F277012

General Info

Members Datasets Scaffolds Average Seq Length
181 92 362 188

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100054843|Ga0070686_1000548432
Length 198
Sequence MGEHGKFLKGQLLLDSGQLGGSFFQHTVILICQHNEEGAFGLVLNRSLGKTVGEMIVADLPEPLKEAPLYLGGPVQPAALSFLHTDNFLSPPDEIDVSPGQSADVLPNLVLGHSLDELVDIGESFSPTKKVRMFAGYAGWSPGQLEDEMKRKSWLTFPASLELVFETPADQLWQKILKNKGGWKNKLLSQMPDDLSMN

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
22 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
35 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
39 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
40 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
41 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
42 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
46 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
47 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
48 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
49 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
50 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
51 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
52 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
53 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
54 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
55 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
56 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
57 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
58 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
92 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 0
Rhizosphere 98.9
Stem 0
Stem Tuber 0
Unclassified 21.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100054843 3300005544 Bacteria 2551
2 rootH2_10252571 3300003320 Unclassified 1305
3 Ga0070658_10128948 3300005327 Bacteria 2107
4 Ga0070690_100005222 3300005330 Bacteria 7276
5 Ga0070689_100038035 3300005340 Unclassified 3680
6 Ga0070689_100099588 3300005340 Bacteria 2299
7 Ga0070688_100195994 3300005365 Unclassified 1410
8 Ga0070681_10855704 3300005458 Unclassified 827
9 Ga0070685_10189381 3300005466 Bacteria 1330
10 Ga0068855_100097617 3300005563 Bacteria 3384
11 Ga0068855_100262690 3300005563 Bacteria 1922
12 Ga0068856_100000079 3300005614 Bacteria 92486
13 Ga0068856_100065954 3300005614 Bacteria 3577
14 Ga0068856_100146116 3300005614 Unclassified 2372
15 Ga0068859_100023636 3300005617 Bacteria 6169
16 Ga0068859_100102595 3300005617 Bacteria 2918
17 Ga0068864_101121119 3300005618 Unclassified 783
18 Ga0068863_100287055 3300005841 Bacteria 1595
19 Ga0068858_100157201 3300005842 Bacteria 2139
20 Ga0070717_10773575 3300006028 Unclassified 873
21 Ga0070717_11125717 3300006028 Unclassified 715
22 Ga0075434_100859663 3300006871 Bacteria 922
23 Ga0097620_100023636 3300006931 Bacteria 6169
24 Ga0097620_100102601 3300006931 Bacteria 2918
25 Ga0105238_10056063 3300009551 Bacteria 3954
26 Ga0105238_10166321 3300009551 Bacteria 2181
27 Ga0157374_10310296 3300013296 Bacteria 1562
28 Ga0157374_10697951 3300013296 Unclassified 1028
29 Ga0163162_10886750 3300013306 Bacteria 1006
30 Ga0163163_11253970 3300014325 Unclassified 804
31 Ga0207695_10215476 3300025913 Bacteria 1829
32 Ga0207663_10042942 3300025916 Unclassified 2765
33 Ga0207694_10028421 3300025924 Bacteria 4263
34 Ga0207670_10014815 3300025936 Unclassified 4641
35 Ga0207670_10497355 3300025936 Bacteria 989
36 Ga0207667_10049823 3300025949 Bacteria 4421
37 Ga0207667_10096761 3300025949 Bacteria 3047
38 Ga0207703_10245411 3300026035 Bacteria 1612
39 Ga0207702_10003680 3300026078 Bacteria 13877
40 Ga0207702_10244916 3300026078 Unclassified 1681
41 Ga0207702_10418598 3300026078 Bacteria 1295
42 Ga0265337_1001306 3300028556 Bacteria 12432
43 Ga0265337_1005710 3300028556 Bacteria 4892
44 Ga0265337_1010214 3300028556 Bacteria 3301
45 Ga0265337_1011467 3300028556 Bacteria 3052
46 Ga0265337_1012485 3300028556 Unclassified 2885
47 Ga0265337_1056286 3300028556 Bacteria 1096
48 Ga0265326_10030140 3300028558 Bacteria 1545
49 Ga0265326_10033607 3300028558 Unclassified 1460
50 Ga0265319_1000181 3300028563 Bacteria 47983
51 Ga0265319_1009214 3300028563 Bacteria 4229
52 Ga0265319_1012057 3300028563 Bacteria 3510
53 Ga0265334_10010936 3300028573 Bacteria 3829
54 Ga0265334_10014477 3300028573 Bacteria 3287
55 Ga0265334_10163519 3300028573 Unclassified 781
56 Ga0265318_10009254 3300028577 Bacteria 4345
57 Ga0265323_10040003 3300028653 Unclassified 1707
58 Ga0265323_10082459 3300028653 Bacteria 1085
59 Ga0265336_10002168 3300028666 Bacteria 8297
60 Ga0265336_10019883 3300028666 Bacteria 2162
61 Ga0265336_10031726 3300028666 Bacteria 1640
62 Ga0265338_10000135 3300028800 Bacteria 135743
63 Ga0265338_10000242 3300028800 Bacteria 101378
64 Ga0265338_10001160 3300028800 Bacteria 43556
65 Ga0265338_10001889 3300028800 Bacteria 32790
66 Ga0265338_10003083 3300028800 Bacteria 23913
67 Ga0265338_10004415 3300028800 Bacteria 19017
68 Ga0265338_10005104 3300028800 Bacteria 17318
69 Ga0265338_10006692 3300028800 Bacteria 14569
70 Ga0265338_10007193 3300028800 Bacteria 13921
71 Ga0265338_10007464 3300028800 Bacteria 13558
72 Ga0265338_10008324 3300028800 Bacteria 12617
73 Ga0265338_10014812 3300028800 Bacteria 8630
74 Ga0265338_10030500 3300028800 Bacteria 5311
75 Ga0265338_10071898 3300028800 Bacteria 2956
76 Ga0265338_10098801 3300028800 Unclassified 2386
77 Ga0265338_10112134 3300028800 Bacteria 2194
78 Ga0265338_10132451 3300028800 Bacteria 1966
79 Ga0265338_10147590 3300028800 Unclassified 1832
80 Ga0265338_10152573 3300028800 Unclassified 1793
81 Ga0265338_10155380 3300028800 Bacteria 1772
82 Ga0265338_10188637 3300028800 Bacteria 1565
83 Ga0265338_10284331 3300028800 Unclassified 1207
84 Ga0265338_10432101 3300028800 Bacteria 934
85 Ga0265338_10447499 3300028800 Unclassified 915
86 Ga0265338_10537672 3300028800 Unclassified 819
87 Ga0265324_10000247 3300029957 Bacteria 40078
88 Ga0265324_10001228 3300029957 Bacteria 15185
89 Ga0265324_10009141 3300029957 Bacteria 3887
90 Ga0265324_10012853 3300029957 Bacteria 3142
91 Ga0265324_10120070 3300029957 Unclassified 893
92 Ga0265328_10094252 3300031239 Bacteria 1107
93 Ga0265320_10001039 3300031240 Bacteria 20598
94 Ga0265320_10021309 3300031240 Bacteria 3490
95 Ga0265320_10031842 3300031240 Bacteria 2705
96 Ga0265320_10034889 3300031240 Bacteria 2554
97 Ga0265320_10091589 3300031240 Bacteria 1408
98 Ga0265325_10009806 3300031241 Bacteria 5575
99 Ga0265325_10033388 3300031241 Bacteria 2743
100 Ga0265325_10120623 3300031241 Bacteria 1264
101 Ga0265340_10000427 3300031247 Bacteria 22587
102 Ga0265340_10008405 3300031247 Bacteria 5577
103 Ga0265340_10185492 3300031247 Unclassified 939
104 Ga0265339_10013154 3300031249 Bacteria 5023
105 Ga0265327_10001286 3300031251 Bacteria 32988
106 Ga0265327_10011562 3300031251 Bacteria 6062
107 Ga0265327_10303835 3300031251 Unclassified 702
108 Ga0265316_10002363 3300031344 Bacteria 19648
109 Ga0265316_10030185 3300031344 Bacteria 4447
110 Ga0265316_10036809 3300031344 Bacteria 3956
111 Ga0265316_10038928 3300031344 Bacteria 3824
112 Ga0265316_10271253 3300031344 Bacteria 1242
113 Ga0265316_10275639 3300031344 Bacteria 1230
114 Ga0265316_10589595 3300031344 Bacteria 789
115 Ga0265313_10001234 3300031595 Bacteria 24376
116 Ga0265313_10016458 3300031595 Bacteria 4249
117 Ga0265314_10059259 3300031711 Bacteria 2620
118 Ga0265314_10313175 3300031711 Unclassified 876
119 Ga0265342_10111918 3300031712 Bacteria 1544
120 Ga0373930_0000645 3300034816 Bacteria 4866
121 Ga0373938_0017587 3300034957 Bacteria 1409
122 Ga0373926_0047489 3300035083 Bacteria 1542
123 Ga0373926_0060831 3300035083 Bacteria 1377
124 Ga0373928_0001007 3300035084 Bacteria 5529
125 Ga0373929_0000917 3300035085 Bacteria 5739
126 Ga0373944_0001890 3300035089 Bacteria 5298
127 Ga0373949_0003389 3300035090 Bacteria 3818
128 Ga0373932_0000001 3300035112 Bacteria 1459067
129 Ga0373943_0030284 3300035170 Unclassified 2560
130 Ga0373943_0190951 3300035170 Unclassified 1130
131 Ga0373946_0061948 3300035171 Bacteria 1594
132 Ga0373946_0071474 3300035171 Bacteria 1500
133 Ga0373962_0000105 3300035242 Bacteria 18388
134 Ga0373931_0000004 3300035691 Bacteria 535140
135 Ga0373935_0014916 3300035692 Unclassified 4693
136 Ga0373935_0153522 3300035692 Bacteria 1564
137 Ga0373927_0003789 3300035695 Bacteria 10728
138 Ga0373927_0005602 3300035695 Bacteria 8630
139 Ga0373927_0021707 3300035695 Bacteria 4207
140 Ga0373947_0011577 3300035725 Bacteria 5060
141 Ga0373937_0014534 3300036401 Bacteria 6952
142 Ga0373925_0000572 3300037068 Bacteria 35958
143 Ga0373925_0000862 3300037068 Bacteria 27775
144 Ga0373925_0018579 3300037068 Bacteria 5054
145 Ga0451577_0031688 3300042876 Bacteria 4769
146 Ga0451576_0035903 3300045051 Bacteria 5257
147 Ga0451576_0075760 3300045051 Bacteria 3501
148 Ga0451576_0160119 3300045051 Unclassified 2349
149 Ga0495629_0104504 3300046459 Bacteria 1975
150 Ga0495639_0419942 3300046475 Unclassified 677
151 Ga0495608_0340103 3300046511 Unclassified 925
152 Ga0495630_0024658 3300046517 Bacteria 4445
153 Ga0495630_0051679 3300046517 Bacteria 3076
154 Ga0495630_0211510 3300046517 Bacteria 1480
155 Ga0495666_0036456 3300046526 Bacteria 2395
156 Ga0495586_0007676 3300046535 Bacteria 5750
157 Ga0495586_0200850 3300046535 Unclassified 1130
158 Ga0495622_0009288 3300046557 Bacteria 4550
159 Ga0495667_0039943 3300046559 Unclassified 3117
160 Ga0495634_0014669 3300046642 Bacteria 5642
161 Ga0495613_0051685 3300046689 Bacteria 3028
162 Ga0495581_0549296 3300047315 Bacteria 670
163 Ga0495676_0724974 3300047321 Bacteria 642
164 Ga0495680_0156506 3300047322 Bacteria 1657
165 Ga0495675_0309765 3300047444 Unclassified 936
166 Ga0495684_0091548 3300047471 Bacteria 2304
167 Ga0501031_0000103 3300049568 Bacteria 45138
168 Ga0501032_0010057 3300049569 Bacteria 6830
169 Ga0501032_0017760 3300049569 Bacteria 4993
170 Ga0501033_0198648 3300049570 Bacteria 1433
171 Ga0501034_0187108 3300049571 Unclassified 2034
172 Ga0501037_0016692 3300049573 Bacteria 5403
173 Ga0501038_0526182 3300049574 Bacteria 902
174 Ga0501039_0284528 3300049575 Unclassified 1300
175 Ga0501035_0001575 3300049822 Bacteria 23223
176 Ga0501035_0019684 3300049822 Bacteria 6203
177 Ga0501035_0026719 3300049822 Bacteria 5280
178 Ga0501044_0000158 3300049823 Bacteria 83865
179 Ga0501044_0019867 3300049823 Bacteria 7175
180 nmdc:mga08x19_251872_c1 3300050514 Unclassified 1219
181 Ga0500651_0059909 3300053093 Bacteria 2380
182 Ga0070686_100054843
183 rootH2_10252571
184 Ga0070658_10128948
185 Ga0070690_100005222
186 Ga0070689_100038035
187 Ga0070689_100099588
188 Ga0070688_100195994
189 Ga0070681_10855704
190 Ga0070685_10189381
191 Ga0068855_100097617
192 Ga0068855_100262690
193 Ga0068856_100000079
194 Ga0068856_100065954
195 Ga0068856_100146116
196 Ga0068859_100023636
197 Ga0068859_100102595
198 Ga0068864_101121119
199 Ga0068863_100287055
200 Ga0068858_100157201
201 Ga0070717_10773575
202 Ga0070717_11125717
203 Ga0075434_100859663
204 Ga0097620_100023636
205 Ga0097620_100102601
206 Ga0105238_10056063
207 Ga0105238_10166321
208 Ga0157374_10310296
209 Ga0157374_10697951
210 Ga0163162_10886750
211 Ga0163163_11253970
212 Ga0207695_10215476
213 Ga0207663_10042942
214 Ga0207694_10028421
215 Ga0207670_10014815
216 Ga0207670_10497355
217 Ga0207667_10049823
218 Ga0207667_10096761
219 Ga0207703_10245411
220 Ga0207702_10003680
221 Ga0207702_10244916
222 Ga0207702_10418598
223 Ga0265337_1001306
224 Ga0265337_1005710
225 Ga0265337_1010214
226 Ga0265337_1011467
227 Ga0265337_1012485
228 Ga0265337_1056286
229 Ga0265326_10030140
230 Ga0265326_10033607
231 Ga0265319_1000181
232 Ga0265319_1009214
233 Ga0265319_1012057
234 Ga0265334_10010936
235 Ga0265334_10014477
236 Ga0265334_10163519
237 Ga0265318_10009254
238 Ga0265323_10040003
239 Ga0265323_10082459
240 Ga0265336_10002168
241 Ga0265336_10019883
242 Ga0265336_10031726
243 Ga0265338_10000135
244 Ga0265338_10000242
245 Ga0265338_10001160
246 Ga0265338_10001889
247 Ga0265338_10003083
248 Ga0265338_10004415
249 Ga0265338_10005104
250 Ga0265338_10006692
251 Ga0265338_10007193
252 Ga0265338_10007464
253 Ga0265338_10008324
254 Ga0265338_10014812
255 Ga0265338_10030500
256 Ga0265338_10071898
257 Ga0265338_10098801
258 Ga0265338_10112134
259 Ga0265338_10132451
260 Ga0265338_10147590
261 Ga0265338_10152573
262 Ga0265338_10155380
263 Ga0265338_10188637
264 Ga0265338_10284331
265 Ga0265338_10432101
266 Ga0265338_10447499
267 Ga0265338_10537672
268 Ga0265324_10000247
269 Ga0265324_10001228
270 Ga0265324_10009141
271 Ga0265324_10012853
272 Ga0265324_10120070
273 Ga0265328_10094252
274 Ga0265320_10001039
275 Ga0265320_10021309
276 Ga0265320_10031842
277 Ga0265320_10034889
278 Ga0265320_10091589
279 Ga0265325_10009806
280 Ga0265325_10033388
281 Ga0265325_10120623
282 Ga0265340_10000427
283 Ga0265340_10008405
284 Ga0265340_10185492
285 Ga0265339_10013154
286 Ga0265327_10001286
287 Ga0265327_10011562
288 Ga0265327_10303835
289 Ga0265316_10002363
290 Ga0265316_10030185
291 Ga0265316_10036809
292 Ga0265316_10038928
293 Ga0265316_10271253
294 Ga0265316_10275639
295 Ga0265316_10589595
296 Ga0265313_10001234
297 Ga0265313_10016458
298 Ga0265314_10059259
299 Ga0265314_10313175
300 Ga0265342_10111918
301 Ga0373930_0000645
302 Ga0373938_0017587
303 Ga0373926_0047489
304 Ga0373926_0060831
305 Ga0373928_0001007
306 Ga0373929_0000917
307 Ga0373944_0001890
308 Ga0373949_0003389
309 Ga0373932_0000001
310 Ga0373943_0030284
311 Ga0373943_0190951
312 Ga0373946_0061948
313 Ga0373946_0071474
314 Ga0373962_0000105
315 Ga0373931_0000004
316 Ga0373935_0014916
317 Ga0373935_0153522
318 Ga0373927_0003789
319 Ga0373927_0005602
320 Ga0373927_0021707
321 Ga0373947_0011577
322 Ga0373937_0014534
323 Ga0373925_0000572
324 Ga0373925_0000862
325 Ga0373925_0018579
326 Ga0451577_0031688
327 Ga0451576_0035903
328 Ga0451576_0075760
329 Ga0451576_0160119
330 Ga0495629_0104504
331 Ga0495639_0419942
332 Ga0495608_0340103
333 Ga0495630_0024658
334 Ga0495630_0051679
335 Ga0495630_0211510
336 Ga0495666_0036456
337 Ga0495586_0007676
338 Ga0495586_0200850
339 Ga0495622_0009288
340 Ga0495667_0039943
341 Ga0495634_0014669
342 Ga0495613_0051685
343 Ga0495581_0549296
344 Ga0495676_0724974
345 Ga0495680_0156506
346 Ga0495675_0309765
347 Ga0495684_0091548
348 Ga0501031_0000103
349 Ga0501032_0010057
350 Ga0501032_0017760
351 Ga0501033_0198648
352 Ga0501034_0187108
353 Ga0501037_0016692
354 Ga0501038_0526182
355 Ga0501039_0284528
356 Ga0501035_0001575
357 Ga0501035_0019684
358 Ga0501035_0026719
359 Ga0501044_0000158
360 Ga0501044_0019867
361 nmdc:mga08x19_251872_c1
362 Ga0500651_0059909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

17

181

0.85

Map