F276406

General Info

Members Datasets Scaffolds Average Seq Length
180 143 360 229

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0009409|Ga0500646_0009409_716_1534
Length 272
Sequence MVIPFPVEDLSGTSFQTELGTALQTCQDGRMPTRTRHTGRREDALSRERIVDAAIELLDVAGEGGLTFRALAAHLKTGPGAIYWHVANKSELLIAATDAVLSHVMPADVADGTPEDEIRAVALGVFDAIDVHPWVGRQLSIAPAEPATLRIFERIGRQIRALGVPDSAQFTAASAVLNYILGVGGQNAANARAYDGVPNRTDFLETASAAWANLDPDEYPFTRNVADQLRDHDDRVQFLDGVDLILAGIASLRRSPASGLPRQSASEVRAPI

Samples

Sample ID Description Type Environment
1 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
96 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
104 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
123 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
124 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
125 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
126 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
129 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
134 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
135 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
136 2738541307 Variovorax sp. GV008 Isolate Unclassified
137 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
138 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
139 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
140 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
141 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
142 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
143 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.44
Metatranscriptomes 0
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 1.11
Rhizoplane 2.22
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500646_0009409 3300053090 Bacteria 2502
2 rootH1_10056341 3300003316 Bacteria 1855
3 rootH2_10001277 3300003320 Bacteria 8743
4 rootL2_10007271 3300003322 Bacteria 1587
5 rootH1_10083102 3300003323 Bacteria 8868
6 rootH1_10084525 3300003323 Bacteria 4428
7 rootH1_10151214 3300003323 Bacteria 2694
8 Ga0065165_1000059 3300005262 Bacteria 182314
9 Ga0065165_1000348 3300005262 Bacteria 75762
10 Ga0070670_100416121 3300005331 Bacteria 1188
11 Ga0068869_100085107 3300005334 Bacteria 2368
12 Ga0068869_100374531 3300005334 Bacteria 1165
13 Ga0070682_100021734 3300005337 Bacteria 3791
14 Ga0070668_100008598 3300005347 Bacteria 7584
15 Ga0070668_100059911 3300005347 Bacteria 2947
16 Ga0070674_100126390 3300005356 Bacteria 1900
17 Ga0070667_100039722 3300005367 Bacteria 3945
18 Ga0070667_100056936 3300005367 Bacteria 3303
19 Ga0070684_100213981 3300005535 Bacteria 1757
20 Ga0070665_100284755 3300005548 Bacteria 1655
21 Ga0068859_100580808 3300005617 Bacteria 1214
22 Ga0068859_100605436 3300005617 Bacteria 1189
23 Ga0068858_100014724 3300005842 Bacteria 7362
24 Ga0068860_100001690 3300005843 Bacteria 23583
25 Ga0068862_100607189 3300005844 Bacteria 1051
26 Ga0075368_10000867 3300006042 Bacteria 9363
27 Ga0075367_10001350 3300006178 Bacteria 10440
28 Ga0097620_100138434 3300006931 Bacteria 2508
29 Ga0097620_100580789 3300006931 Bacteria 1214
30 Ga0097620_100605361 3300006931 Bacteria 1189
31 Ga0105240_10936930 3300009093 Bacteria 930
32 Ga0105247_10611283 3300009101 Bacteria 809
33 Ga0105237_10000463 3300009545 Bacteria 57508
34 Ga0105238_10003046 3300009551 Bacteria 16716
35 Ga0105239_10000090 3300010375 Bacteria 127911
36 Ga0157374_11027716 3300013296 Bacteria 844
37 Ga0182008_10002007 3300014497 Bacteria 13063
38 Ga0157377_10212780 3300014745 Bacteria 1233
39 Ga0157376_10117442 3300014969 Bacteria 2352
40 Ga0157376_10287919 3300014969 Bacteria 1550
41 Ga0157376_11102258 3300014969 Bacteria 820
42 Ga0182006_1000057 3300015261 Bacteria 168707
43 Ga0182007_10012850 3300015262 Bacteria 3211
44 Ga0182005_1015501 3300015265 Bacteria 2125
45 Ga0163161_10541522 3300017792 Bacteria 953
46 Ga0213876_10167167 3300021384 Bacteria 1170
47 Ga0209130_1010946 3300025284 Bacteria 2461
48 Ga0207688_10048348 3300025901 Bacteria 2376
49 Ga0207647_10324356 3300025904 Bacteria 874
50 Ga0207695_10004667 3300025913 Bacteria 18566
51 Ga0207671_10004554 3300025914 Bacteria 13172
52 Ga0207694_10069912 3300025924 Bacteria 2743
53 Ga0207687_10196281 3300025927 Bacteria 1574
54 Ga0207670_10615403 3300025936 Bacteria 893
55 Ga0207669_10340503 3300025937 Bacteria 1155
56 Ga0207689_10077515 3300025942 Bacteria 2731
57 Ga0207658_10081194 3300025986 Bacteria 2486
58 Ga0207658_10618198 3300025986 Bacteria 974
59 Ga0207678_10326508 3300026067 Bacteria 1320
60 Ga0207676_10794208 3300026095 Bacteria 923
61 Ga0209813_10007560 3300027866 Bacteria 2709
62 Ga0268266_10308485 3300028379 Bacteria 1478
63 Ga0268264_10000048 3300028381 Bacteria 334457
64 Ga0307517_10058994 3300028786 Bacteria 3684
65 Ga0307515_10010933 3300028794 Bacteria 17303
66 Ga0307515_10021449 3300028794 Bacteria 11454
67 Ga0307515_10051688 3300028794 Bacteria 6119
68 Ga0265338_10001197 3300028800 Bacteria 42864
69 Ga0307513_10001913 3300031456 Bacteria 29595
70 Ga0307513_10005498 3300031456 Bacteria 16730
71 Ga0307513_10005901 3300031456 Bacteria 16077
72 Ga0307513_10341704 3300031456 Bacteria 1247
73 Ga0307509_10000065 3300031507 Bacteria 142674
74 Ga0307508_10003484 3300031616 Bacteria 15888
75 Ga0307508_10025567 3300031616 Bacteria 5352
76 Ga0307514_10003178 3300031649 Bacteria 16050
77 Ga0307516_10003173 3300031730 Bacteria 21387
78 Ga0307516_10009125 3300031730 Bacteria 11110
79 Ga0307516_10010773 3300031730 Bacteria 10012
80 Ga0307516_10290074 3300031730 Bacteria 1315
81 Ga0307507_10134038 3300033179 Bacteria 1926
82 Ga0307510_10042337 3300033180 Bacteria 4964
83 Ga0436365_1154351 3300039437 Bacteria 2449
84 Ga0451791_0246155 3300041451 Bacteria 2632
85 Ga0451791_0364004 3300041451 Bacteria 773
86 Ga0451853_2421254 3300041512 Bacteria 1025
87 Ga0451853_3155504 3300041512 Bacteria 3103
88 Ga0466969_0019937 3300044656 Bacteria 3477
89 Ga0466972_0071882 3300044658 Bacteria 1650
90 Ga0466963_0066388 3300044694 Bacteria 2420
91 Ga0466970_0295527 3300044765 Bacteria 913
92 Ga0466967_0198192 3300045976 Bacteria 1900
93 Ga0466967_0319497 3300045976 Bacteria 1497
94 Ga0495617_000133 3300046452 Bacteria 49698
95 Ga0495627_012650 3300046453 Bacteria 2989
96 Ga0495638_0038551 3300046460 Bacteria 3035
97 Ga0495650_0017826 3300046471 Bacteria 3548
98 Ga0495605_0208574 3300046474 Bacteria 849
99 Ga0495639_0166923 3300046475 Bacteria 1067
100 Ga0495607_0000046 3300046501 Bacteria 123998
101 Ga0495583_0011287 3300046506 Bacteria 5139
102 Ga0495606_0151814 3300046507 Bacteria 1359
103 Ga0495606_0340852 3300046507 Bacteria 798
104 Ga0495616_0060791 3300046513 Bacteria 1854
105 Ga0495631_0000420 3300046518 Bacteria 29217
106 Ga0495637_0020969 3300046520 Bacteria 2998
107 Ga0495648_0001194 3300046524 Bacteria 26006
108 Ga0495609_0014465 3300046538 Bacteria 3707
109 Ga0495668_0004744 3300046616 Bacteria 9518
110 Ga0495611_0000001 3300046648 Bacteria 2628469
111 Ga0495625_0000001 3300046660 Bacteria 1641829
112 Ga0495661_0000103 3300046665 Bacteria 104642
113 Ga0495661_0143414 3300046665 Bacteria 1297
114 Ga0495613_0165442 3300046689 Bacteria 1572
115 Ga0495670_0005131 3300046691 Bacteria 6439
116 Ga0495671_0000112 3300046692 Bacteria 72401
117 Ga0495589_0075070 3300046794 Bacteria 1648
118 Ga0495660_0000097 3300046810 Bacteria 94152
119 Ga0495660_0000182 3300046810 Bacteria 67980
120 Ga0495676_0164209 3300047321 Bacteria 1568
121 Ga0495687_143382 3300047443 Bacteria 827
122 Ga0495679_000001 3300047446 Bacteria 1607568
123 Ga0495673_0000001 3300047469 Bacteria 1630730
124 Ga0495673_0000030 3300047469 Bacteria 468915
125 Ga0495673_0000562 3300047469 Bacteria 37800
126 Ga0495673_0024498 3300047469 Bacteria 2915
127 Ga0495686_0000175 3300047472 Bacteria 122163
128 Ga0496100_0030775 3300048903 Bacteria 3332
129 Ga0496109_0618215 3300048912 Bacteria 1020
130 Ga0496116_0008116 3300048919 Bacteria 9173
131 Ga0496121_0001290 3300048924 Bacteria 43154
132 Ga0496121_0001648 3300048924 Bacteria 36903
133 Ga0496121_0020339 3300048924 Bacteria 6579
134 Ga0496121_0472071 3300048924 Bacteria 803
135 Ga0496126_0001083 3300048929 Bacteria 45812
136 Ga0495678_000296 3300049459 Bacteria 54659
137 Ga0495682_0000350 3300049460 Bacteria 33753
138 Ga0495682_0092552 3300049460 Bacteria 1085
139 Ga0501031_0002713 3300049568 Bacteria 11267
140 Ga0501032_0001238 3300049569 Bacteria 20484
141 Ga0501033_0035627 3300049570 Bacteria 3730
142 Ga0501034_0111921 3300049571 Bacteria 2720
143 Ga0501036_0068575 3300049572 Bacteria 3001
144 Ga0501037_0004641 3300049573 Bacteria 9983
145 Ga0501038_0092486 3300049574 Bacteria 2532
146 Ga0501042_0015549 3300049578 Bacteria 5212
147 Ga0501043_0022237 3300049579 Bacteria 4974
148 Ga0501046_0014018 3300049580 Bacteria 6769
149 Ga0501047_0019388 3300049581 Bacteria 6524
150 Ga0501048_0034915 3300049582 Bacteria 3623
151 Ga0501035_0005870 3300049822 Bacteria 11570
152 Ga0501044_0008539 3300049823 Bacteria 11224
153 nmdc:mga06z11_576_c1 3300050494 Bacteria 13423
154 nmdc:mga04h51_6958_c1 3300050495 Bacteria 2963
155 Ga0500643_000002 3300053087 Bacteria 1277657
156 Ga0500646_0000166 3300053090 Bacteria 19703
157 Ga0500641_0012034 3300053096 Bacteria 3152
158 Ga0500555_000545 3300053103 Bacteria 15048
159 Ga0500560_001486 3300053107 Bacteria 4093
160 Ga0500594_0024513 3300053118 Bacteria 1538
161 Ga0500621_094750 3300053126 Bacteria 1184
162 Ga0500559_0001466 3300053136 Bacteria 13354
163 Ga0500573_0016084 3300053140 Bacteria 4245
164 Ga0500600_0094726 3300053149 Bacteria 1587
165 Ga0500622_0000544 3300053156 Bacteria 34698
166 Ga0500633_0017808 3300053160 Unclassified 2092
167 Ga0500633_0069302 3300053160 Bacteria 1257
168 Ga0500636_0088842 3300053177 Bacteria 1772
169 Ga0500636_0127986 3300053177 Bacteria 1418
170 Ga0500645_000476 3300053730 Bacteria 27430
171 2513855713 2513237137 Bacteria 9558895
172 2585314137 2582581314 Bacteria 11452267
173 2738885914 2738541307 Bacteria 8606193
174 2738945906 2738541317 Bacteria 5340176
175 2902842116 2902837492 Bacteria 6697721
176 2906643133 2906635258 Bacteria 8601019
177 2906666225 2906660503 Bacteria 8595048
178 2913310409 2913308742 Bacteria 5350706
179 2932798144 2932794094 Bacteria 7915132
180 2954007488 2954002825 Bacteria 9173742
181 Ga0500646_0009409
182 rootH1_10056341
183 rootH2_10001277
184 rootL2_10007271
185 rootH1_10083102
186 rootH1_10084525
187 rootH1_10151214
188 Ga0065165_1000059
189 Ga0065165_1000348
190 Ga0070670_100416121
191 Ga0068869_100085107
192 Ga0068869_100374531
193 Ga0070682_100021734
194 Ga0070668_100008598
195 Ga0070668_100059911
196 Ga0070674_100126390
197 Ga0070667_100039722
198 Ga0070667_100056936
199 Ga0070684_100213981
200 Ga0070665_100284755
201 Ga0068859_100580808
202 Ga0068859_100605436
203 Ga0068858_100014724
204 Ga0068860_100001690
205 Ga0068862_100607189
206 Ga0075368_10000867
207 Ga0075367_10001350
208 Ga0097620_100138434
209 Ga0097620_100580789
210 Ga0097620_100605361
211 Ga0105240_10936930
212 Ga0105247_10611283
213 Ga0105237_10000463
214 Ga0105238_10003046
215 Ga0105239_10000090
216 Ga0157374_11027716
217 Ga0182008_10002007
218 Ga0157377_10212780
219 Ga0157376_10117442
220 Ga0157376_10287919
221 Ga0157376_11102258
222 Ga0182006_1000057
223 Ga0182007_10012850
224 Ga0182005_1015501
225 Ga0163161_10541522
226 Ga0213876_10167167
227 Ga0209130_1010946
228 Ga0207688_10048348
229 Ga0207647_10324356
230 Ga0207695_10004667
231 Ga0207671_10004554
232 Ga0207694_10069912
233 Ga0207687_10196281
234 Ga0207670_10615403
235 Ga0207669_10340503
236 Ga0207689_10077515
237 Ga0207658_10081194
238 Ga0207658_10618198
239 Ga0207678_10326508
240 Ga0207676_10794208
241 Ga0209813_10007560
242 Ga0268266_10308485
243 Ga0268264_10000048
244 Ga0307517_10058994
245 Ga0307515_10010933
246 Ga0307515_10021449
247 Ga0307515_10051688
248 Ga0265338_10001197
249 Ga0307513_10001913
250 Ga0307513_10005498
251 Ga0307513_10005901
252 Ga0307513_10341704
253 Ga0307509_10000065
254 Ga0307508_10003484
255 Ga0307508_10025567
256 Ga0307514_10003178
257 Ga0307516_10003173
258 Ga0307516_10009125
259 Ga0307516_10010773
260 Ga0307516_10290074
261 Ga0307507_10134038
262 Ga0307510_10042337
263 Ga0436365_1154351
264 Ga0451791_0246155
265 Ga0451791_0364004
266 Ga0451853_2421254
267 Ga0451853_3155504
268 Ga0466969_0019937
269 Ga0466972_0071882
270 Ga0466963_0066388
271 Ga0466970_0295527
272 Ga0466967_0198192
273 Ga0466967_0319497
274 Ga0495617_000133
275 Ga0495627_012650
276 Ga0495638_0038551
277 Ga0495650_0017826
278 Ga0495605_0208574
279 Ga0495639_0166923
280 Ga0495607_0000046
281 Ga0495583_0011287
282 Ga0495606_0151814
283 Ga0495606_0340852
284 Ga0495616_0060791
285 Ga0495631_0000420
286 Ga0495637_0020969
287 Ga0495648_0001194
288 Ga0495609_0014465
289 Ga0495668_0004744
290 Ga0495611_0000001
291 Ga0495625_0000001
292 Ga0495661_0000103
293 Ga0495661_0143414
294 Ga0495613_0165442
295 Ga0495670_0005131
296 Ga0495671_0000112
297 Ga0495589_0075070
298 Ga0495660_0000097
299 Ga0495660_0000182
300 Ga0495676_0164209
301 Ga0495687_143382
302 Ga0495679_000001
303 Ga0495673_0000001
304 Ga0495673_0000030
305 Ga0495673_0000562
306 Ga0495673_0024498
307 Ga0495686_0000175
308 Ga0496100_0030775
309 Ga0496109_0618215
310 Ga0496116_0008116
311 Ga0496121_0001290
312 Ga0496121_0001648
313 Ga0496121_0020339
314 Ga0496121_0472071
315 Ga0496126_0001083
316 Ga0495678_000296
317 Ga0495682_0000350
318 Ga0495682_0092552
319 Ga0501031_0002713
320 Ga0501032_0001238
321 Ga0501033_0035627
322 Ga0501034_0111921
323 Ga0501036_0068575
324 Ga0501037_0004641
325 Ga0501038_0092486
326 Ga0501042_0015549
327 Ga0501043_0022237
328 Ga0501046_0014018
329 Ga0501047_0019388
330 Ga0501048_0034915
331 Ga0501035_0005870
332 Ga0501044_0008539
333 nmdc:mga06z11_576_c1
334 nmdc:mga04h51_6958_c1
335 Ga0500643_000002
336 Ga0500646_0000166
337 Ga0500641_0012034
338 Ga0500555_000545
339 Ga0500560_001486
340 Ga0500594_0024513
341 Ga0500621_094750
342 Ga0500559_0001466
343 Ga0500573_0016084
344 Ga0500600_0094726
345 Ga0500622_0000544
346 Ga0500633_0017808
347 Ga0500633_0069302
348 Ga0500636_0088842
349 Ga0500636_0127986
350 Ga0500645_000476
351 2513855713
352 2585314137
353 2738885914
354 2738945906
355 2902842116
356 2906643133
357 2906666225
358 2913310409
359 2932798144
360 2954007488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

50

96

0.98

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

105

253

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hxo-assembly1.cif.gz_B structure of the transcriptional regulator sco7222, a tetr from streptomyces coelicolor 0.9123 15 224
2hxo-assembly1.cif.gz_B structure of the transcriptional regulator sco7222, a tetr from streptomyces coelicolor 0.9039 15 224
2hxo-assembly1.cif.gz_A structure of the transcriptional regulator sco7222, a tetr from streptomyces coelicolor 0.8999 15 225
2hxo-assembly1.cif.gz_A structure of the transcriptional regulator sco7222, a tetr from streptomyces coelicolor 0.8958 15 225
5yek-assembly1.cif.gz_B crystal structure of bioq 0.8517 15 220
ID Description Score Start End Superfamily
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9817 15 69 1.10.10.60
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.972 14 69 1.10.10.60
2ns8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.965 19 73 1.10.10.60
2y30A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9616 16 69 1.10.10.60
3zqlD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9583 15 69 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6L6PI49-F1-model_v4 Tetracycline repressor TetR C-terminal domain-containing protein 0.9599 79 222 GO:0045892
AF-U2RYD2-F1-model_v4 Transcriptional regulator, TetR family 0.9596 22 221 GO:0000976
GO:0003700
GO:0045892
AF-A0A5D0QRU0-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9548 1 222 GO:0000976
GO:0003700
GO:0045892
AF-A0A1H6PFY2-F1-model_v4 Transcriptional regulator, TetR family 0.9531 58 225
AF-A0A5Q0HEB2-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9526 15 223 GO:0000976
GO:0003700
GO:0045892

Map