166_4495 108
149 3300045051 Ga0451576_0293164 Ga0451576_0293164_261_587 108
150 3300045051 Ga0451576_1587146 Ga0451576_1587146_165_491 108
151 3300045051 Ga0451576_2697443 Ga0451576_2697443_128_454 108
152 3300046461 Ga0495641_0391061 Ga0495641_0391061_43_375 108
153 3300046473 Ga0495582_0203280 Ga0495582_0203280_633_965 108
154 3300046476 Ga0495662_0079158 Ga0495662_0079158_860_1192 108
155 3300046514 Ga0495618_0094627 Ga0495618_0094627_1010_1342 108
156 3300046517 Ga0495630_0000339 Ga0495630_0000339_29585_29917 108
157 3300046517 Ga0495630_0015368 Ga0495630_0015368_468_794 108
158 3300046517 Ga0495630_0955752 Ga0495630_0955752_169_495 108
159 3300046526 Ga0495666_0004195 Ga0495666_0004195_1792_2124 108
160 3300046531 Ga0495665_0031837 Ga0495665_0031837_2120_2452 108
161 3300046533 Ga0495640_0133596 Ga0495640_0133596_311_643 108
162 3300046535 Ga0495586_0000228 Ga0495586_0000228_7350_7682 108
163 3300046535 Ga0495586_0551684 Ga0495586_0551684_13_345 108
164 3300046642 Ga0495634_0048407 Ga0495634_0048407_20_352 108
165 3300046681 Ga0495647_0047639 Ga0495647_0047639_450_782 108
166 3300046683 Ga0495658_0059509 Ga0495658_0059509_1581_1913 108
167 3300046690 Ga0495624_0505904 Ga0495624_0505904_207_539 108
168 3300047315 Ga0495581_0135722 Ga0495581_0135722_821_1153 108
169 3300047315 Ga0495581_0530670 Ga0495581_0530670_170_496 108
170 3300047319 Ga0495674_0014120 Ga0495674_0014120_5729_6061 108
171 3300047321 Ga0495676_0067062 Ga0495676_0067062_1740_2066 108
172 3300047321 Ga0495676_0199165 Ga0495676_0199165_540_872 108
173 3300047471 Ga0495684_0384576 Ga0495684_0384576_322_654 108
174 3300048089 Ga0495614_0344443 Ga0495614_0344443_106_438 108
175 3300049568 Ga0501031_0678063 Ga0501031_0678063_27_353 108
176 3300049572 Ga0501036_0810112 Ga0501036_0810112_100_426 108
177 3300049581 Ga0501047_0592381 Ga0501047_0592381_87_413 108
178 3300049586 Ga0501070_0255460 Ga0501070_0255460_476_802 108
179 3300049744 Ga0501083_0009683 Ga0501083_0009683_1575_1901 108
180 3300049744 Ga0501083_0152411 Ga0501083_0152411_61_387 108
181 3300049823 Ga0501044_0005151 Ga0501044_0005151_10502_10828 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

22

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wg5-assembly1.cif.gz_E cyclic electron transport supercomplex ndh-psi from arabidopsis 0.896 14 94
7wff-assembly1.cif.gz_E subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis 0.8872 14 94
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8755 10 55
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.8591 10 93
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.852 9 93
ID Description Score Start End Superfamily
6nbqE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8441 9 94 1.10.287.3510
6nbxE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8407 9 94 1.10.287.3510
6humE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8398 9 94 1.10.287.3510
af_Q80Z70_171_425_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8276 10 57 1.25.40.10
af_Q58706_15_126_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8028 13 96 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A1G3VWP2-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9702 8 83 GO:0005886
GO:0016651
GO:0030964
GO:0042773
AF-A0A7Z9WXY9-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9611 3 90 GO:0016020
AF-A6G551-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9533 9 94 GO:0016020
AF-A0A831KBH4-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9448 13 80 GO:0016651
GO:0030964
GO:0042773
AF-A0A7I8JPD9-F1-model_v4 Uncharacterized protein 0.9405 10 83 GO:0016651
GO:0030964
GO:0042773
GO:0048038

Feature Viewer

pLDDT pTM Quality
88.07 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map