F276488

General Info

Members Datasets Scaffolds Average Seq Length
180 137 360 322

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2875391855|2875394694
Length 357
Sequence IVLDGVHKRYGERRALDGLDLTVGAGTVHAVLGPNGAGKTTVVRIMSTLLRPDAGRVTVAGFDVRERASEVRRRIGLLGQHAAVDEQLGGRQNLEMFGRLYHLGARRAGSRADELLERFGLAETGRKAVRQYSGGMRRRLDLAASLITEPAVLFLDEPTTGLDPRGRAEVWDAVRSLVGGGTTVLLTTQYLEEADQLADRISLIDEGRVAAEGTSDQLKALVGGDRIDIVLRDAARLAEAAALLGAGDPVLDPDRRLLSAPAPDRMAALTRAVRALQEAGIEAEDIAVRRPTLDEVFLSLTGRPAGGRTAQGAGHRTAGDTGGRTAHGTRERMEAGADGRTAHETAGRTAHGTEAAA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
24 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
44 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
45 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
46 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
47 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
49 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
50 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
51 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
52 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
53 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
65 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
66 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
108 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
109 2501939600 Micromonospora sp. L5 Isolate Unclassified
110 2643221548 Streptomyces sp. Root55 Isolate Unclassified
111 2643221578 Streptomyces sp. Root63 Isolate Unclassified
112 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
113 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
114 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
115 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
116 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
117 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
118 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
119 2862574272 Streptomyces sp. AcE210 Isolate Nodule
120 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
121 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
122 2867369537 Streptomyces sp. Z26 Isolate Unclassified
123 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
124 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
125 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
126 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
127 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
128 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
129 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
130 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
131 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
132 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
133 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
134 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
135 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
136 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
137 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 0
Isolates 19.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0.56
Rhizoplane 4.44
Rhizosphere 77.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10041901 3300005327 Bacteria 3694
2 Ga0070680_100002587 3300005336 Bacteria 13390
3 Ga0070682_100036627 3300005337 Bacteria 3000
4 Ga0070659_100323245 3300005366 Bacteria 1290
5 Ga0070709_10169016 3300005434 Bacteria 1526
6 Ga0070714_100023382 3300005435 Bacteria 5076
7 Ga0070714_100048580 3300005435 Bacteria 3609
8 Ga0070714_100183113 3300005435 Bacteria 1907
9 Ga0070714_100242945 3300005435 Bacteria 1662
10 Ga0070714_100385837 3300005435 Bacteria 1321
11 Ga0070713_100004105 3300005436 Bacteria 9705
12 Ga0070713_100172696 3300005436 Bacteria 1937
13 Ga0070710_10028107 3300005437 Bacteria 3005
14 Ga0070710_10083750 3300005437 Bacteria 1867
15 Ga0070711_100013737 3300005439 Bacteria 5090
16 Ga0070678_100261046 3300005456 Bacteria 1457
17 Ga0070681_10032295 3300005458 Bacteria 5253
18 Ga0070706_100297433 3300005467 Bacteria 1506
19 Ga0070679_100126433 3300005530 Bacteria 2539
20 Ga0068856_100089981 3300005614 Bacteria 3053
21 Ga0068856_100492372 3300005614 Bacteria 1247
22 Ga0068870_10102786 3300005840 Bacteria 1618
23 Ga0081538_10000520 3300005981 Bacteria 43003
24 Ga0081538_10020394 3300005981 Bacteria 4880
25 Ga0081538_10066168 3300005981 Bacteria 2028
26 Ga0081539_10000135 3300005985 Bacteria 172789
27 Ga0070717_10094405 3300006028 Bacteria 2530
28 Ga0070712_100016875 3300006175 Bacteria 4722
29 Ga0070712_100104109 3300006175 Bacteria 2105
30 Ga0070712_100259277 3300006175 Bacteria 1392
31 Ga0105245_10147611 3300009098 Bacteria 2220
32 Ga0157372_10477541 3300013307 Bacteria 1453
33 Ga0163163_10132806 3300014325 Bacteria 2529
34 Ga0213875_10000303 3300021388 Bacteria 47142
35 Ga0213875_10145813 3300021388 Bacteria 1109
36 Ga0224572_1005949 3300024225 Bacteria 2195
37 Ga0207426_1012882 3300025302 Bacteria 3122
38 Ga0207688_10062132 3300025901 Bacteria 2106
39 Ga0207699_10016410 3300025906 Bacteria 3873
40 Ga0207684_10319869 3300025910 Bacteria 1337
41 Ga0207693_10013636 3300025915 Bacteria 6549
42 Ga0207693_10014758 3300025915 Bacteria 6275
43 Ga0207663_10046449 3300025916 Bacteria 2676
44 Ga0207700_10018336 3300025928 Bacteria 4700
45 Ga0207700_10132339 3300025928 Bacteria 2038
46 Ga0207700_10225481 3300025928 Bacteria 1591
47 Ga0207664_10014650 3300025929 Bacteria 5670
48 Ga0207664_10037648 3300025929 Bacteria 3746
49 Ga0207664_10150327 3300025929 Bacteria 1978
50 Ga0207664_10153607 3300025929 Bacteria 1957
51 Ga0207664_10162466 3300025929 Bacteria 1906
52 Ga0207690_10253688 3300025932 Bacteria 1360
53 Ga0207661_10021795 3300025944 Bacteria 4808
54 Ga0207702_10045373 3300026078 Bacteria 3697
55 Ga0207648_10199115 3300026089 Bacteria 1776
56 Ga0207683_10549339 3300026121 Bacteria 1068
57 Ga0207698_10138082 3300026142 Bacteria 2095
58 Ga0307513_10032397 3300031456 Bacteria 5895
59 Ga0307410_10190800 3300031852 Bacteria 1558
60 Ga0307409_100086589 3300031995 Bacteria 2551
61 Ga0307415_100070416 3300032126 Bacteria 2456
62 Ga0307415_100261439 3300032126 Bacteria 1412
63 Ga0316214_1001988 3300033545 Bacteria 2477
64 Ga0373926_0000177 3300035083 Bacteria 14320
65 Ga0373934_0102811 3300035086 Bacteria 1155
66 Ga0373944_0000897 3300035089 Bacteria 7325
67 Ga0373923_0005561 3300035111 Bacteria 4285
68 Ga0373936_0027397 3300035113 Bacteria 2234
69 Ga0373936_0027773 3300035113 Bacteria 2220
70 Ga0373945_0000012 3300035116 Bacteria 37996
71 Ga0373954_0067455 3300035118 Bacteria 1695
72 Ga0373943_0000289 3300035170 Bacteria 20838
73 Ga0373946_0000039 3300035171 Bacteria 33079
74 Ga0373924_0006321 3300035410 Bacteria 4239
75 Ga0373935_0000294 3300035692 Bacteria 24704
76 Ga0373927_0002206 3300035695 Bacteria 14316
77 Ga0373947_0000351 3300035725 Bacteria 26026
78 Ga0373937_0026087 3300036401 Bacteria 5280
79 Ga0373937_0078725 3300036401 Bacteria 3046
80 Ga0373925_0006976 3300037068 Bacteria 8260
81 Ga0395898_0083423 3300037466 Bacteria 3080
82 Ga0436364_0037760 3300037853 Bacteria 3316
83 Ga0436364_0330965 3300037853 Bacteria 247749
84 Ga0436364_0785403 3300037853 Bacteria 1725
85 Ga0439436_0001249 3300041404 Bacteria 7254
86 Ga0439439_0003532 3300041406 Bacteria 3454
87 Ga0451791_0252034 3300041451 Bacteria 5122
88 Ga0451797_0620805 3300041453 Bacteria 5730
89 Ga0451833_0258635 3300041491 Bacteria 1419
90 Ga0451843_0865924 3300041509 Bacteria 4792
91 Ga0451853_1882159 3300041512 Bacteria 4421
92 Ga0439433_0010062 3300041999 Bacteria 2064
93 Ga0439449_0011726 3300042007 Bacteria 3293
94 Ga0439462_0010797 3300042015 Bacteria 2317
95 Ga0466969_0003439 3300044656 Bacteria 8423
96 Ga0495592_0089365 3300046454 Bacteria 2213
97 Ga0495592_0093104 3300046454 Bacteria 2159
98 Ga0495603_0003326 3300046455 Bacteria 9570
99 Ga0495603_0014417 3300046455 Bacteria 4780
100 Ga0495641_0004585 3300046461 Bacteria 9678
101 Ga0495651_0024255 3300046462 Bacteria 4721
102 Ga0495651_0035692 3300046462 Bacteria 3870
103 Ga0495653_0040607 3300046463 Bacteria 3635
104 Ga0495653_0048603 3300046463 Bacteria 3273
105 Ga0495664_0000598 3300046477 Bacteria 18297
106 Ga0495585_0033970 3300046492 Bacteria 2884
107 Ga0495618_0004280 3300046514 Bacteria 8792
108 Ga0495630_0021350 3300046517 Bacteria 4781
109 Ga0495652_0012846 3300046529 Bacteria 7544
110 Ga0495652_0064019 3300046529 Bacteria 3095
111 Ga0495640_0024864 3300046533 Bacteria 4352
112 Ga0495587_0041893 3300046536 Bacteria 2732
113 Ga0495645_0114722 3300046543 Bacteria 1903
114 Ga0495667_0056195 3300046559 Bacteria 2588
115 Ga0495667_0139465 3300046559 Bacteria 1563
116 Ga0495634_0017411 3300046642 Bacteria 5126
117 Ga0495611_0017497 3300046648 Bacteria 3067
118 Ga0495635_0000209 3300046663 Bacteria 37055
119 Ga0495635_0025564 3300046663 Bacteria 4113
120 Ga0495635_0078959 3300046663 Bacteria 2253
121 Ga0495657_0015687 3300046675 Bacteria 5537
122 Ga0495657_0143561 3300046675 Bacteria 1486
123 Ga0495599_0027305 3300046678 Bacteria 3578
124 Ga0495647_0093153 3300046681 Bacteria 1238
125 Ga0495624_0002182 3300046690 Bacteria 14940
126 Ga0495600_0013941 3300046809 Bacteria 5065
127 Ga0495600_0017711 3300046809 Bacteria 4534
128 Ga0495581_0053444 3300047315 Bacteria 2333
129 Ga0495674_0000512 3300047319 Bacteria 35529
130 Ga0495674_0007505 3300047319 Bacteria 10411
131 Ga0495674_0044148 3300047319 Bacteria 3964
132 Ga0495676_0042443 3300047321 Bacteria 3733
133 Ga0495676_0064905 3300047321 Bacteria 2836
134 Ga0495676_0103468 3300047321 Bacteria 2102
135 Ga0495680_0036261 3300047322 Bacteria 3961
136 Ga0495685_031561 3300047447 Bacteria 1820
137 Ga0495684_0001001 3300047471 Bacteria 23006
138 Ga0495593_0103387 3300047673 Bacteria 1459
139 Ga0496102_0017605 3300048905 Bacteria 6261
140 Ga0496108_0003051 3300048911 Bacteria 13460
141 Ga0496109_0000405 3300048912 Bacteria 38562
142 Ga0496111_0002094 3300048914 Bacteria 11906
143 Ga0496115_0347665 3300048918 Bacteria 1210
144 Ga0495619_0304621 3300053085 Bacteria 1104
145 Ga0500616_0003095 3300053153 Bacteria 13042
146 2875394694 2875391855 Bacteria 7600475
147 2501940679 2501939600 Bacteria 6907073
148 2643763472 2643221548 Bacteria 8053412
149 2643899723 2643221578 Bacteria 9213798
150 2644403691 2643221673 Bacteria 9196637
151 2644463660 2643221682 Bacteria 6743283
152 2793977818 2791355406 Bacteria 11364898
153 2795786912 2795385470 Bacteria 8317180
154 2804849619 2802429296 Bacteria 7227771
155 2862179473 2862178590 Bacteria 8583590
156 2862294601 2862290372 Bacteria 7471434
157 2862578461 2862574272 Bacteria 10567477
158 2862710129 2862705112 Bacteria 6563286
159 2867348551 2867346516 Bacteria 7608576
160 2867348801 2867346516 Bacteria 7608576
161 2867352187 2867346516 Bacteria 7608576
162 2867372935 2867369537 Bacteria 6501581
163 2891328648 2891326441 Bacteria 6439512
164 2897563888 2897561785 Bacteria 3256946
165 2912761847 2912757875 Bacteria 7940295
166 2946049942 2946045630 Bacteria 8527308
167 2990045574 2990044586 Bacteria 6603797
168 2990047013 2990044586 Bacteria 6603797
169 2997600230 2997600082 Bacteria 9896405
170 3006493866 3006486233 Bacteria 8157040
171 8008485494 8008485437 Bacteria 7198341
172 8008485860 8008485437 Bacteria 7198341
173 8025481339 8025478263 Bacteria 8209203
174 8025524944 8025524527 Bacteria 7197316
175 8025529968 8025524527 Bacteria 7197316
176 8025538160 8025530807 Bacteria 8495698
177 8047897885 8047893842 Bacteria 11723082
178 8048361009 8048356638 Bacteria 11044339
179 8048374848 8048369669 Bacteria 11666822
180 8048383374 8048379754 Bacteria 11877923
181 Ga0070658_10041901
182 Ga0070680_100002587
183 Ga0070682_100036627
184 Ga0070659_100323245
185 Ga0070709_10169016
186 Ga0070714_100023382
187 Ga0070714_100048580
188 Ga0070714_100183113
189 Ga0070714_100242945
190 Ga0070714_100385837
191 Ga0070713_100004105
192 Ga0070713_100172696
193 Ga0070710_10028107
194 Ga0070710_10083750
195 Ga0070711_100013737
196 Ga0070678_100261046
197 Ga0070681_10032295
198 Ga0070706_100297433
199 Ga0070679_100126433
200 Ga0068856_100089981
201 Ga0068856_100492372
202 Ga0068870_10102786
203 Ga0081538_10000520
204 Ga0081538_10020394
205 Ga0081538_10066168
206 Ga0081539_10000135
207 Ga0070717_10094405
208 Ga0070712_100016875
209 Ga0070712_100104109
210 Ga0070712_100259277
211 Ga0105245_10147611
212 Ga0157372_10477541
213 Ga0163163_10132806
214 Ga0213875_10000303
215 Ga0213875_10145813
216 Ga0224572_1005949
217 Ga0207426_1012882
218 Ga0207688_10062132
219 Ga0207699_10016410
220 Ga0207684_10319869
221 Ga0207693_10013636
222 Ga0207693_10014758
223 Ga0207663_10046449
224 Ga0207700_10018336
225 Ga0207700_10132339
226 Ga0207700_10225481
227 Ga0207664_10014650
228 Ga0207664_10037648
229 Ga0207664_10150327
230 Ga0207664_10153607
231 Ga0207664_10162466
232 Ga0207690_10253688
233 Ga0207661_10021795
234 Ga0207702_10045373
235 Ga0207648_10199115
236 Ga0207683_10549339
237 Ga0207698_10138082
238 Ga0307513_10032397
239 Ga0307410_10190800
240 Ga0307409_100086589
241 Ga0307415_100070416
242 Ga0307415_100261439
243 Ga0316214_1001988
244 Ga0373926_0000177
245 Ga0373934_0102811
246 Ga0373944_0000897
247 Ga0373923_0005561
248 Ga0373936_0027397
249 Ga0373936_0027773
250 Ga0373945_0000012
251 Ga0373954_0067455
252 Ga0373943_0000289
253 Ga0373946_0000039
254 Ga0373924_0006321
255 Ga0373935_0000294
256 Ga0373927_0002206
257 Ga0373947_0000351
258 Ga0373937_0026087
259 Ga0373937_0078725
260 Ga0373925_0006976
261 Ga0395898_0083423
262 Ga0436364_0037760
263 Ga0436364_0330965
264 Ga0436364_0785403
265 Ga0439436_0001249
266 Ga0439439_0003532
267 Ga0451791_0252034
268 Ga0451797_0620805
269 Ga0451833_0258635
270 Ga0451843_0865924
271 Ga0451853_1882159
272 Ga0439433_0010062
273 Ga0439449_0011726
274 Ga0439462_0010797
275 Ga0466969_0003439
276 Ga0495592_0089365
277 Ga0495592_0093104
278 Ga0495603_0003326
279 Ga0495603_0014417
280 Ga0495641_0004585
281 Ga0495651_0024255
282 Ga0495651_0035692
283 Ga0495653_0040607
284 Ga0495653_0048603
285 Ga0495664_0000598
286 Ga0495585_0033970
287 Ga0495618_0004280
288 Ga0495630_0021350
289 Ga0495652_0012846
290 Ga0495652_0064019
291 Ga0495640_0024864
292 Ga0495587_0041893
293 Ga0495645_0114722
294 Ga0495667_0056195
295 Ga0495667_0139465
296 Ga0495634_0017411
297 Ga0495611_0017497
298 Ga0495635_0000209
299 Ga0495635_0025564
300 Ga0495635_0078959
301 Ga0495657_0015687
302 Ga0495657_0143561
303 Ga0495599_0027305
304 Ga0495647_0093153
305 Ga0495624_0002182
306 Ga0495600_0013941
307 Ga0495600_0017711
308 Ga0495581_0053444
309 Ga0495674_0000512
310 Ga0495674_0007505
311 Ga0495674_0044148
312 Ga0495676_0042443
313 Ga0495676_0064905
314 Ga0495676_0103468
315 Ga0495680_0036261
316 Ga0495685_031561
317 Ga0495684_0001001
318 Ga0495593_0103387
319 Ga0496102_0017605
320 Ga0496108_0003051
321 Ga0496109_0000405
322 Ga0496111_0002094
323 Ga0496115_0347665
324 Ga0495619_0304621
325 Ga0500616_0003095
326 2875394694
327 2501940679
328 2643763472
329 2643899723
330 2644403691
331 2644463660
332 2793977818
333 2795786912
334 2804849619
335 2862179473
336 2862294601
337 2862578461
338 2862710129
339 2867348551
340 2867348801
341 2867352187
342 2867372935
343 2891328648
344 2897563888
345 2912761847
346 2946049942
347 2990045574
348 2990047013
349 2997600230
350 3006493866
351 8008485494
352 8008485860
353 8025481339
354 8025524944
355 8025529968
356 8025538160
357 8047897885
358 8048361009
359 8048374848
360 8048383374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

16

160

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

110

193

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9562 7 227
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9503 6 221
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9423 6 221
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9367 6 220
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.9333 8 225
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9573 1 230 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9562 7 227 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9462 5 221 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 7 221 3.40.50.300
af_O65934_308_546_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9425 7 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A429TR11-F1-model_v4 deleted 0.9644 1 169
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9516 81 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0D7KEI4-F1-model_v4 ABC transporter domain-containing protein 0.9464 99 221 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3C0JFJ3-F1-model_v4 ABC transporter 0.946 1 160 GO:0005524
GO:0016887
AF-A0A3M1J999-F1-model_v4 ABC transporter ATP-binding protein 0.9457 1 227 GO:0005524
GO:0016887

Map