F276610

General Info

Members Datasets Scaffolds Average Seq Length
181 125 181 90

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10000244|rootH2_1000024472
Length 96
Sequence MSHVKAGGTSKNTRDSQGQRLGVKLFGGQKVSVGQVIVRQVGMTKRPGAGTKLSRNFTIHADRDGIVAYKPRRVRRFTGKTVRRTEVVVIDATTEK

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
86 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
93 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
94 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
95 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
96 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
104 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
105 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
106 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
107 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
108 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
112 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
113 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
114 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
115 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
116 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
119 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
122 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
123 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
124 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
125 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.02
Nodule 0
Rhizoplane 2.21
Rhizosphere 59.12
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000002 3300001990 Bacteria 76949
2 JGI24735J21928_10000042 3300002067 Bacteria 58971
3 rootH1_10169626 3300003316 Bacteria 3418
4 rootH2_10000244 3300003320 Bacteria 697651
5 Ga0070658_10343342 3300005327 Bacteria 1277
6 Ga0070680_100584405 3300005336 Bacteria 958
7 Ga0070682_101530802 3300005337 Unclassified 574
8 Ga0070689_101655486 3300005340 Unclassified 582
9 Ga0070687_100340414 3300005343 Unclassified 965
10 Ga0070671_100007741 3300005355 Bacteria 8583
11 Ga0070671_101606302 3300005355 Unclassified 576
12 Ga0070688_100396588 3300005365 Bacteria 1020
13 Ga0070667_100009751 3300005367 Bacteria 7962
14 Ga0070701_10631950 3300005438 Unclassified 713
15 Ga0070678_100090741 3300005456 Bacteria 2343
16 Ga0070679_100615609 3300005530 Unclassified 1029
17 Ga0070684_100000623 3300005535 Bacteria 24450
18 Ga0070686_100712050 3300005544 Unclassified 802
19 Ga0068855_100000003 3300005563 Bacteria 589862
20 Ga0068855_100003265 3300005563 Bacteria 19847
21 Ga0068855_101989452 3300005563 Unclassified 587
22 Ga0070664_100097854 3300005564 Bacteria 2548
23 Ga0068857_100143932 3300005577 Unclassified 2156
24 Ga0068857_100404062 3300005577 Bacteria 1271
25 Ga0068859_100348490 3300005617 Bacteria 1576
26 Ga0068861_100693569 3300005719 Unclassified 945
27 Ga0068862_100678606 3300005844 Unclassified 996
28 Ga0075365_10736540 3300006038 Unclassified 696
29 Ga0075365_10858943 3300006038 Bacteria 640
30 Ga0075368_10000062 3300006042 Bacteria 25855
31 Ga0075363_100000019 3300006048 Bacteria 34359
32 Ga0075364_10011717 3300006051 Bacteria 5335
33 Ga0075364_10019027 3300006051 Bacteria 4308
34 Ga0075364_11158112 3300006051 Unclassified 524
35 Ga0075364_11180791 3300006051 Bacteria 519
36 Ga0075367_10010029 3300006178 Bacteria 4964
37 Ga0075369_10000042 3300006186 Bacteria 33379
38 Ga0075366_10015495 3300006195 Bacteria 4371
39 Ga0075366_10018833 3300006195 Bacteria 3990
40 Ga0097621_100000002 3300006237 Bacteria 172240
41 Ga0097621_100444338 3300006237 Bacteria 1167
42 Ga0075370_10001521 3300006353 Bacteria 10136
43 Ga0075370_10294773 3300006353 Unclassified 964
44 Ga0068871_100002126 3300006358 Bacteria 13428
45 Ga0068871_100671319 3300006358 Bacteria 947
46 Ga0097620_100348474 3300006931 Bacteria 1576
47 Ga0105240_10113793 3300009093 Bacteria 3269
48 Ga0111539_10000492 3300009094 Bacteria 50138
49 Ga0105245_10000002 3300009098 Bacteria 634374
50 Ga0105245_10120864 3300009098 Bacteria 2447
51 Ga0105245_12724498 3300009098 Unclassified 547
52 Ga0114129_11609543 3300009147 Bacteria 795
53 Ga0105243_11072251 3300009148 Bacteria 812
54 Ga0105241_10000007 3300009174 Bacteria 343524
55 Ga0105242_10001924 3300009176 Bacteria 16329
56 Ga0105248_11102967 3300009177 Bacteria 897
57 Ga0105237_10884527 3300009545 Unclassified 900
58 Ga0105237_12063424 3300009545 Unclassified 579
59 Ga0105249_10406014 3300009553 Unclassified 1393
60 Ga0105249_12060899 3300009553 Unclassified 643
61 Ga0105033_103047 3300009986 Unclassified 1402
62 Ga0157369_10000104 3300013105 Bacteria 118133
63 Ga0157369_11144317 3300013105 Unclassified 795
64 Ga0157369_11432753 3300013105 Unclassified 703
65 Ga0157374_10000018 3300013296 Bacteria 286683
66 Ga0157378_10483547 3300013297 Bacteria 1234
67 Ga0157372_10194547 3300013307 Bacteria 2349
68 Ga0163163_10018921 3300014325 Bacteria 6461
69 Ga0163163_10284242 3300014325 Bacteria 1706
70 Ga0163163_10623001 3300014325 Unclassified 1142
71 Ga0157380_10104999 3300014326 Bacteria 2361
72 Ga0206351_10486507 3300020077 Bacteria 520
73 Ga0207705_10268021 3300025909 Bacteria 1305
74 Ga0207654_10000002 3300025911 Bacteria 1460142
75 Ga0207654_10000975 3300025911 Bacteria 15729
76 Ga0207707_10822742 3300025912 Bacteria 772
77 Ga0207695_10255940 3300025913 Unclassified 1649
78 Ga0207671_10571308 3300025914 Unclassified 901
79 Ga0207662_10208747 3300025918 Unclassified 1267
80 Ga0207652_10281537 3300025921 Bacteria 1500
81 Ga0207687_10000001 3300025927 Bacteria 1130810
82 Ga0207687_10000008 3300025927 Bacteria 497738
83 Ga0207687_10230349 3300025927 Bacteria 1463
84 Ga0207644_11003916 3300025931 Unclassified 700
85 Ga0207644_11446963 3300025931 Unclassified 577
86 Ga0207686_10001050 3300025934 Bacteria 16339
87 Ga0207711_10927348 3300025941 Bacteria 809
88 Ga0207689_10153935 3300025942 Bacteria 1895
89 Ga0207661_10000118 3300025944 Bacteria 50730
90 Ga0207679_10564070 3300025945 Unclassified 1023
91 Ga0207667_10000008 3300025949 Bacteria 625138
92 Ga0207667_10003751 3300025949 Bacteria 18715
93 Ga0207667_10496011 3300025949 Bacteria 1239
94 Ga0207667_11263796 3300025949 Unclassified 716
95 Ga0207712_10001763 3300025961 Bacteria 14436
96 Ga0207712_10177622 3300025961 Unclassified 1669
97 Ga0207712_11360551 3300025961 Unclassified 635
98 Ga0207658_10044971 3300025986 Bacteria 3216
99 Ga0207702_10316777 3300026078 Unclassified 1485
100 Ga0207702_12449247 3300026078 Unclassified 509
101 Ga0207674_10561652 3300026116 Unclassified 1102
102 Ga0207674_10895824 3300026116 Unclassified 855
103 Ga0207683_10005840 3300026121 Bacteria 10553
104 Ga0209813_10000002 3300027866 Bacteria 215993
105 Ga0207428_10038562 3300027907 Bacteria 3883
106 Ga0268265_10520067 3300028380 Unclassified 1125
107 Ga0316179_1104898 3300030734 Bacteria 1143
108 Ga0265327_10003876 3300031251 Bacteria 13782
109 Ga0265327_10169983 3300031251 Bacteria 1002
110 Ga0307416_103358216 3300032002 Unclassified 536
111 Ga0395900_0086686 3300037418 Unclassified 3218
112 Ga0395900_0795599 3300037418 Bacteria 874
113 Ga0395898_1478649 3300037466 Unclassified 606
114 Ga0395905_0080378 3300037471 Unclassified 3055
115 Ga0395905_1035419 3300037471 Unclassified 724
116 Ga0395901_0011311 3300038443 Bacteria 9041
117 Ga0395901_0148432 3300038443 Unclassified 2464
118 Ga0451802_1635173 3300041460 Bacteria 1422
119 Ga0495583_0019644 3300046506 Bacteria 3521
120 Ga0495649_0000069 3300046694 Bacteria 90066
121 Ga0495677_0193752 3300047445 Unclassified 789
122 Ga0496109_1047316 3300048912 Bacteria 753
123 Ga0496112_0117186 3300048915 Bacteria 2633
124 Ga0496113_0055141 3300048916 Bacteria 2979
125 Ga0496126_0265179 3300048929 Bacteria 1427
126 Ga0501046_0197299 3300049580 Bacteria 1499
127 Ga0501276_018389 3300049773 Bacteria 650
128 nmdc:mga03683_545614_c1 3300050489 Bacteria 564
129 nmdc:mga03n38_8791_c1 3300050490 Bacteria 3642
130 nmdc:mga00v17_1067904_c1 3300050491 Bacteria 506
131 nmdc:mga00v17_134124_c1 3300050491 Bacteria 1584
132 nmdc:mga00v17_23374_c1 3300050491 Bacteria 3575
133 nmdc:mga00v17_26893_c1 3300050491 Bacteria 3355
134 nmdc:mga00v17_273005_c1 3300050491 Unclassified 1097
135 nmdc:mga0yw44_516005_c1 3300050492 Unclassified 811
136 nmdc:mga0k408_17437_c1 3300050493 Bacteria 4001
137 nmdc:mga0k408_374_c1 3300050493 Bacteria 24527
138 nmdc:mga06z11_31_c1 3300050494 Bacteria 57393
139 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
140 nmdc:mga07m45_174641_c1 3300050496 Unclassified 1249
141 nmdc:mga07m45_47482_c1 3300050496 Bacteria 2414
142 nmdc:mga07m45_62416_c1 3300050496 Unclassified 2112
143 nmdc:mga0qj67_208505_c1 3300050509 Bacteria 1587
144 nmdc:mga08y16_2629_c1 3300050511 Bacteria 18453
145 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
146 nmdc:mga0sz30_43527_c1 3300050516 Bacteria 1539
147 Ga0500610_0000002 3300053079 Bacteria 166752
148 Ga0500643_000010 3300053087 Bacteria 408084
149 Ga0500643_002840 3300053087 Bacteria 8637
150 Ga0500644_0000198 3300053088 Bacteria 36907
151 Ga0500644_0003980 3300053088 Bacteria 3675
152 Ga0500644_0024820 3300053088 Bacteria 1837
153 Ga0500644_0034419 3300053088 Bacteria 1634
154 Ga0500646_0000510 3300053090 Bacteria 11408
155 Ga0500583_0000057 3300053092 Bacteria 71874
156 Ga0500583_0002559 3300053092 Bacteria 5495
157 Ga0500651_0049807 3300053093 Bacteria 2630
158 Ga0500651_0428630 3300053093 Bacteria 739
159 Ga0500650_0000001 3300053098 Bacteria 818797
160 Ga0500555_000001 3300053103 Bacteria 1353713
161 Ga0500555_000002 3300053103 Bacteria 1314346
162 Ga0500562_003874 3300053108 Bacteria 3771
163 Ga0500562_196899 3300053108 Bacteria 546
164 Ga0500594_0000001 3300053118 Bacteria 1178472
165 Ga0500594_0000311 3300053118 Bacteria 10932
166 Ga0500594_0030919 3300053118 Bacteria 1409
167 Ga0500594_0163031 3300053118 Bacteria 721
168 Ga0500614_000850 3300053123 Bacteria 7692
169 Ga0500628_000009 3300053129 Bacteria 122386
170 Ga0500628_012044 3300053129 Unclassified 1584
171 Ga0500642_0008021 3300053130 Bacteria 3586
172 Ga0500652_000119 3300053131 Bacteria 30219
173 Ga0500655_000400 3300053133 Bacteria 9181
174 Ga0500561_0000001 3300053137 Bacteria 957685
175 Ga0500568_0013420 3300053139 Bacteria 3736
176 Ga0500577_0000288 3300053142 Bacteria 13114
177 Ga0500577_0003910 3300053142 Bacteria 3893
178 Ga0500579_002076 3300053143 Bacteria 11828
179 Ga0500589_000002 3300053147 Bacteria 245055
180 Ga0500633_0052009 3300053160 Unclassified 1416
181 Ga0500570_000003 3300053724 Bacteria 149500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10000492 Ga0111539_1000049243 89
2 3300027907 Ga0207428_10038562 Ga0207428_100385623 89
3 3300050511 nmdc:mga08y16_2629_c1 nmdc:mga08y16_2629_c1_8109_8381 89
4 3300001990 JGI24737J22298_10000002 JGI24737J22298_1000000235 90
5 3300002067 JGI24735J21928_10000042 JGI24735J21928_1000004212 90
6 3300003316 rootH1_10169626 rootH1_101696262 90
7 3300003320 rootH2_10000244 rootH2_1000024472 90
8 3300005327 Ga0070658_10343342 Ga0070658_103433422 90
9 3300005336 Ga0070680_100584405 Ga0070680_1005844051 90
10 3300005337 Ga0070682_101530802 Ga0070682_1015308022 90
11 3300005340 Ga0070689_101655486 Ga0070689_1016554861 90
12 3300005343 Ga0070687_100340414 Ga0070687_1003404142 90
13 3300005355 Ga0070671_100007741 Ga0070671_1000077416 90
14 3300005355 Ga0070671_101606302 Ga0070671_1016063021 90
15 3300005365 Ga0070688_100396588 Ga0070688_1003965882 90
16 3300005367 Ga0070667_100009751 Ga0070667_1000097517 90
17 3300005438 Ga0070701_10631950 Ga0070701_106319502 90
18 3300005456 Ga0070678_100090741 Ga0070678_1000907413 90
19 3300005530 Ga0070679_100615609 Ga0070679_1006156092 90
20 3300005535 Ga0070684_100000623 Ga0070684_1000006237 90
21 3300005544 Ga0070686_100712050 Ga0070686_1007120501 90
22 3300005563 Ga0068855_100000003 Ga0068855_100000003583 90
23 3300005563 Ga0068855_100003265 Ga0068855_10000326511 90
24 3300005563 Ga0068855_101989452 Ga0068855_1019894522 90
25 3300005564 Ga0070664_100097854 Ga0070664_1000978543 90
26 3300005577 Ga0068857_100143932 Ga0068857_1001439323 90
27 3300005577 Ga0068857_100404062 Ga0068857_1004040622 90
28 3300005617 Ga0068859_100348490 Ga0068859_1003484902 90
29 3300005719 Ga0068861_100693569 Ga0068861_1006935692 90
30 3300005844 Ga0068862_100678606 Ga0068862_1006786062 90
31 3300006038 Ga0075365_10736540 Ga0075365_107365401 90
32 3300006038 Ga0075365_10858943 Ga0075365_108589432 90
33 3300006042 Ga0075368_10000062 Ga0075368_1000006219 90
34 3300006048 Ga0075363_100000019 Ga0075363_10000001936 90
35 3300006051 Ga0075364_10011717 Ga0075364_100117173 90
36 3300006051 Ga0075364_10019027 Ga0075364_100190274 90
37 3300006051 Ga0075364_11158112 Ga0075364_111581122 90
38 3300006051 Ga0075364_11180791 Ga0075364_111807911 90
39 3300006178 Ga0075367_10010029 Ga0075367_100100297 90
40 3300006186 Ga0075369_10000042 Ga0075369_1000004219 90
41 3300006195 Ga0075366_10015495 Ga0075366_100154953 90
42 3300006195 Ga0075366_10018833 Ga0075366_100188332 90
43 3300006237 Ga0097621_100000002 Ga0097621_100000002155 90
44 3300006237 Ga0097621_100444338 Ga0097621_1004443382 90
45 3300006353 Ga0075370_10001521 Ga0075370_100015215 90
46 3300006353 Ga0075370_10294773 Ga0075370_102947731 90
47 3300006358 Ga0068871_100002126 Ga0068871_10000212614 90
48 3300006358 Ga0068871_100671319 Ga0068871_1006713192 90
49 3300006931 Ga0097620_100348474 Ga0097620_1003484742 90
50 3300009093 Ga0105240_10113793 Ga0105240_101137932 90
51 3300009098 Ga0105245_10000002 Ga0105245_10000002600 90
52 3300009098 Ga0105245_10120864 Ga0105245_101208642 90
53 3300009098 Ga0105245_12724498 Ga0105245_127244982 90
54 3300009147 Ga0114129_11609543 Ga0114129_116095431 90
55 3300009148 Ga0105243_11072251 Ga0105243_110722511 90
56 3300009174 Ga0105241_10000007 Ga0105241_1000000784 90
57 3300009176 Ga0105242_10001924 Ga0105242_1000192417 90
58 3300009177 Ga0105248_11102967 Ga0105248_111029671 90
59 3300009545 Ga0105237_10884527 Ga0105237_108845272 90
60 3300009545 Ga0105237_12063424 Ga0105237_120634241 90
61 3300009553 Ga0105249_10406014 Ga0105249_104060142 90
62 3300009553 Ga0105249_12060899 Ga0105249_120608992 90
63 3300009986 Ga0105033_103047 Ga0105033_1030472 90
64 3300013105 Ga0157369_10000104 Ga0157369_1000010460 90
65 3300013105 Ga0157369_11144317 Ga0157369_111443171 90
66 3300013105 Ga0157369_11432753 Ga0157369_114327532 90
67 3300013296 Ga0157374_10000018 Ga0157374_1000001867 90
68 3300013297 Ga0157378_10483547 Ga0157378_104835472 90
69 3300013307 Ga0157372_10194547 Ga0157372_101945473 90
70 3300014325 Ga0163163_10018921 Ga0163163_100189213 90
71 3300014325 Ga0163163_10284242 Ga0163163_102842422 90
72 3300014325 Ga0163163_10623001 Ga0163163_106230012 90
73 3300014326 Ga0157380_10104999 Ga0157380_101049993 90
74 3300020077 Ga0206351_10486507 Ga0206351_104865071 90
75 3300025909 Ga0207705_10268021 Ga0207705_102680212 90
76 3300025911 Ga0207654_10000002 Ga0207654_100000021462 90
77 3300025911 Ga0207654_10000975 Ga0207654_100009756 90
78 3300025912 Ga0207707_10822742 Ga0207707_108227421 90
79 3300025913 Ga0207695_10255940 Ga0207695_102559402 90
80 3300025914 Ga0207671_10571308 Ga0207671_105713081 90
81 3300025918 Ga0207662_10208747 Ga0207662_102087472 90
82 3300025921 Ga0207652_10281537 Ga0207652_102815372 90
83 3300025927 Ga0207687_10000001 Ga0207687_10000001611 90
84 3300025927 Ga0207687_10000008 Ga0207687_10000008501 90
85 3300025927 Ga0207687_10230349 Ga0207687_102303492 90
86 3300025931 Ga0207644_11003916 Ga0207644_110039162 90
87 3300025931 Ga0207644_11446963 Ga0207644_114469631 90
88 3300025934 Ga0207686_10001050 Ga0207686_100010502 90
89 3300025941 Ga0207711_10927348 Ga0207711_109273481 90
90 3300025942 Ga0207689_10153935 Ga0207689_101539351 90
91 3300025944 Ga0207661_10000118 Ga0207661_1000011827 90
92 3300025945 Ga0207679_10564070 Ga0207679_105640702 90
93 3300025949 Ga0207667_10000008 Ga0207667_10000008573 90
94 3300025949 Ga0207667_10003751 Ga0207667_1000375111 90
95 3300025949 Ga0207667_10496011 Ga0207667_104960112 90
96 3300025949 Ga0207667_11263796 Ga0207667_112637962 90
97 3300025961 Ga0207712_10001763 Ga0207712_1000176317 90
98 3300025961 Ga0207712_10177622 Ga0207712_101776222 90
99 3300025961 Ga0207712_11360551 Ga0207712_113605512 90
100 3300025986 Ga0207658_10044971 Ga0207658_100449713 90
101 3300026078 Ga0207702_10316777 Ga0207702_103167772 90
102 3300026078 Ga0207702_12449247 Ga0207702_124492471 90
103 3300026116 Ga0207674_10561652 Ga0207674_105616522 90
104 3300026116 Ga0207674_10895824 Ga0207674_108958242 90
105 3300026121 Ga0207683_10005840 Ga0207683_100058407 90
106 3300027866 Ga0209813_10000002 Ga0209813_10000002104 90
107 3300028380 Ga0268265_10520067 Ga0268265_105200672 90
108 3300030734 Ga0316179_1104898 Ga0316179_11048982 90
109 3300031251 Ga0265327_10003876 Ga0265327_100038764 90
110 3300031251 Ga0265327_10169983 Ga0265327_101699832 90
111 3300032002 Ga0307416_103358216 Ga0307416_1033582162 90
112 3300037418 Ga0395900_0086686 Ga0395900_0086686_86_358 90
113 3300037418 Ga0395900_0795599 Ga0395900_0795599_282_554 90
114 3300037466 Ga0395898_1478649 Ga0395898_1478649_181_453 90
115 3300037471 Ga0395905_0080378 Ga0395905_0080378_2312_2584 90
116 3300037471 Ga0395905_1035419 Ga0395905_1035419_171_443 90
117 3300038443 Ga0395901_0011311 Ga0395901_0011311_6203_6475 90
118 3300038443 Ga0395901_0148432 Ga0395901_0148432_1777_2049 90
119 3300041460 Ga0451802_1635173 Ga0451802_1635173_405_677 90
120 3300046506 Ga0495583_0019644 Ga0495583_0019644_2294_2566 90
121 3300046694 Ga0495649_0000069 Ga0495649_0000069_41731_42003 90
122 3300047445 Ga0495677_0193752 Ga0495677_0193752_196_468 90
123 3300048912 Ga0496109_1047316 Ga0496109_1047316_442_714 90
124 3300048915 Ga0496112_0117186 Ga0496112_0117186_1640_1912 90
125 3300048916 Ga0496113_0055141 Ga0496113_0055141_1892_2164 90
126 3300048929 Ga0496126_0265179 Ga0496126_0265179_55_327 90
127 3300049580 Ga0501046_0197299 Ga0501046_0197299_1144_1416 90
128 3300049773 Ga0501276_018389 Ga0501276_018389_168_440 90
129 3300050489 nmdc:mga03683_545614_c1 nmdc:mga03683_545614_c1_272_544 90
130 3300050490 nmdc:mga03n38_8791_c1 nmdc:mga03n38_8791_c1_3030_3302 90
131 3300050491 nmdc:mga00v17_1067904_c1 nmdc:mga00v17_1067904_c1_138_410 90
132 3300050491 nmdc:mga00v17_134124_c1 nmdc:mga00v17_134124_c1_180_452 90
133 3300050491 nmdc:mga00v17_23374_c1 nmdc:mga00v17_23374_c1_1128_1400 90
134 3300050491 nmdc:mga00v17_26893_c1 nmdc:mga00v17_26893_c1_1540_1812 90
135 3300050491 nmdc:mga00v17_273005_c1 nmdc:mga00v17_273005_c1_680_952 90
136 3300050492 nmdc:mga0yw44_516005_c1 nmdc:mga0yw44_516005_c1_348_620 90
137 3300050493 nmdc:mga0k408_17437_c1 nmdc:mga0k408_17437_c1_190_462 90
138 3300050493 nmdc:mga0k408_374_c1 nmdc:mga0k408_374_c1_2655_2927 90
139 3300050494 nmdc:mga06z11_31_c1 nmdc:mga06z11_31_c1_41975_42247 90
140 3300050495 nmdc:mga04h51_2_c1 nmdc:mga04h51_2_c1_120999_121271 90
141 3300050496 nmdc:mga07m45_174641_c1 nmdc:mga07m45_174641_c1_307_579 90
142 3300050496 nmdc:mga07m45_47482_c1 nmdc:mga07m45_47482_c1_931_1203 90
143 3300050496 nmdc:mga07m45_62416_c1 nmdc:mga07m45_62416_c1_698_970 90
144 3300050509 nmdc:mga0qj67_208505_c1 nmdc:mga0qj67_208505_c1_179_451 90
145 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_735013_735291 90
146 3300050516 nmdc:mga0sz30_43527_c1 nmdc:mga0sz30_43527_c1_780_1052 90
147 3300053079 Ga0500610_0000002 Ga0500610_0000002_70340_70612 90
148 3300053087 Ga0500643_000010 Ga0500643_000010_61034_61306 90
149 3300053087 Ga0500643_002840 Ga0500643_002840_2748_3020 90
150 3300053088 Ga0500644_0000198 Ga0500644_0000198_29423_29695 90
151 3300053088 Ga0500644_0003980 Ga0500644_0003980_2969_3241 90
152 3300053088 Ga0500644_0024820 Ga0500644_0024820_307_579 90
153 3300053088 Ga0500644_0034419 Ga0500644_0034419_1131_1403 90
154 3300053090 Ga0500646_0000510 Ga0500646_0000510_3177_3449 90
155 3300053092 Ga0500583_0000057 Ga0500583_0000057_56891_57172 90
156 3300053092 Ga0500583_0002559 Ga0500583_0002559_428_700 90
157 3300053093 Ga0500651_0049807 Ga0500651_0049807_137_430 90
158 3300053093 Ga0500651_0428630 Ga0500651_0428630_111_392 90
159 3300053098 Ga0500650_0000001 Ga0500650_0000001_811338_811610 90
160 3300053103 Ga0500555_000001 Ga0500555_000001_1224162_1224434 90
161 3300053103 Ga0500555_000002 Ga0500555_000002_108120_108392 90
162 3300053108 Ga0500562_003874 Ga0500562_003874_1046_1318 90
163 3300053108 Ga0500562_196899 Ga0500562_196899_151_423 90
164 3300053118 Ga0500594_0000001 Ga0500594_0000001_294723_294995 90
165 3300053118 Ga0500594_0000311 Ga0500594_0000311_10479_10751 90
166 3300053118 Ga0500594_0030919 Ga0500594_0030919_825_1106 90
167 3300053118 Ga0500594_0163031 Ga0500594_0163031_107_379 90
168 3300053123 Ga0500614_000850 Ga0500614_000850_6825_7118 90
169 3300053129 Ga0500628_000009 Ga0500628_000009_65924_66196 90
170 3300053129 Ga0500628_012044 Ga0500628_012044_261_533 90
171 3300053130 Ga0500642_0008021 Ga0500642_0008021_2832_3113 90
172 3300053131 Ga0500652_000119 Ga0500652_000119_27473_27745 90
173 3300053133 Ga0500655_000400 Ga0500655_000400_4759_5031 90
174 3300053137 Ga0500561_0000001 Ga0500561_0000001_109115_109387 90
175 3300053139 Ga0500568_0013420 Ga0500568_0013420_1115_1387 90
176 3300053142 Ga0500577_0000288 Ga0500577_0000288_3525_3797 90
177 3300053142 Ga0500577_0003910 Ga0500577_0003910_1962_2234 90
178 3300053143 Ga0500579_002076 Ga0500579_002076_8466_8738 90
179 3300053147 Ga0500589_000002 Ga0500589_000002_115869_116150 90
180 3300053160 Ga0500633_0052009 Ga0500633_0052009_188_460 90
181 3300053724 Ga0500570_000003 Ga0500570_000003_133363_133635 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

83

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8508 20 90
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8409 20 90
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.8316 23 90
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8251 20 90
8apo-assembly1.cif.gz_Au structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.8234 22 89
ID Description Score Start End Superfamily
af_Q9GZG5_165_337_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.874 67 90 3.40.50.10130
af_Q8K284_174_250_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8208 67 90 1.10.10.10
af_Q7KWX9_3_63_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8142 27 90 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8125 20 90 2.40.50.100
af_O82264_156_305_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.809 66 87 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A2M7D8R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9587 31 90 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7W1EQX5-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.955 28 90 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M7MG04-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.936 28 90 GO:0003735
GO:0006412
GO:0022625
AF-A0A2M7D8R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9289 31 90 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M7MG04-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9222 28 90 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
78.64 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map