F277572

General Info

Members Datasets Scaffolds Average Seq Length
181 117 181 129

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1039586|Ga0265319_10395861
Length 141
Sequence MDPVRSPFVCYNLDMSTAQNIQVDKFINDLPAWQQKVCLRVRLLIHEAEPEIQETIKRGDRPYFVLNGNVCALQATKDHINIFIYDPIAPDPQHIINQGHDNETARSIQIYQDDQINEKAFKQLVSAVSSNNRAGGWRKLK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
64 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
67 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
110 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
111 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
114 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
115 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
116 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
117 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 0
Rhizoplane 4.42
Rhizosphere 86.19
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10200909 3300003320 Bacteria 2007
2 rootL2_10185671 3300003322 Bacteria 1070
3 Ga0070666_10011238 3300005335 Bacteria 5616
4 Ga0070682_100723136 3300005337 Bacteria 801
5 Ga0070668_100126879 3300005347 Bacteria 2044
6 Ga0070671_100028206 3300005355 Bacteria 4622
7 Ga0070681_10711920 3300005458 Bacteria 920
8 Ga0068867_100022676 3300005459 Bacteria 4490
9 Ga0070696_100142227 3300005546 Bacteria 1755
10 Ga0068855_100000001 3300005563 Bacteria 818777
11 Ga0068855_100000002 3300005563 Bacteria 616881
12 Ga0068855_100014049 3300005563 Bacteria 9652
13 Ga0068855_100037001 3300005563 Bacteria 5807
14 Ga0068857_100026629 3300005577 Bacteria 5097
15 Ga0068857_100047451 3300005577 Bacteria 3813
16 Ga0068857_102013044 3300005577 Unclassified 566
17 Ga0068856_100000001 3300005614 Bacteria 565602
18 Ga0068856_100001259 3300005614 Bacteria 26642
19 Ga0068856_100029359 3300005614 Bacteria 5372
20 Ga0068856_100035296 3300005614 Bacteria 4900
21 Ga0068856_100532821 3300005614 Bacteria 1196
22 Ga0070702_100556773 3300005615 Bacteria 852
23 Ga0068852_100000001 3300005616 Bacteria 716526
24 Ga0068852_100037974 3300005616 Bacteria 4044
25 Ga0068852_100482270 3300005616 Bacteria 1232
26 Ga0068851_10393049 3300005834 Bacteria 815
27 Ga0068863_100090060 3300005841 Bacteria 2909
28 Ga0068858_100890019 3300005842 Unclassified 870
29 Ga0075365_10000060 3300006038 Bacteria 32892
30 Ga0075366_10141912 3300006195 Bacteria 1452
31 Ga0097621_101004727 3300006237 Unclassified 780
32 Ga0068871_100000090 3300006358 Bacteria 52749
33 Ga0068871_100224044 3300006358 Bacteria 1630
34 Ga0068865_100187109 3300006881 Bacteria 1598
35 Ga0105240_10000003 3300009093 Bacteria 1183681
36 Ga0105240_10000102 3300009093 Bacteria 174846
37 Ga0105240_10000489 3300009093 Bacteria 73274
38 Ga0105240_12221653 3300009093 Bacteria 569
39 Ga0105245_10000002 3300009098 Bacteria 634374
40 Ga0105245_10000118 3300009098 Bacteria 76624
41 Ga0105243_10000001 3300009148 Bacteria 1156578
42 Ga0105241_10000003 3300009174 Bacteria 839043
43 Ga0105241_10000836 3300009174 Bacteria 23346
44 Ga0105241_10089652 3300009174 Bacteria 2423
45 Ga0105242_10000272 3300009176 Bacteria 41181
46 Ga0105242_11691515 3300009176 Bacteria 669
47 Ga0105237_10000002 3300009545 Bacteria 702357
48 Ga0105237_10002864 3300009545 Bacteria 20969
49 Ga0105237_10020987 3300009545 Bacteria 6723
50 Ga0105238_10000478 3300009551 Bacteria 42007
51 Ga0105238_10010565 3300009551 Bacteria 9270
52 Ga0105238_11177536 3300009551 Archaea 790
53 Ga0105239_10001744 3300010375 Bacteria 28674
54 Ga0105239_10011818 3300010375 Bacteria 9744
55 Ga0105239_10014156 3300010375 Bacteria 8851
56 Ga0105239_10431945 3300010375 Archaea 1493
57 Ga0105239_12451402 3300010375 Bacteria 608
58 Ga0105246_10788123 3300011119 Unclassified 842
59 Ga0157370_10001144 3300013104 Bacteria 33084
60 Ga0157369_10002230 3300013105 Bacteria 23335
61 Ga0157369_10399084 3300013105 Unclassified 1427
62 Ga0157374_10000018 3300013296 Bacteria 286683
63 Ga0157374_10328356 3300013296 Bacteria 1517
64 Ga0157372_10056118 3300013307 Bacteria 4401
65 Ga0157372_10870485 3300013307 Unclassified 1046
66 Ga0157372_10898856 3300013307 Unclassified 1028
67 Ga0163163_10254381 3300014325 Bacteria 1807
68 Ga0163163_10614380 3300014325 Bacteria 1150
69 Ga0207656_10262839 3300025321 Bacteria 848
70 Ga0207680_10007976 3300025903 Bacteria 5180
71 Ga0207705_10002124 3300025909 Bacteria 15378
72 Ga0207654_10000002 3300025911 Bacteria 1460142
73 Ga0207654_10004106 3300025911 Bacteria 7337
74 Ga0207654_10156371 3300025911 Bacteria 1468
75 Ga0207707_10020893 3300025912 Bacteria 5718
76 Ga0207695_10000005 3300025913 Bacteria 1196715
77 Ga0207695_10000109 3300025913 Bacteria 251757
78 Ga0207695_10035794 3300025913 Bacteria 5377
79 Ga0207695_11167888 3300025913 Bacteria 650
80 Ga0207671_10000008 3300025914 Bacteria 798229
81 Ga0207671_10043384 3300025914 Bacteria 3326
82 Ga0207671_10091343 3300025914 Bacteria 2294
83 Ga0207694_10000590 3300025924 Bacteria 32776
84 Ga0207694_10010719 3300025924 Bacteria 6921
85 Ga0207687_10000001 3300025927 Bacteria 1130810
86 Ga0207687_10000346 3300025927 Bacteria 30801
87 Ga0207644_10047944 3300025931 Bacteria 3051
88 Ga0207686_10000001 3300025934 Bacteria 1169580
89 Ga0207709_10000002 3300025935 Bacteria 1171536
90 Ga0207709_10803477 3300025935 Bacteria 759
91 Ga0207667_10000003 3300025949 Bacteria 822935
92 Ga0207667_10000005 3300025949 Bacteria 715503
93 Ga0207667_10029098 3300025949 Bacteria 5994
94 Ga0207667_10055328 3300025949 Bacteria 4171
95 Ga0207668_10100695 3300025972 Bacteria 2146
96 Ga0207703_10640495 3300026035 Bacteria 1008
97 Ga0207702_10000001 3300026078 Bacteria 895738
98 Ga0207702_10013623 3300026078 Bacteria 6754
99 Ga0207702_10020385 3300026078 Bacteria 5491
100 Ga0207702_10048155 3300026078 Bacteria 3594
101 Ga0207702_12398270 3300026078 Unclassified 515
102 Ga0207641_10074964 3300026088 Bacteria 2920
103 Ga0207648_10186774 3300026089 Bacteria 1836
104 Ga0207674_10008133 3300026116 Bacteria 12159
105 Ga0207674_10018216 3300026116 Bacteria 7641
106 Ga0207698_10000001 3300026142 Bacteria 625389
107 Ga0207698_10083957 3300026142 Bacteria 2580
108 Ga0207698_10506353 3300026142 Unclassified 1176
109 Ga0207698_11459043 3300026142 Bacteria 699
110 Ga0265319_1039586 3300028563 Bacteria 1597
111 Ga0265338_10005747 3300028800 Bacteria 16047
112 Ga0265338_10009093 3300028800 Bacteria 11943
113 Ga0265324_10023795 3300029957 Unclassified 2179
114 Ga0314311_1109729 3300030733 Bacteria 727
115 Ga0265332_10006918 3300031238 Bacteria 5142
116 Ga0265339_10094295 3300031249 Unclassified 1565
117 Ga0373934_0000056 3300035086 Bacteria 38785
118 Ga0373923_0159713 3300035111 Bacteria 1028
119 Ga0373954_0000792 3300035118 Bacteria 12211
120 Ga0373956_0000191 3300035119 Bacteria 23567
121 Ga0373957_0000071 3300035120 Bacteria 25001
122 Ga0373955_0000050 3300035172 Bacteria 45664
123 Ga0373924_0000037 3300035410 Bacteria 33504
124 Ga0373933_0000149 3300035724 Bacteria 45676
125 Ga0373937_0000319 3300036401 Bacteria 45685
126 Ga0450910_014464 3300042147 Bacteria 1155
127 Ga0466969_0141962 3300044656 Bacteria 1109
128 Ga0466966_0464775 3300044684 Unclassified 761
129 Ga0466961_0212543 3300044693 Bacteria 1193
130 Ga0466963_0375991 3300044694 Unclassified 1001
131 Ga0466971_0023962 3300044719 Bacteria 2721
132 Ga0466957_0224776 3300044842 Bacteria 1241
133 Ga0466959_0260618 3300045049 Bacteria 1193
134 Ga0466958_0037595 3300045836 Bacteria 2900
135 Ga0466958_0868219 3300045836 Bacteria 589
136 Ga0495592_0000255 3300046454 Bacteria 45685
137 Ga0495651_0000199 3300046462 Bacteria 45685
138 Ga0495653_0003175 3300046463 Bacteria 13165
139 Ga0495653_0536668 3300046463 Bacteria 725
140 Ga0495608_0000499 3300046511 Bacteria 27122
141 Ga0495628_0000282 3300046516 Bacteria 45645
142 Ga0495652_0001352 3300046529 Bacteria 27313
143 Ga0495652_0635196 3300046529 Bacteria 725
144 Ga0495587_0000189 3300046536 Bacteria 45681
145 Ga0495645_0053345 3300046543 Bacteria 2940
146 Ga0495667_0000136 3300046559 Bacteria 50731
147 Ga0495635_0261515 3300046663 Bacteria 1165
148 Ga0495657_0000290 3300046675 Bacteria 45685
149 Ga0495599_0000282 3300046678 Bacteria 31243
150 Ga0495623_0000368 3300046679 Bacteria 29559
151 Ga0495658_0707176 3300046683 Unclassified 645
152 Ga0495600_0029989 3300046809 Bacteria 3523
153 Ga0495660_0020769 3300046810 Bacteria 3765
154 Ga0495604_0000280 3300047317 Bacteria 45685
155 Ga0495680_0000430 3300047322 Bacteria 47076
156 Ga0495675_0002808 3300047444 Bacteria 10433
157 Ga0495675_0517395 3300047444 Bacteria 684
158 Ga0495602_0000297 3300048088 Bacteria 45689
159 Ga0496105_0588925 3300048908 Bacteria 864
160 Ga0496109_0123630 3300048912 Bacteria 2412
161 Ga0496111_0204935 3300048914 Bacteria 1466
162 Ga0496111_0552835 3300048914 Bacteria 845
163 Ga0496111_0832892 3300048914 Bacteria 667
164 Ga0496112_1059033 3300048915 Bacteria 730
165 Ga0496114_0316954 3300048917 Bacteria 1378
166 Ga0496115_0030563 3300048918 Bacteria 4238
167 nmdc:mga0yw44_34_c1 3300050492 Bacteria 48269
168 Ga0495595_0002052 3300053084 Bacteria 7836
169 Ga0500643_014447 3300053087 Bacteria 2744
170 Ga0500651_0000036 3300053093 Bacteria 104352
171 Ga0500651_0000225 3300053093 Bacteria 35223
172 Ga0500651_0000634 3300053093 Bacteria 17490
173 Ga0500554_121333 3300053102 Unclassified 881
174 Ga0500562_000001 3300053108 Bacteria 1178987
175 Ga0500562_000002 3300053108 Bacteria 977234
176 Ga0500577_0000400 3300053142 Bacteria 11104
177 Ga0500577_0434997 3300053142 Bacteria 573
178 Ga0500603_212817 3300053150 Unclassified 615
179 Ga0500570_038796 3300053724 Bacteria 2509
180 Ga0500611_021195 3300053727 Bacteria 1237
181 Ga0466962_0531770 3300061719 Bacteria 596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053102 Ga0500554_121333 Ga0500554_121333_515_871 117
2 3300005614 Ga0068856_100035296 Ga0068856_1000352963 119
3 3300026078 Ga0207702_10048155 Ga0207702_100481553 119
4 3300026142 Ga0207698_10083957 Ga0207698_100839572 119
5 3300048914 Ga0496111_0832892 Ga0496111_0832892_261_653 120
6 3300048917 Ga0496114_0316954 Ga0496114_0316954_915_1307 120
7 3300005616 Ga0068852_100037974 Ga0068852_1000379746 124
8 3300006358 Ga0068871_100224044 Ga0068871_1002240443 124
9 3300006881 Ga0068865_100187109 Ga0068865_1001871092 124
10 3300009093 Ga0105240_10000489 Ga0105240_1000048972 124
11 3300009174 Ga0105241_10089652 Ga0105241_100896523 124
12 3300009176 Ga0105242_10000272 Ga0105242_1000027214 124
13 3300010375 Ga0105239_10011818 Ga0105239_100118186 124
14 3300010375 Ga0105239_12451402 Ga0105239_124514021 124
15 3300011119 Ga0105246_10788123 Ga0105246_107881232 124
16 3300013105 Ga0157369_10399084 Ga0157369_103990841 124
17 3300013307 Ga0157372_10056118 Ga0157372_100561182 124
18 3300013307 Ga0157372_10898856 Ga0157372_108988563 124
19 3300025911 Ga0207654_10156371 Ga0207654_101563713 124
20 3300025934 Ga0207686_10000001 Ga0207686_10000001546 124
21 3300053093 Ga0500651_0000036 Ga0500651_0000036_68319_68693 124
22 3300053093 Ga0500651_0000225 Ga0500651_0000225_828_1202 124
23 3300053150 Ga0500603_212817 Ga0500603_212817_207_581 124
24 3300005459 Ga0068867_100022676 Ga0068867_1000226762 125
25 3300005563 Ga0068855_100014049 Ga0068855_1000140494 125
26 3300005614 Ga0068856_100001259 Ga0068856_1000012597 125
27 3300005616 Ga0068852_100482270 Ga0068852_1004822702 125
28 3300009093 Ga0105240_10000003 Ga0105240_10000003693 125
29 3300009098 Ga0105245_10000118 Ga0105245_1000011811 125
30 3300009148 Ga0105243_10000001 Ga0105243_10000001599 125
31 3300009545 Ga0105237_10002864 Ga0105237_100028649 125
32 3300009551 Ga0105238_10010565 Ga0105238_100105658 125
33 3300010375 Ga0105239_10431945 Ga0105239_104319452 125
34 3300013296 Ga0157374_10328356 Ga0157374_103283562 125
35 3300025913 Ga0207695_10000005 Ga0207695_10000005702 125
36 3300025914 Ga0207671_10091343 Ga0207671_100913433 125
37 3300025924 Ga0207694_10010719 Ga0207694_100107198 125
38 3300025927 Ga0207687_10000346 Ga0207687_1000034615 125
39 3300025935 Ga0207709_10000002 Ga0207709_10000002661 125
40 3300025949 Ga0207667_10055328 Ga0207667_100553284 125
41 3300026078 Ga0207702_10013623 Ga0207702_100136236 125
42 3300026078 Ga0207702_12398270 Ga0207702_123982702 125
43 3300026089 Ga0207648_10186774 Ga0207648_101867743 125
44 3300026142 Ga0207698_10506353 Ga0207698_105063532 125
45 3300030733 Ga0314311_1109729 Ga0314311_11097292 125
46 3300005337 Ga0070682_100723136 Ga0070682_1007231362 126
47 3300005563 Ga0068855_100000001 Ga0068855_10000000119 126
48 3300005615 Ga0070702_100556773 Ga0070702_1005567731 126
49 3300006358 Ga0068871_100000090 Ga0068871_10000009026 126
50 3300009098 Ga0105245_10000002 Ga0105245_10000002490 126
51 3300009174 Ga0105241_10000003 Ga0105241_10000003315 126
52 3300009176 Ga0105242_11691515 Ga0105242_116915151 126
53 3300013104 Ga0157370_10001144 Ga0157370_1000114426 126
54 3300013105 Ga0157369_10002230 Ga0157369_1000223012 126
55 3300013296 Ga0157374_10000018 Ga0157374_10000018177 126
56 3300025909 Ga0207705_10002124 Ga0207705_1000212419 126
57 3300025911 Ga0207654_10000002 Ga0207654_10000002891 126
58 3300025912 Ga0207707_10020893 Ga0207707_100208933 126
59 3300025927 Ga0207687_10000001 Ga0207687_10000001721 126
60 3300025949 Ga0207667_10000003 Ga0207667_1000000319 126
61 3300026142 Ga0207698_11459043 Ga0207698_114590432 126
62 3300044694 Ga0466963_0375991 Ga0466963_0375991_274_696 126
63 3300045836 Ga0466958_0037595 Ga0466958_0037595_326_748 126
64 3300053087 Ga0500643_014447 Ga0500643_014447_1777_2169 126
65 3300053724 Ga0500570_038796 Ga0500570_038796_1338_1730 126
66 3300005335 Ga0070666_10011238 Ga0070666_100112384 127
67 3300005347 Ga0070668_100126879 Ga0070668_1001268793 127
68 3300005458 Ga0070681_10711920 Ga0070681_107119202 127
69 3300005563 Ga0068855_100000002 Ga0068855_100000002568 127
70 3300005563 Ga0068855_100037001 Ga0068855_1000370012 127
71 3300005577 Ga0068857_100026629 Ga0068857_1000266295 127
72 3300005577 Ga0068857_100047451 Ga0068857_1000474512 127
73 3300005577 Ga0068857_102013044 Ga0068857_1020130441 127
74 3300005616 Ga0068852_100000001 Ga0068852_100000001121 127
75 3300005834 Ga0068851_10393049 Ga0068851_103930491 127
76 3300005842 Ga0068858_100890019 Ga0068858_1008900192 127
77 3300009093 Ga0105240_10000102 Ga0105240_10000102124 127
78 3300009093 Ga0105240_12221653 Ga0105240_122216531 127
79 3300009174 Ga0105241_10000836 Ga0105241_1000083612 127
80 3300009545 Ga0105237_10000002 Ga0105237_1000000216 127
81 3300009551 Ga0105238_10000478 Ga0105238_1000047811 127
82 3300025321 Ga0207656_10262839 Ga0207656_102628392 127
83 3300025903 Ga0207680_10007976 Ga0207680_100079764 127
84 3300025911 Ga0207654_10004106 Ga0207654_100041066 127
85 3300025913 Ga0207695_10000109 Ga0207695_10000109139 127
86 3300025913 Ga0207695_11167888 Ga0207695_111678881 127
87 3300025914 Ga0207671_10000008 Ga0207671_10000008120 127
88 3300025924 Ga0207694_10000590 Ga0207694_1000059033 127
89 3300025949 Ga0207667_10000005 Ga0207667_10000005678 127
90 3300025949 Ga0207667_10029098 Ga0207667_100290982 127
91 3300025972 Ga0207668_10100695 Ga0207668_101006952 127
92 3300026035 Ga0207703_10640495 Ga0207703_106404951 127
93 3300026116 Ga0207674_10008133 Ga0207674_1000813314 127
94 3300026116 Ga0207674_10018216 Ga0207674_100182163 127
95 3300026142 Ga0207698_10000001 Ga0207698_1000000173 127
96 3300046463 Ga0495653_0536668 Ga0495653_0536668_19_417 127
97 3300048908 Ga0496105_0588925 Ga0496105_0588925_300_692 127
98 3300048912 Ga0496109_0123630 Ga0496109_0123630_1780_2178 127
99 3300048914 Ga0496111_0552835 Ga0496111_0552835_425_835 127
100 3300048918 Ga0496115_0030563 Ga0496115_0030563_1274_1666 127
101 3300005546 Ga0070696_100142227 Ga0070696_1001422273 128
102 3300005614 Ga0068856_100029359 Ga0068856_1000293596 128
103 3300006038 Ga0075365_10000060 Ga0075365_1000006020 128
104 3300006195 Ga0075366_10141912 Ga0075366_101419123 128
105 3300006237 Ga0097621_101004727 Ga0097621_1010047272 128
106 3300009545 Ga0105237_10020987 Ga0105237_100209876 128
107 3300009551 Ga0105238_11177536 Ga0105238_111775361 128
108 3300010375 Ga0105239_10001744 Ga0105239_100017446 128
109 3300010375 Ga0105239_10014156 Ga0105239_100141563 128
110 3300013307 Ga0157372_10870485 Ga0157372_108704852 128
111 3300014325 Ga0163163_10254381 Ga0163163_102543812 128
112 3300014325 Ga0163163_10614380 Ga0163163_106143802 128
113 3300025913 Ga0207695_10035794 Ga0207695_100357949 128
114 3300025914 Ga0207671_10043384 Ga0207671_100433843 128
115 3300025935 Ga0207709_10803477 Ga0207709_108034772 128
116 3300026078 Ga0207702_10020385 Ga0207702_100203852 128
117 3300028563 Ga0265319_1039586 Ga0265319_10395861 128
118 3300028800 Ga0265338_10005747 Ga0265338_1000574710 128
119 3300028800 Ga0265338_10009093 Ga0265338_100090935 128
120 3300029957 Ga0265324_10023795 Ga0265324_100237953 128
121 3300031238 Ga0265332_10006918 Ga0265332_100069187 128
122 3300031249 Ga0265339_10094295 Ga0265339_100942952 128
123 3300035086 Ga0373934_0000056 Ga0373934_0000056_3233_3628 128
124 3300035111 Ga0373923_0159713 Ga0373923_0159713_223_618 128
125 3300035118 Ga0373954_0000792 Ga0373954_0000792_9620_10015 128
126 3300035119 Ga0373956_0000191 Ga0373956_0000191_11209_11604 128
127 3300035120 Ga0373957_0000071 Ga0373957_0000071_21866_22261 128
128 3300035172 Ga0373955_0000050 Ga0373955_0000050_15180_15575 128
129 3300035410 Ga0373924_0000037 Ga0373924_0000037_21454_21849 128
130 3300035724 Ga0373933_0000149 Ga0373933_0000149_30111_30506 128
131 3300036401 Ga0373937_0000319 Ga0373937_0000319_15180_15575 128
132 3300042147 Ga0450910_014464 Ga0450910_014464_136_531 128
133 3300044684 Ga0466966_0464775 Ga0466966_0464775_34_420 128
134 3300045836 Ga0466958_0868219 Ga0466958_0868219_82_468 128
135 3300046454 Ga0495592_0000255 Ga0495592_0000255_15180_15575 128
136 3300046462 Ga0495651_0000199 Ga0495651_0000199_30111_30506 128
137 3300046463 Ga0495653_0003175 Ga0495653_0003175_8047_8442 128
138 3300046511 Ga0495608_0000499 Ga0495608_0000499_15172_15567 128
139 3300046516 Ga0495628_0000282 Ga0495628_0000282_30071_30466 128
140 3300046529 Ga0495652_0001352 Ga0495652_0001352_15184_15579 128
141 3300046536 Ga0495587_0000189 Ga0495587_0000189_30111_30506 128
142 3300046559 Ga0495667_0000136 Ga0495667_0000136_35157_35552 128
143 3300046663 Ga0495635_0261515 Ga0495635_0261515_480_875 128
144 3300046675 Ga0495657_0000290 Ga0495657_0000290_30111_30506 128
145 3300046678 Ga0495599_0000282 Ga0495599_0000282_15665_16060 128
146 3300046679 Ga0495623_0000368 Ga0495623_0000368_11156_11551 128
147 3300046683 Ga0495658_0707176 Ga0495658_0707176_132_521 128
148 3300046809 Ga0495600_0029989 Ga0495600_0029989_2648_3043 128
149 3300047317 Ga0495604_0000280 Ga0495604_0000280_30111_30506 128
150 3300047322 Ga0495680_0000430 Ga0495680_0000430_31498_31893 128
151 3300047444 Ga0495675_0002808 Ga0495675_0002808_7539_7934 128
152 3300048088 Ga0495602_0000297 Ga0495602_0000297_30111_30506 128
153 3300048914 Ga0496111_0204935 Ga0496111_0204935_720_1121 128
154 3300048915 Ga0496112_1059033 Ga0496112_1059033_249_662 128
155 3300050492 nmdc:mga0yw44_34_c1 nmdc:mga0yw44_34_c1_33276_33665 128
156 3300053084 Ga0495595_0002052 Ga0495595_0002052_4551_4946 128
157 3300053093 Ga0500651_0000634 Ga0500651_0000634_13116_13505 128
158 3300053142 Ga0500577_0000400 Ga0500577_0000400_2500_2889 128
159 3300053142 Ga0500577_0434997 Ga0500577_0434997_124_513 128
160 3300053727 Ga0500611_021195 Ga0500611_021195_544_933 128
161 3300003320 rootH2_10200909 rootH2_102009092 129
162 3300003322 rootL2_10185671 rootL2_101856712 129
163 3300005355 Ga0070671_100028206 Ga0070671_1000282063 129
164 3300005614 Ga0068856_100000001 Ga0068856_100000001141 129
165 3300005614 Ga0068856_100532821 Ga0068856_1005328212 129
166 3300005841 Ga0068863_100090060 Ga0068863_1000900604 129
167 3300025931 Ga0207644_10047944 Ga0207644_100479445 129
168 3300026078 Ga0207702_10000001 Ga0207702_10000001690 129
169 3300026088 Ga0207641_10074964 Ga0207641_100749644 129
170 3300044656 Ga0466969_0141962 Ga0466969_0141962_19_417 129
171 3300044693 Ga0466961_0212543 Ga0466961_0212543_106_504 129
172 3300044719 Ga0466971_0023962 Ga0466971_0023962_2043_2441 129
173 3300044842 Ga0466957_0224776 Ga0466957_0224776_657_1055 129
174 3300045049 Ga0466959_0260618 Ga0466959_0260618_689_1087 129
175 3300046529 Ga0495652_0635196 Ga0495652_0635196_218_637 129
176 3300046543 Ga0495645_0053345 Ga0495645_0053345_2324_2743 129
177 3300046810 Ga0495660_0020769 Ga0495660_0020769_30_419 129
178 3300047444 Ga0495675_0517395 Ga0495675_0517395_108_527 129
179 3300053108 Ga0500562_000001 Ga0500562_000001_432747_433136 129
180 3300053108 Ga0500562_000002 Ga0500562_000002_604491_604880 129
181 3300061719 Ga0466962_0531770 Ga0466962_0531770_67_465 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

34

128

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.8066 8 120
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7369 8 120
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6956 2 112
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6506 2 112
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.5914 24 114
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8107 6 115 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7795 6 115 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7668 7 111 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.714 7 111 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6929 22 128 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A1G8ZE52-F1-model_v4 YdhG-like domain-containing protein 0.9953 6 128
AF-A0A7W5YBE3-F1-model_v4 YdhG-like domain-containing protein 0.9938 2 128
AF-A0A399V6T1-F1-model_v4 deleted 0.9886 1 128
AF-A0A841CK39-F1-model_v4 YdhG-like domain-containing protein 0.9872 3 128
AF-A0A0M8Y510-F1-model_v4 YdhG-like domain-containing protein 0.9851 17 128

Feature Viewer

pLDDT pTM Quality
95.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map