F276286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 180 | 144 | 163 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0019006|Ga0501031_0019006_3204_4241 |
| Length | 345 |
| Sequence | MTEYHEAAAGTAVSRPPDIKAVPVRHPGRWIAVVVIAVLAAMMVHTLVFSKVQRGNGNESRFGWAVVGDYLFSHQILHGVLVTVELTAIAMAIGIVGGVLLAVMRLSPNPVLSGVSWLYLWFFRGTPLIVQIAFWYVGISFLYPQLSLGIPFGPEFAHYSANDLIVPMVAASIGLGFNEAAYMAEIVRAGILSVDEGQHEAASSLGMTRALLMRRIVLPQAMRVIIPPTGNEVISMLKNTSLVFAAGVVDVYYAQQEISATTYQTEPMLLVACLWYLALTSVLMIGQYYIERHYARGSVRELPPTPLQRFKSLVGRRNVLPPATVDLEAQAVLGGLGRGPGGQHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 4 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 5 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 6 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 7 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 8 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 9 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 10 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 11 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 12 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 13 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 14 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 15 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 84 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 90 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 91 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 92 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 93 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 101 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 102 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 103 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 104 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 105 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 111 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 133 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 134 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 142 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 143 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 144 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.44 |
| Metatranscriptomes | 1.11 |
| Isolates | 9.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0.56 |
| Rhizoplane | 3.33 |
| Rhizosphere | 85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006562J51391_1040945 | 3300003578 | Bacteria | 1700 |
| 2 | Ga0070676_10020087 | 3300005328 | Bacteria | 3723 |
| 3 | Ga0070683_100237243 | 3300005329 | Bacteria | 1734 |
| 4 | Ga0070670_100025632 | 3300005331 | Bacteria | 5072 |
| 5 | Ga0068868_100107849 | 3300005338 | Bacteria | 2260 |
| 6 | Ga0070689_100048328 | 3300005340 | Bacteria | 3281 |
| 7 | Ga0070661_100154004 | 3300005344 | Bacteria | 1739 |
| 8 | Ga0070661_100345981 | 3300005344 | Bacteria | 1166 |
| 9 | Ga0070668_100031562 | 3300005347 | Bacteria | 4031 |
| 10 | Ga0070714_100149430 | 3300005435 | Bacteria | 2104 |
| 11 | Ga0070708_100056440 | 3300005445 | Bacteria | 3493 |
| 12 | Ga0070708_100150341 | 3300005445 | Bacteria | 2165 |
| 13 | Ga0070708_100204271 | 3300005445 | Bacteria | 1850 |
| 14 | Ga0070678_100340480 | 3300005456 | Bacteria | 1286 |
| 15 | Ga0070685_10022953 | 3300005466 | Bacteria | 3409 |
| 16 | Ga0070706_100000083 | 3300005467 | Bacteria | 109341 |
| 17 | Ga0070706_100000323 | 3300005467 | Bacteria | 58191 |
| 18 | Ga0070706_100120999 | 3300005467 | Bacteria | 2440 |
| 19 | Ga0070707_100013319 | 3300005468 | Bacteria | 7692 |
| 20 | Ga0070698_100009269 | 3300005471 | Bacteria | 10561 |
| 21 | Ga0070698_100183833 | 3300005471 | Bacteria | 2028 |
| 22 | Ga0070698_100261646 | 3300005471 | Bacteria | 1662 |
| 23 | Ga0070699_100000109 | 3300005518 | Bacteria | 77030 |
| 24 | Ga0070679_100187261 | 3300005530 | Bacteria | 2040 |
| 25 | Ga0070697_100046476 | 3300005536 | Bacteria | 3518 |
| 26 | Ga0068853_100123652 | 3300005539 | Bacteria | 2310 |
| 27 | Ga0070672_100165124 | 3300005543 | Bacteria | 1839 |
| 28 | Ga0070665_100196649 | 3300005548 | Bacteria | 2017 |
| 29 | Ga0070664_100365339 | 3300005564 | Bacteria | 1315 |
| 30 | Ga0068856_100079949 | 3300005614 | Bacteria | 3242 |
| 31 | Ga0068856_100107252 | 3300005614 | Bacteria | 2789 |
| 32 | Ga0070702_100070803 | 3300005615 | Bacteria | 2059 |
| 33 | Ga0068861_100127592 | 3300005719 | Bacteria | 2060 |
| 34 | Ga0068870_10037701 | 3300005840 | Bacteria | 2493 |
| 35 | Ga0068860_100224268 | 3300005843 | Bacteria | 1825 |
| 36 | Ga0068862_100026741 | 3300005844 | Bacteria | 4851 |
| 37 | Ga0070717_10029611 | 3300006028 | Bacteria | 4393 |
| 38 | Ga0070716_100117536 | 3300006173 | Bacteria | 1659 |
| 39 | Ga0111539_10056447 | 3300009094 | Bacteria | 4667 |
| 40 | Ga0105245_10601094 | 3300009098 | Bacteria | 1126 |
| 41 | Ga0105242_10078759 | 3300009176 | Bacteria | 2751 |
| 42 | Ga0105237_10864872 | 3300009545 | Bacteria | 911 |
| 43 | Ga0105238_10009689 | 3300009551 | Bacteria | 9642 |
| 44 | Ga0105238_10235096 | 3300009551 | Bacteria | 1810 |
| 45 | Ga0157369_10134802 | 3300013105 | Bacteria | 2615 |
| 46 | Ga0157369_10220263 | 3300013105 | Bacteria | 1986 |
| 47 | Ga0157374_10195949 | 3300013296 | Bacteria | 1977 |
| 48 | Ga0163162_10054901 | 3300013306 | Bacteria | 4008 |
| 49 | Ga0206353_11310748 | 3300020082 | Bacteria | 3307 |
| 50 | Ga0213876_10000552 | 3300021384 | Bacteria | 28013 |
| 51 | Ga0207647_10023776 | 3300025904 | Bacteria | 4049 |
| 52 | Ga0207643_10041059 | 3300025908 | Bacteria | 2606 |
| 53 | Ga0207705_10052600 | 3300025909 | Bacteria | 2932 |
| 54 | Ga0207684_10000006 | 3300025910 | Bacteria | 688605 |
| 55 | Ga0207684_10000104 | 3300025910 | Bacteria | 161447 |
| 56 | Ga0207684_10234107 | 3300025910 | Bacteria | 1585 |
| 57 | Ga0207654_10198757 | 3300025911 | Bacteria | 1319 |
| 58 | Ga0207662_10046209 | 3300025918 | Bacteria | 2575 |
| 59 | Ga0207657_10029210 | 3300025919 | Bacteria | 5021 |
| 60 | Ga0207649_10029106 | 3300025920 | Bacteria | 3260 |
| 61 | Ga0207652_10408072 | 3300025921 | Bacteria | 1226 |
| 62 | Ga0207646_10000914 | 3300025922 | Bacteria | 38039 |
| 63 | Ga0207646_10000978 | 3300025922 | Bacteria | 36791 |
| 64 | Ga0207646_10040289 | 3300025922 | Bacteria | 4201 |
| 65 | Ga0207646_10459642 | 3300025922 | Bacteria | 1148 |
| 66 | Ga0207659_10142945 | 3300025926 | Bacteria | 1859 |
| 67 | Ga0207687_10058538 | 3300025927 | Bacteria | 2711 |
| 68 | Ga0207664_10201917 | 3300025929 | Bacteria | 1716 |
| 69 | Ga0207706_10032986 | 3300025933 | Bacteria | 4608 |
| 70 | Ga0207665_10066402 | 3300025939 | Bacteria | 2455 |
| 71 | Ga0207691_10022900 | 3300025940 | Bacteria | 5887 |
| 72 | Ga0207689_10020461 | 3300025942 | Bacteria | 5569 |
| 73 | Ga0207679_10510188 | 3300025945 | Bacteria | 1074 |
| 74 | Ga0207668_10047181 | 3300025972 | Bacteria | 2948 |
| 75 | Ga0207658_10079649 | 3300025986 | Bacteria | 2507 |
| 76 | Ga0207703_10422513 | 3300026035 | Bacteria | 1241 |
| 77 | Ga0207708_10044543 | 3300026075 | Bacteria | 3381 |
| 78 | Ga0207702_10064770 | 3300026078 | Bacteria | 3128 |
| 79 | Ga0207648_10041298 | 3300026089 | Bacteria | 4051 |
| 80 | Ga0207674_10028265 | 3300026116 | Bacteria | 5920 |
| 81 | Ga0207674_10075403 | 3300026116 | Bacteria | 3383 |
| 82 | Ga0207675_100177717 | 3300026118 | Bacteria | 2037 |
| 83 | Ga0207683_10057638 | 3300026121 | Bacteria | 3410 |
| 84 | Ga0209588_1014499 | 3300027671 | Bacteria | 2414 |
| 85 | Ga0265319_1014845 | 3300028563 | Bacteria | 3039 |
| 86 | Ga0265318_10011101 | 3300028577 | Bacteria | 3893 |
| 87 | Ga0265338_10055984 | 3300028800 | Bacteria | 3502 |
| 88 | Ga0265320_10026902 | 3300031240 | Bacteria | 3005 |
| 89 | Ga0265327_10032287 | 3300031251 | Bacteria | 2932 |
| 90 | Ga0265316_10091605 | 3300031344 | Bacteria | 2319 |
| 91 | Ga0316576_10018018 | 3300031727 | Bacteria | 4812 |
| 92 | Ga0316578_10037963 | 3300031728 | Bacteria | 2776 |
| 93 | Ga0316574_0018796 | 3300035398 | Bacteria | 4068 |
| 94 | Ga0316584_0002023 | 3300036712 | Bacteria | 12688 |
| 95 | Ga0395899_0081631 | 3300037312 | Bacteria | 2352 |
| 96 | Ga0395899_0263469 | 3300037312 | Bacteria | 1178 |
| 97 | Ga0395900_0012486 | 3300037418 | Bacteria | 8686 |
| 98 | Ga0395900_0034044 | 3300037418 | Bacteria | 5244 |
| 99 | Ga0395898_0081724 | 3300037466 | Bacteria | 3115 |
| 100 | Ga0395898_0158407 | 3300037466 | Bacteria | 2165 |
| 101 | Ga0395905_0016383 | 3300037471 | Bacteria | 7042 |
| 102 | Ga0436364_0400910 | 3300037853 | Bacteria | 5636 |
| 103 | Ga0395901_0108600 | 3300038443 | Bacteria | 2912 |
| 104 | Ga0436365_1781586 | 3300039437 | Bacteria | 55120 |
| 105 | Ga0439439_0017143 | 3300041406 | Bacteria | 1778 |
| 106 | Ga0439431_0024244 | 3300041997 | Bacteria | 1475 |
| 107 | Ga0439433_0002057 | 3300041999 | Bacteria | 4231 |
| 108 | Ga0439442_009967 | 3300042002 | Bacteria | 1923 |
| 109 | Ga0439449_0025083 | 3300042007 | Bacteria | 2228 |
| 110 | Ga0439457_000032 | 3300042014 | Bacteria | 28723 |
| 111 | Ga0466969_0064278 | 3300044656 | Bacteria | 1777 |
| 112 | Ga0466966_0025950 | 3300044684 | Bacteria | 3827 |
| 113 | Ga0466966_0080225 | 3300044684 | Bacteria | 2033 |
| 114 | Ga0466961_0007076 | 3300044693 | Bacteria | 7136 |
| 115 | Ga0466961_0018000 | 3300044693 | Bacteria | 4543 |
| 116 | Ga0466963_0173655 | 3300044694 | Bacteria | 1503 |
| 117 | Ga0466964_0148996 | 3300044706 | Bacteria | 1083 |
| 118 | Ga0466971_0080505 | 3300044719 | Bacteria | 1485 |
| 119 | Ga0466970_0155932 | 3300044765 | Bacteria | 1262 |
| 120 | Ga0466957_0006331 | 3300044842 | Bacteria | 6674 |
| 121 | Ga0466957_0016917 | 3300044842 | Bacteria | 4267 |
| 122 | Ga0466957_0028158 | 3300044842 | Bacteria | 3344 |
| 123 | Ga0466960_0009816 | 3300044901 | Bacteria | 3957 |
| 124 | Ga0466960_0013805 | 3300044901 | Bacteria | 3441 |
| 125 | Ga0466960_0017532 | 3300044901 | Bacteria | 3124 |
| 126 | Ga0466960_0053088 | 3300044901 | Bacteria | 1963 |
| 127 | Ga0466959_0011311 | 3300045049 | Bacteria | 6408 |
| 128 | Ga0466959_0039684 | 3300045049 | Bacteria | 3480 |
| 129 | Ga0466959_0055812 | 3300045049 | Bacteria | 2883 |
| 130 | Ga0466959_0097439 | 3300045049 | Bacteria | 2108 |
| 131 | Ga0466958_0007503 | 3300045836 | Bacteria | 6005 |
| 132 | Ga0466958_0019796 | 3300045836 | Bacteria | 3919 |
| 133 | Ga0466967_0016041 | 3300045976 | Bacteria | 5893 |
| 134 | Ga0466967_0109346 | 3300045976 | Bacteria | 2538 |
| 135 | Ga0466967_0136004 | 3300045976 | Bacteria | 2285 |
| 136 | Ga0466967_0690214 | 3300045976 | Bacteria | 1011 |
| 137 | Ga0495627_006853 | 3300046453 | Bacteria | 4430 |
| 138 | Ga0495596_0020802 | 3300046500 | Bacteria | 2683 |
| 139 | Ga0495616_0018526 | 3300046513 | Bacteria | 3820 |
| 140 | Ga0495631_0008894 | 3300046518 | Bacteria | 5040 |
| 141 | Ga0495588_0153222 | 3300046674 | Bacteria | 1218 |
| 142 | Ga0495657_0048248 | 3300046675 | Bacteria | 2874 |
| 143 | Ga0495604_0004927 | 3300047317 | Bacteria | 10585 |
| 144 | Ga0495673_0043444 | 3300047469 | Bacteria | 2012 |
| 145 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 146 | Ga0495686_0015292 | 3300047472 | Bacteria | 5247 |
| 147 | Ga0495686_0070815 | 3300047472 | Bacteria | 2148 |
| 148 | Ga0496101_0166459 | 3300048904 | Bacteria | 1693 |
| 149 | Ga0496106_0282750 | 3300048909 | Bacteria | 1329 |
| 150 | Ga0496108_0189305 | 3300048911 | Bacteria | 1783 |
| 151 | Ga0496109_0098435 | 3300048912 | Bacteria | 2711 |
| 152 | Ga0496112_0184349 | 3300048915 | Bacteria | 2051 |
| 153 | Ga0496113_0235075 | 3300048916 | Bacteria | 1462 |
| 154 | Ga0496120_0087592 | 3300048923 | Bacteria | 1671 |
| 155 | Ga0501031_0019006 | 3300049568 | Bacteria | 4473 |
| 156 | Ga0501043_0005595 | 3300049579 | Bacteria | 10123 |
| 157 | Ga0501047_0000107 | 3300049581 | Bacteria | 102041 |
| 158 | Ga0501047_0003422 | 3300049581 | Bacteria | 15003 |
| 159 | Ga0501048_0000381 | 3300049582 | Bacteria | 30814 |
| 160 | Ga0501081_0027878 | 3300049743 | Bacteria | 3808 |
| 161 | Ga0501035_0078441 | 3300049822 | Bacteria | 2917 |
| 162 | Ga0501045_0259382 | 3300049824 | Bacteria | 1294 |
| 163 | Ga0500568_0015492 | 3300053139 | Bacteria | 3412 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0148996 | Ga0466964_0148996_223_1068 | 239 |
| 2 | 3300049581 | Ga0501047_0000107 | Ga0501047_0000107_98579_99475 | 239 |
| 3 | 3300005471 | Ga0070698_100009269 | Ga0070698_1000092698 | 241 |
| 4 | 3300048909 | Ga0496106_0282750 | Ga0496106_0282750_548_1306 | 244 |
| 5 | 3300044684 | Ga0466966_0080225 | Ga0466966_0080225_1132_2010 | 249 |
| 6 | 3300005467 | Ga0070706_100000323 | Ga0070706_10000032319 | 250 |
| 7 | 3300005518 | Ga0070699_100000109 | Ga0070699_10000010937 | 250 |
| 8 | 3300025910 | Ga0207684_10000006 | Ga0207684_10000006181 | 250 |
| 9 | 3300025922 | Ga0207646_10000914 | Ga0207646_1000091416 | 250 |
| 10 | 3300005445 | Ga0070708_100150341 | Ga0070708_1001503412 | 252 |
| 11 | 3300005471 | Ga0070698_100261646 | Ga0070698_1002616462 | 255 |
| 12 | 3300009551 | Ga0105238_10009689 | Ga0105238_100096892 | 257 |
| 13 | 3300009545 | Ga0105237_10864872 | Ga0105237_108648721 | 259 |
| 14 | 3300037312 | Ga0395899_0081631 | Ga0395899_0081631_52_951 | 259 |
| 15 | 3300037466 | Ga0395898_0158407 | Ga0395898_0158407_1238_2137 | 259 |
| 16 | 3300044719 | Ga0466971_0080505 | Ga0466971_0080505_555_1427 | 260 |
| 17 | 3300005445 | Ga0070708_100204271 | Ga0070708_1002042711 | 261 |
| 18 | 3300005467 | Ga0070706_100000083 | Ga0070706_10000008392 | 261 |
| 19 | 3300005468 | Ga0070707_100013319 | Ga0070707_1000133199 | 261 |
| 20 | 3300005536 | Ga0070697_100046476 | Ga0070697_1000464763 | 261 |
| 21 | 3300044842 | Ga0466957_0016917 | Ga0466957_0016917_2884_3852 | 261 |
| 22 | 3300045976 | Ga0466967_0136004 | Ga0466967_0136004_159_1127 | 261 |
| 23 | 3300048923 | Ga0496120_0087592 | Ga0496120_0087592_50_943 | 264 |
| 24 | iso_pu_bacteria | 2558860280 | 2559428096 | 267 |
| 25 | 3300044901 | Ga0466960_0053088 | Ga0466960_0053088_577_1503 | 269 |
| 26 | 3300045049 | Ga0466959_0097439 | Ga0466959_0097439_767_1735 | 269 |
| 27 | 3300027671 | Ga0209588_1014499 | Ga0209588_10144992 | 270 |
| 28 | 3300035398 | Ga0316574_0018796 | Ga0316574_0018796_1376_2212 | 271 |
| 29 | 3300036712 | Ga0316584_0002023 | Ga0316584_0002023_7358_8194 | 271 |
| 30 | 3300005344 | Ga0070661_100154004 | Ga0070661_1001540042 | 272 |
| 31 | 3300005530 | Ga0070679_100187261 | Ga0070679_1001872612 | 272 |
| 32 | 3300005614 | Ga0068856_100107252 | Ga0068856_1001072522 | 272 |
| 33 | 3300009551 | Ga0105238_10235096 | Ga0105238_102350962 | 272 |
| 34 | 3300026078 | Ga0207702_10064770 | Ga0207702_100647703 | 272 |
| 35 | 3300009098 | Ga0105245_10601094 | Ga0105245_106010942 | 274 |
| 36 | 3300045049 | Ga0466959_0039684 | Ga0466959_0039684_879_1805 | 274 |
| 37 | 3300045976 | Ga0466967_0109346 | Ga0466967_0109346_1521_2447 | 275 |
| 38 | 3300005539 | Ga0068853_100123652 | Ga0068853_1001236521 | 276 |
| 39 | 3300031251 | Ga0265327_10032287 | Ga0265327_100322873 | 276 |
| 40 | 3300045049 | Ga0466959_0055812 | Ga0466959_0055812_873_1796 | 278 |
| 41 | 3300044842 | Ga0466957_0006331 | Ga0466957_0006331_3645_4544 | 279 |
| 42 | 3300044901 | Ga0466960_0013805 | Ga0466960_0013805_1251_2150 | 279 |
| 43 | 3300045976 | Ga0466967_0690214 | Ga0466967_0690214_16_915 | 279 |
| 44 | 3300046500 | Ga0495596_0020802 | Ga0495596_0020802_1216_2172 | 279 |
| 45 | 3300046513 | Ga0495616_0018526 | Ga0495616_0018526_1840_2796 | 279 |
| 46 | 3300046518 | Ga0495631_0008894 | Ga0495631_0008894_2181_3137 | 279 |
| 47 | 3300047469 | Ga0495673_0043444 | Ga0495673_0043444_12_968 | 279 |
| 48 | 3300047472 | Ga0495686_0070815 | Ga0495686_0070815_491_1447 | 279 |
| 49 | 3300005328 | Ga0070676_10020087 | Ga0070676_100200874 | 280 |
| 50 | 3300005329 | Ga0070683_100237243 | Ga0070683_1002372432 | 280 |
| 51 | 3300005331 | Ga0070670_100025632 | Ga0070670_1000256325 | 280 |
| 52 | 3300005338 | Ga0068868_100107849 | Ga0068868_1001078492 | 280 |
| 53 | 3300005340 | Ga0070689_100048328 | Ga0070689_1000483282 | 280 |
| 54 | 3300005347 | Ga0070668_100031562 | Ga0070668_1000315623 | 280 |
| 55 | 3300005456 | Ga0070678_100340480 | Ga0070678_1003404802 | 280 |
| 56 | 3300005466 | Ga0070685_10022953 | Ga0070685_100229533 | 280 |
| 57 | 3300005471 | Ga0070698_100183833 | Ga0070698_1001838332 | 280 |
| 58 | 3300005543 | Ga0070672_100165124 | Ga0070672_1001651242 | 280 |
| 59 | 3300005548 | Ga0070665_100196649 | Ga0070665_1001966492 | 280 |
| 60 | 3300005614 | Ga0068856_100079949 | Ga0068856_1000799492 | 280 |
| 61 | 3300005615 | Ga0070702_100070803 | Ga0070702_1000708032 | 280 |
| 62 | 3300005719 | Ga0068861_100127592 | Ga0068861_1001275922 | 280 |
| 63 | 3300005840 | Ga0068870_10037701 | Ga0068870_100377013 | 280 |
| 64 | 3300005843 | Ga0068860_100224268 | Ga0068860_1002242682 | 280 |
| 65 | 3300005844 | Ga0068862_100026741 | Ga0068862_1000267416 | 280 |
| 66 | 3300009094 | Ga0111539_10056447 | Ga0111539_100564472 | 280 |
| 67 | 3300009176 | Ga0105242_10078759 | Ga0105242_100787594 | 280 |
| 68 | 3300013105 | Ga0157369_10134802 | Ga0157369_101348022 | 280 |
| 69 | 3300013296 | Ga0157374_10195949 | Ga0157374_101959492 | 280 |
| 70 | 3300013306 | Ga0163162_10054901 | Ga0163162_100549012 | 280 |
| 71 | 3300025904 | Ga0207647_10023776 | Ga0207647_100237762 | 280 |
| 72 | 3300025908 | Ga0207643_10041059 | Ga0207643_100410592 | 280 |
| 73 | 3300025909 | Ga0207705_10052600 | Ga0207705_100526004 | 280 |
| 74 | 3300025910 | Ga0207684_10000104 | Ga0207684_100001043 | 280 |
| 75 | 3300025911 | Ga0207654_10198757 | Ga0207654_101987572 | 280 |
| 76 | 3300025918 | Ga0207662_10046209 | Ga0207662_100462094 | 280 |
| 77 | 3300025919 | Ga0207657_10029210 | Ga0207657_100292105 | 280 |
| 78 | 3300025920 | Ga0207649_10029106 | Ga0207649_100291062 | 280 |
| 79 | 3300025921 | Ga0207652_10408072 | Ga0207652_104080722 | 280 |
| 80 | 3300025922 | Ga0207646_10000978 | Ga0207646_100009782 | 280 |
| 81 | 3300025926 | Ga0207659_10142945 | Ga0207659_101429452 | 280 |
| 82 | 3300025927 | Ga0207687_10058538 | Ga0207687_100585383 | 280 |
| 83 | 3300025933 | Ga0207706_10032986 | Ga0207706_100329862 | 280 |
| 84 | 3300025940 | Ga0207691_10022900 | Ga0207691_100229005 | 280 |
| 85 | 3300025942 | Ga0207689_10020461 | Ga0207689_100204615 | 280 |
| 86 | 3300025945 | Ga0207679_10510188 | Ga0207679_105101881 | 280 |
| 87 | 3300025972 | Ga0207668_10047181 | Ga0207668_100471813 | 280 |
| 88 | 3300025986 | Ga0207658_10079649 | Ga0207658_100796492 | 280 |
| 89 | 3300026035 | Ga0207703_10422513 | Ga0207703_104225132 | 280 |
| 90 | 3300026075 | Ga0207708_10044543 | Ga0207708_100445433 | 280 |
| 91 | 3300026089 | Ga0207648_10041298 | Ga0207648_100412982 | 280 |
| 92 | 3300026116 | Ga0207674_10028265 | Ga0207674_100282655 | 280 |
| 93 | 3300026118 | Ga0207675_100177717 | Ga0207675_1001777172 | 280 |
| 94 | 3300026121 | Ga0207683_10057638 | Ga0207683_100576384 | 280 |
| 95 | 3300047472 | Ga0495686_0000020 | Ga0495686_0000020_138055_139035 | 280 |
| 96 | 3300048904 | Ga0496101_0166459 | Ga0496101_0166459_255_1121 | 280 |
| 97 | 3300048911 | Ga0496108_0189305 | Ga0496108_0189305_552_1418 | 280 |
| 98 | 3300048912 | Ga0496109_0098435 | Ga0496109_0098435_1247_2113 | 280 |
| 99 | 3300048915 | Ga0496112_0184349 | Ga0496112_0184349_818_1684 | 280 |
| 100 | 3300048916 | Ga0496113_0235075 | Ga0496113_0235075_241_1107 | 280 |
| 101 | 3300005344 | Ga0070661_100345981 | Ga0070661_1003459812 | 281 |
| 102 | 3300026116 | Ga0207674_10075403 | Ga0207674_100754034 | 282 |
| 103 | 3300044901 | Ga0466960_0017532 | Ga0466960_0017532_613_1581 | 282 |
| 104 | 3300044765 | Ga0466970_0155932 | Ga0466970_0155932_257_1225 | 283 |
| 105 | 3300037418 | Ga0395900_0012486 | Ga0395900_0012486_1095_2069 | 284 |
| 106 | 3300037471 | Ga0395905_0016383 | Ga0395905_0016383_4129_5103 | 284 |
| 107 | 3300038443 | Ga0395901_0108600 | Ga0395901_0108600_969_1943 | 284 |
| 108 | 3300049743 | Ga0501081_0027878 | Ga0501081_0027878_393_1373 | 284 |
| 109 | 3300037312 | Ga0395899_0263469 | Ga0395899_0263469_25_981 | 287 |
| 110 | 3300046453 | Ga0495627_006853 | Ga0495627_006853_1703_2674 | 287 |
| 111 | 3300053139 | Ga0500568_0015492 | Ga0500568_0015492_816_1787 | 287 |
| 112 | 3300049824 | Ga0501045_0259382 | Ga0501045_0259382_167_1108 | 288 |
| 113 | iso_pu_bacteria | 2513237164 | 2514037550 | 288 |
| 114 | 3300037418 | Ga0395900_0034044 | Ga0395900_0034044_1488_2450 | 289 |
| 115 | 3300037466 | Ga0395898_0081724 | Ga0395898_0081724_742_1704 | 289 |
| 116 | 3300025922 | Ga0207646_10040289 | Ga0207646_100402892 | 290 |
| 117 | 3300045976 | Ga0466967_0016041 | Ga0466967_0016041_3702_4667 | 291 |
| 118 | 3300005445 | Ga0070708_100056440 | Ga0070708_1000564402 | 295 |
| 119 | 3300005467 | Ga0070706_100120999 | Ga0070706_1001209992 | 295 |
| 120 | 3300006028 | Ga0070717_10029611 | Ga0070717_100296114 | 295 |
| 121 | 3300025910 | Ga0207684_10234107 | Ga0207684_102341072 | 295 |
| 122 | 3300025922 | Ga0207646_10459642 | Ga0207646_104596422 | 295 |
| 123 | 3300006173 | Ga0070716_100117536 | Ga0070716_1001175362 | 296 |
| 124 | 3300025939 | Ga0207665_10066402 | Ga0207665_100664022 | 296 |
| 125 | 3300042002 | Ga0439442_009967 | Ga0439442_009967_309_1241 | 297 |
| 126 | 3300044901 | Ga0466960_0009816 | Ga0466960_0009816_513_1508 | 298 |
| 127 | 3300047472 | Ga0495686_0015292 | Ga0495686_0015292_4254_5210 | 298 |
| 128 | 3300042007 | Ga0439449_0025083 | Ga0439449_0025083_1030_1968 | 299 |
| 129 | 3300044694 | Ga0466963_0173655 | Ga0466963_0173655_162_1163 | 299 |
| 130 | 3300046675 | Ga0495657_0048248 | Ga0495657_0048248_1173_2105 | 299 |
| 131 | 3300005564 | Ga0070664_100365339 | Ga0070664_1003653391 | 300 |
| 132 | 3300041406 | Ga0439439_0017143 | Ga0439439_0017143_598_1533 | 300 |
| 133 | 3300041999 | Ga0439433_0002057 | Ga0439433_0002057_1777_2712 | 300 |
| 134 | 3300042014 | Ga0439457_000032 | Ga0439457_000032_5301_6236 | 300 |
| 135 | 3300044656 | Ga0466969_0064278 | Ga0466969_0064278_744_1754 | 300 |
| 136 | 3300044693 | Ga0466961_0007076 | Ga0466961_0007076_1119_2129 | 300 |
| 137 | 3300037853 | Ga0436364_0400910 | Ga0436364_0400910_4157_5089 | 301 |
| 138 | iso_pu_bacteria | 2758568522 | 2760305500 | 301 |
| 139 | iso_pu_bacteria | 2835188231 | 2835190341 | 301 |
| 140 | 3300028563 | Ga0265319_1014845 | Ga0265319_10148453 | 302 |
| 141 | 3300028577 | Ga0265318_10011101 | Ga0265318_100111013 | 302 |
| 142 | 3300028800 | Ga0265338_10055984 | Ga0265338_100559843 | 302 |
| 143 | 3300031240 | Ga0265320_10026902 | Ga0265320_100269023 | 302 |
| 144 | 3300031344 | Ga0265316_10091605 | Ga0265316_100916052 | 302 |
| 145 | 3300031727 | Ga0316576_10018018 | Ga0316576_100180183 | 302 |
| 146 | 3300031728 | Ga0316578_10037963 | Ga0316578_100379632 | 302 |
| 147 | iso_pu_bacteria | 2739367654 | 2739609379 | 302 |
| 148 | iso_pu_bacteria | 2758568621 | 2760626021 | 302 |
| 149 | iso_pu_bacteria | 2808606394 | 2809031027 | 302 |
| 150 | iso_pu_bacteria | 8001781756 | 8001789842 | 302 |
| 151 | iso_pu_bacteria | 8056579771 | 8056584410 | 303 |
| 152 | 3300021384 | Ga0213876_10000552 | Ga0213876_1000055234 | 304 |
| 153 | 3300025929 | Ga0207664_10201917 | Ga0207664_102019172 | 304 |
| 154 | 3300039437 | Ga0436365_1781586 | Ga0436365_1781586_44363_45325 | 304 |
| 155 | 3300044684 | Ga0466966_0025950 | Ga0466966_0025950_1422_2366 | 305 |
| 156 | 3300044693 | Ga0466961_0018000 | Ga0466961_0018000_2047_2991 | 305 |
| 157 | 3300045049 | Ga0466959_0011311 | Ga0466959_0011311_4093_5037 | 305 |
| 158 | 3300045836 | Ga0466958_0019796 | Ga0466958_0019796_1552_2496 | 305 |
| 159 | iso_pu_bacteria | 2643221601 | 2644017604 | 305 |
| 160 | iso_pu_bacteria | 2643221631 | 2644173436 | 305 |
| 161 | iso_pu_bacteria | 2784746763 | 2785341298 | 306 |
| 162 | 3300041997 | Ga0439431_0024244 | Ga0439431_0024244_279_1256 | 307 |
| 163 | iso_pu_bacteria | 2738541272 | 2738694209 | 307 |
| 164 | iso_pu_bacteria | 2738543027 | 2739325249 | 307 |
| 165 | iso_pu_bacteria | 2862507626 | 2862512764 | 307 |
| 166 | iso_pu_bacteria | 2990059506 | 2990064049 | 307 |
| 167 | iso_pu_bacteria | 8048406513 | 8048406561 | 307 |
| 168 | 3300046674 | Ga0495588_0153222 | Ga0495588_0153222_209_1198 | 308 |
| 169 | 3300047317 | Ga0495604_0004927 | Ga0495604_0004927_4292_5266 | 308 |
| 170 | 3300005435 | Ga0070714_100149430 | Ga0070714_1001494302 | 309 |
| 171 | 3300013105 | Ga0157369_10220263 | Ga0157369_102202632 | 309 |
| 172 | 3300020082 | Ga0206353_11310748 | Ga0206353_113107483 | 310 |
| 173 | 3300049568 | Ga0501031_0019006 | Ga0501031_0019006_3204_4241 | 310 |
| 174 | 3300049579 | Ga0501043_0005595 | Ga0501043_0005595_1123_2160 | 310 |
| 175 | 3300049581 | Ga0501047_0003422 | Ga0501047_0003422_2271_3308 | 310 |
| 176 | 3300049582 | Ga0501048_0000381 | Ga0501048_0000381_21226_22263 | 310 |
| 177 | 3300049822 | Ga0501035_0078441 | Ga0501035_0078441_735_1772 | 310 |
| 178 | 3300044842 | Ga0466957_0028158 | Ga0466957_0028158_393_1427 | 312 |
| 179 | 3300045836 | Ga0466958_0007503 | Ga0466958_0007503_1841_2875 | 312 |
| 180 | 3300003578 | Ga0006562J51391_1040945 | Ga0006562J51391_10409452 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
94
296
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.9072 | 56 | 282 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8953 | 56 | 282 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7688 | 71 | 289 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7635 | 71 | 276 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7489 | 70 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEU3_9_230_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9175 | 78 | 283 | 1.10.3720.10 |
| af_Q2FVL3_18_236_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9149 | 68 | 286 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9116 | 56 | 283 | 1.10.3720.10 |
| af_Q2FX86_270_484_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9099 | 67 | 286 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9096 | 56 | 283 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V2PYK4-F1-model_v4 | ABC transporter permease | 0.9615 | 27 | 289 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A434CJX5-F1-model_v4 | Amino acid ABC transporter permease | 0.9566 | 155 | 285 |
GO:0005886
GO:0006865 GO:0055085 |
| AF-A0A530ZMR9-F1-model_v4 | Ectoine/hydroxyectoine ABC transporter permease subunit EhuD | 0.9561 | 161 | 289 |
GO:0005886
GO:0006865 GO:0055085 |
| AF-A0A1V2PYK4-F1-model_v4 | ABC transporter permease | 0.9474 | 27 | 289 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A848I6N7-F1-model_v4 | Histidine/lysine/arginine/ornithine transport system permease protein HisM | 0.9473 | 14 | 290 |
GO:0006865
GO:0022857 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar