F276961

General Info

Members Datasets Scaffolds Average Seq Length
181 105 362 196

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100009712|Ga0070707_1000097123
Length 215
Sequence MCGCALTPHSKPGFIRRMRLAAALVALSSLTIAASSQAARERVEPRVVEKLSPLPVALSNDFEFRKTKLFFLSDKPPKPGQGARQTSSSLGGKSNSPSQKTATMQDAPITFERQYRLFGAVTALDQRQRYGNYFDFFWRAKRPSDVTVRLEYRQEKLHEHVQAQEISYRNVRGTHRTEFKVIGDDYFDDGRVIAWRCLLIENGRIVAENRSFMWE

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.21
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 40.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100009712 3300005468 Bacteria 8943
2 JGI24746J21847_1008308 3300001977 Unclassified 1568
3 JGI25406J46586_10000011 3300003203 Bacteria 104720
4 JGI25404J52841_10016268 3300003659 Unclassified 1614
5 JGI25405J52794_10005400 3300003911 Bacteria 2302
6 Ga0065704_10020781 3300005289 Bacteria 1654
7 Ga0065712_10102649 3300005290 Bacteria 2004
8 Ga0065715_10097162 3300005293 Unclassified 3742
9 Ga0065715_10182652 3300005293 Unclassified 1466
10 Ga0065715_10459138 3300005293 Unclassified 818
11 Ga0070676_10004452 3300005328 Bacteria 7373
12 Ga0070690_100147941 3300005330 Bacteria 1600
13 Ga0068869_100200428 3300005334 Unclassified 1573
14 Ga0068868_100033378 3300005338 Unclassified 3967
15 Ga0070660_100150758 3300005339 Unclassified 1869
16 Ga0070689_100057026 3300005340 Unclassified 3030
17 Ga0070687_100008724 3300005343 Unclassified 4305
18 Ga0070668_100044914 3300005347 Bacteria 3390
19 Ga0070669_100023645 3300005353 Unclassified 4401
20 Ga0070675_100064574 3300005354 Unclassified 3026
21 Ga0070671_100386100 3300005355 Unclassified 1197
22 Ga0070659_100023420 3300005366 Unclassified 4725
23 Ga0070667_100071190 3300005367 Unclassified 2961
24 Ga0070714_100037057 3300005435 Unclassified 4096
25 Ga0070713_100166180 3300005436 Bacteria 1973
26 Ga0070713_100649209 3300005436 Bacteria 1005
27 Ga0070711_100033582 3300005439 Bacteria 3416
28 Ga0070711_100298808 3300005439 Unclassified 1280
29 Ga0070705_100257082 3300005440 Bacteria 1229
30 Ga0070705_100274027 3300005440 Bacteria 1196
31 Ga0070708_100058893 3300005445 Unclassified 3423
32 Ga0070708_100166929 3300005445 Bacteria 2053
33 Ga0070708_100187842 3300005445 Bacteria 1933
34 Ga0070708_100226555 3300005445 Bacteria 1754
35 Ga0070708_100318306 3300005445 Unclassified 1465
36 Ga0070708_100574175 3300005445 Unclassified 1063
37 Ga0070662_100081696 3300005457 Unclassified 2408
38 Ga0070706_100000116 3300005467 Bacteria 97606
39 Ga0070706_100005715 3300005467 Bacteria 11828
40 Ga0070706_100022719 3300005467 Bacteria 5777
41 Ga0070706_100082839 3300005467 Unclassified 2971
42 Ga0070706_100137211 3300005467 Unclassified 2283
43 Ga0070706_100367687 3300005467 Bacteria 1340
44 Ga0070707_100001914 3300005468 Bacteria 19954
45 Ga0070707_100011498 3300005468 Bacteria 8254
46 Ga0070707_100031391 3300005468 Bacteria 5061
47 Ga0070707_100032665 3300005468 Unclassified 4959
48 Ga0070707_100094014 3300005468 Bacteria 2903
49 Ga0070707_100559511 3300005468 Bacteria 1106
50 Ga0070698_100001128 3300005471 Bacteria 29519
51 Ga0070698_100001373 3300005471 Bacteria 27059
52 Ga0070698_100014571 3300005471 Bacteria 8303
53 Ga0070698_100110708 3300005471 Bacteria 2711
54 Ga0070698_100164040 3300005471 Bacteria 2165
55 Ga0070698_100393085 3300005471 Bacteria 1320
56 Ga0070699_100049989 3300005518 Bacteria 3618
57 Ga0070699_100109108 3300005518 Unclassified 2429
58 Ga0070699_100125203 3300005518 Bacteria 2262
59 Ga0070699_100253789 3300005518 Bacteria 1572
60 Ga0070699_100508805 3300005518 Unclassified 1094
61 Ga0070699_101052398 3300005518 Unclassified 746
62 Ga0070684_100118774 3300005535 Unclassified 2377
63 Ga0070697_100000885 3300005536 Bacteria 22519
64 Ga0070697_100001611 3300005536 Bacteria 17211
65 Ga0070697_100003783 3300005536 Bacteria 11618
66 Ga0070697_100013369 3300005536 Bacteria 6438
67 Ga0070697_100016534 3300005536 Bacteria 5804
68 Ga0070697_100036479 3300005536 Unclassified 3971
69 Ga0070697_100144613 3300005536 Unclassified 2001
70 Ga0070697_100216530 3300005536 Bacteria 1631
71 Ga0070697_100431635 3300005536 Unclassified 1146
72 Ga0070696_100248589 3300005546 Unclassified 1344
73 Ga0068860_100224021 3300005843 Unclassified 1826
74 Ga0068862_100014956 3300005844 Bacteria 6444
75 Ga0081455_10000398 3300005937 Bacteria 57265
76 Ga0081455_10001384 3300005937 Bacteria 29929
77 Ga0081455_10002878 3300005937 Bacteria 20255
78 Ga0081540_1000010 3300005983 Bacteria 193206
79 Ga0081540_1017838 3300005983 Unclassified 4378
80 Ga0081539_10000139 3300005985 Bacteria 170623
81 Ga0081539_10028867 3300005985 Bacteria 3481
82 Ga0081539_10046309 3300005985 Bacteria 2493
83 Ga0081539_10079344 3300005985 Bacteria 1730
84 Ga0070717_10004053 3300006028 Bacteria 10555
85 Ga0070717_10013427 3300006028 Bacteria 6278
86 Ga0070717_10068198 3300006028 Bacteria 2960
87 Ga0070717_10088127 3300006028 Unclassified 2615
88 Ga0070716_100240104 3300006173 Bacteria 1228
89 Ga0070712_100009479 3300006175 Bacteria 6136
90 Ga0070712_100153086 3300006175 Bacteria 1773
91 Ga0068871_100623605 3300006358 Bacteria 982
92 Ga0075436_100066678 3300006914 Unclassified 2488
93 Ga0105245_10260536 3300009098 Unclassified 1687
94 Ga0114129_10009121 3300009147 Bacteria 14139
95 Ga0105242_10007619 3300009176 Bacteria 8334
96 Ga0105248_10758810 3300009177 Unclassified 1095
97 Ga0105249_10019697 3300009553 Bacteria 6022
98 Ga0105239_10047155 3300010375 Bacteria 4722
99 Ga0157373_10197705 3300013100 Bacteria 1417
100 Ga0157374_10013367 3300013296 Bacteria 7165
101 Ga0157378_10009471 3300013297 Bacteria 8486
102 Ga0157378_10014779 3300013297 Bacteria 6836
103 Ga0157378_10226250 3300013297 Unclassified 1780
104 Ga0163162_10005533 3300013306 Bacteria 12212
105 Ga0163162_10642418 3300013306 Bacteria 1185
106 Ga0157372_10563186 3300013307 Bacteria 1328
107 Ga0157375_10400461 3300013308 Unclassified 1539
108 Ga0157375_11276278 3300013308 Unclassified 863
109 Ga0157379_10103593 3300014968 Unclassified 2553
110 Ga0157376_10015128 3300014969 Bacteria 5816
111 Ga0207666_1001254 3300025271 Unclassified 2997
112 Ga0207697_10000479 3300025315 Bacteria 22589
113 Ga0207697_10005720 3300025315 Bacteria 5731
114 Ga0207645_10001870 3300025907 Bacteria 16994
115 Ga0207684_10000190 3300025910 Bacteria 97762
116 Ga0207684_10002366 3300025910 Bacteria 19090
117 Ga0207684_10020496 3300025910 Bacteria 5650
118 Ga0207684_10073836 3300025910 Unclassified 2897
119 Ga0207684_11001663 3300025910 Unclassified 699
120 Ga0207693_10015715 3300025915 Bacteria 6065
121 Ga0207693_10015776 3300025915 Bacteria 6053
122 Ga0207693_10035096 3300025915 Bacteria 3955
123 Ga0207693_10403380 3300025915 Unclassified 1069
124 Ga0207663_10005273 3300025916 Bacteria 6507
125 Ga0207663_10029231 3300025916 Unclassified 3235
126 Ga0207662_10003513 3300025918 Bacteria 8077
127 Ga0207657_10167865 3300025919 Unclassified 1779
128 Ga0207646_10000248 3300025922 Bacteria 73450
129 Ga0207646_10001113 3300025922 Bacteria 34274
130 Ga0207646_10011797 3300025922 Bacteria 8441
131 Ga0207646_10033325 3300025922 Unclassified 4660
132 Ga0207646_10088291 3300025922 Bacteria 2774
133 Ga0207646_10561961 3300025922 Unclassified 1025
134 Ga0207681_10051134 3300025923 Unclassified 2798
135 Ga0207659_10226001 3300025926 Unclassified 1507
136 Ga0207700_10080282 3300025928 Unclassified 2543
137 Ga0207664_10022778 3300025929 Bacteria 4684
138 Ga0207664_10061599 3300025929 Unclassified 2994
139 Ga0207644_10301764 3300025931 Unclassified 1291
140 Ga0207690_10136858 3300025932 Unclassified 1799
141 Ga0207706_10000611 3300025933 Bacteria 37952
142 Ga0207686_10006456 3300025934 Bacteria 6312
143 Ga0207709_10046370 3300025935 Unclassified 2637
144 Ga0207670_10028248 3300025936 Unclassified 3558
145 Ga0207704_11006953 3300025938 Unclassified 705
146 Ga0207665_10033014 3300025939 Bacteria 3429
147 Ga0207689_10075495 3300025942 Bacteria 2771
148 Ga0207651_10206106 3300025960 Bacteria 1580
149 Ga0207712_10329928 3300025961 Unclassified 1262
150 Ga0207668_10004871 3300025972 Bacteria 7900
151 Ga0207668_10033080 3300025972 Unclassified 3423
152 Ga0207658_10004290 3300025986 Bacteria 9933
153 Ga0207677_10203152 3300026023 Unclassified 1576
154 Ga0210002_1018040 3300027617 Bacteria 1127
155 Ga0268265_10142161 3300028380 Unclassified 2010
156 Ga0268264_10020083 3300028381 Bacteria 5458
157 Ga0373934_0096506 3300035086 Unclassified 1194
158 Ga0373957_0254198 3300035120 Unclassified 740
159 Ga0373943_0326862 3300035170 Unclassified 875
160 Ga0373955_0368428 3300035172 Unclassified 871
161 Ga0373933_0028799 3300035724 Bacteria 3206
162 Ga0395899_0089215 3300037312 Unclassified 2237
163 Ga0395900_0009891 3300037418 Bacteria 9767
164 Ga0395900_0204194 3300037418 Bacteria 1998
165 Ga0395900_0239070 3300037418 Bacteria 1823
166 Ga0395900_0606882 3300037418 Bacteria 1034
167 Ga0395900_0788104 3300037418 Unclassified 879
168 Ga0395898_0011104 3300037466 Bacteria 9377
169 Ga0395901_0003456 3300038443 Bacteria 15923
170 Ga0395901_0153707 3300038443 Bacteria 2417
171 Ga0395901_0244601 3300038443 Bacteria 1870
172 Ga0436363_1234445 3300039450 Unclassified 4004
173 Ga0451853_2138883 3300041512 Bacteria 1055
174 Ga0439454_001279 3300042011 Bacteria 2370
175 Ga0495684_0290504 3300047471 Unclassified 1177
176 Ga0496108_0023057 3300048911 Bacteria 5121
177 Ga0496109_0001244 3300048912 Bacteria 21112
178 Ga0496110_0961236 3300048913 Unclassified 761
179 Ga0496115_0126187 3300048918 Bacteria 2108
180 nmdc:mga08x19_17923_c1 3300050514 Unclassified 4335
181 nmdc:mga08x19_70194_c1 3300050514 Bacteria 2282
182 Ga0070707_100009712
183 JGI24746J21847_1008308
184 JGI25406J46586_10000011
185 JGI25404J52841_10016268
186 JGI25405J52794_10005400
187 Ga0065704_10020781
188 Ga0065712_10102649
189 Ga0065715_10097162
190 Ga0065715_10182652
191 Ga0065715_10459138
192 Ga0070676_10004452
193 Ga0070690_100147941
194 Ga0068869_100200428
195 Ga0068868_100033378
196 Ga0070660_100150758
197 Ga0070689_100057026
198 Ga0070687_100008724
199 Ga0070668_100044914
200 Ga0070669_100023645
201 Ga0070675_100064574
202 Ga0070671_100386100
203 Ga0070659_100023420
204 Ga0070667_100071190
205 Ga0070714_100037057
206 Ga0070713_100166180
207 Ga0070713_100649209
208 Ga0070711_100033582
209 Ga0070711_100298808
210 Ga0070705_100257082
211 Ga0070705_100274027
212 Ga0070708_100058893
213 Ga0070708_100166929
214 Ga0070708_100187842
215 Ga0070708_100226555
216 Ga0070708_100318306
217 Ga0070708_100574175
218 Ga0070662_100081696
219 Ga0070706_100000116
220 Ga0070706_100005715
221 Ga0070706_100022719
222 Ga0070706_100082839
223 Ga0070706_100137211
224 Ga0070706_100367687
225 Ga0070707_100001914
226 Ga0070707_100011498
227 Ga0070707_100031391
228 Ga0070707_100032665
229 Ga0070707_100094014
230 Ga0070707_100559511
231 Ga0070698_100001128
232 Ga0070698_100001373
233 Ga0070698_100014571
234 Ga0070698_100110708
235 Ga0070698_100164040
236 Ga0070698_100393085
237 Ga0070699_100049989
238 Ga0070699_100109108
239 Ga0070699_100125203
240 Ga0070699_100253789
241 Ga0070699_100508805
242 Ga0070699_101052398
243 Ga0070684_100118774
244 Ga0070697_100000885
245 Ga0070697_100001611
246 Ga0070697_100003783
247 Ga0070697_100013369
248 Ga0070697_100016534
249 Ga0070697_100036479
250 Ga0070697_100144613
251 Ga0070697_100216530
252 Ga0070697_100431635
253 Ga0070696_100248589
254 Ga0068860_100224021
255 Ga0068862_100014956
256 Ga0081455_10000398
257 Ga0081455_10001384
258 Ga0081455_10002878
259 Ga0081540_1000010
260 Ga0081540_1017838
261 Ga0081539_10000139
262 Ga0081539_10028867
263 Ga0081539_10046309
264 Ga0081539_10079344
265 Ga0070717_10004053
266 Ga0070717_10013427
267 Ga0070717_10068198
268 Ga0070717_10088127
269 Ga0070716_100240104
270 Ga0070712_100009479
271 Ga0070712_100153086
272 Ga0068871_100623605
273 Ga0075436_100066678
274 Ga0105245_10260536
275 Ga0114129_10009121
276 Ga0105242_10007619
277 Ga0105248_10758810
278 Ga0105249_10019697
279 Ga0105239_10047155
280 Ga0157373_10197705
281 Ga0157374_10013367
282 Ga0157378_10009471
283 Ga0157378_10014779
284 Ga0157378_10226250
285 Ga0163162_10005533
286 Ga0163162_10642418
287 Ga0157372_10563186
288 Ga0157375_10400461
289 Ga0157375_11276278
290 Ga0157379_10103593
291 Ga0157376_10015128
292 Ga0207666_1001254
293 Ga0207697_10000479
294 Ga0207697_10005720
295 Ga0207645_10001870
296 Ga0207684_10000190
297 Ga0207684_10002366
298 Ga0207684_10020496
299 Ga0207684_10073836
300 Ga0207684_11001663
301 Ga0207693_10015715
302 Ga0207693_10015776
303 Ga0207693_10035096
304 Ga0207693_10403380
305 Ga0207663_10005273
306 Ga0207663_10029231
307 Ga0207662_10003513
308 Ga0207657_10167865
309 Ga0207646_10000248
310 Ga0207646_10001113
311 Ga0207646_10011797
312 Ga0207646_10033325
313 Ga0207646_10088291
314 Ga0207646_10561961
315 Ga0207681_10051134
316 Ga0207659_10226001
317 Ga0207700_10080282
318 Ga0207664_10022778
319 Ga0207664_10061599
320 Ga0207644_10301764
321 Ga0207690_10136858
322 Ga0207706_10000611
323 Ga0207686_10006456
324 Ga0207709_10046370
325 Ga0207670_10028248
326 Ga0207704_11006953
327 Ga0207665_10033014
328 Ga0207689_10075495
329 Ga0207651_10206106
330 Ga0207712_10329928
331 Ga0207668_10004871
332 Ga0207668_10033080
333 Ga0207658_10004290
334 Ga0207677_10203152
335 Ga0210002_1018040
336 Ga0268265_10142161
337 Ga0268264_10020083
338 Ga0373934_0096506
339 Ga0373957_0254198
340 Ga0373943_0326862
341 Ga0373955_0368428
342 Ga0373933_0028799
343 Ga0395899_0089215
344 Ga0395900_0009891
345 Ga0395900_0204194
346 Ga0395900_0239070
347 Ga0395900_0606882
348 Ga0395900_0788104
349 Ga0395898_0011104
350 Ga0395901_0003456
351 Ga0395901_0153707
352 Ga0395901_0244601
353 Ga0436363_1234445
354 Ga0451853_2138883
355 Ga0439454_001279
356 Ga0495684_0290504
357 Ga0496108_0023057
358 Ga0496109_0001244
359 Ga0496110_0961236
360 Ga0496115_0126187
361 nmdc:mga08x19_17923_c1
362 nmdc:mga08x19_70194_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kh9-assembly2.cif.gz_B crystal structure of a duf4785 family protein (lpg0956) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 2.00 a resolution 0.7325 107 183
2hue-assembly1.cif.gz_A structure of the h3-h4 chaperone asf1 bound to histones h3 and h4 0.6775 105 179
6a6y-assembly1.cif.gz_A crystal structure of asf1 from plasmodium falciparum 0.6642 106 179
7vcq-assembly3.cif.gz_I structure of viral protein bkrf4 in complex with h3.3-h4-asf1 0.6631 106 179
3bga-assembly1.cif.gz_B crystal structure of beta-galactosidase from bacteroides thetaiotaomicron vpi-5482 0.6621 106 184
ID Description Score Start End Superfamily
af_Q86HV8_101_221_2.60.40.770 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7821 106 185 2.60.40.770
af_Q8WSR7_104_226_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7193 106 185 2.60.40.640
af_Q86IV5_107_223_2.60.40.770 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6972 106 185 2.60.40.770
af_Q554K2_173_290_2.70.220.10 Mainly Beta;Distorted Sandwich;Ganglioside M2 Activator Protein; Chain: A,;Ganglioside GM2 activator 0.6936 106 185 2.70.220.10
af_C6T049_37_160_2.60.40.770 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6474 106 185 2.60.40.770
ID Description Score Start End GO Terms
AF-A0A2V5MXB3-F1-model_v4 Nuclear transport factor 2 family protein 0.931 93 189
AF-A0A2V5MXB3-F1-model_v4 Nuclear transport factor 2 family protein 0.922 93 189
AF-A0A7W0YD18-F1-model_v4 Lipoprotein 0.8771 9 189
AF-A0A349K279-F1-model_v4 Uncharacterized protein 0.8713 93 189
AF-A0A1J4V993-F1-model_v4 Uncharacterized protein 0.8514 105 185

Map