F276286

General Info

Members Datasets Scaffolds Average Seq Length
180 144 163 298

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0019006|Ga0501031_0019006_3204_4241
Length 345
Sequence MTEYHEAAAGTAVSRPPDIKAVPVRHPGRWIAVVVIAVLAAMMVHTLVFSKVQRGNGNESRFGWAVVGDYLFSHQILHGVLVTVELTAIAMAIGIVGGVLLAVMRLSPNPVLSGVSWLYLWFFRGTPLIVQIAFWYVGISFLYPQLSLGIPFGPEFAHYSANDLIVPMVAASIGLGFNEAAYMAEIVRAGILSVDEGQHEAASSLGMTRALLMRRIVLPQAMRVIIPPTGNEVISMLKNTSLVFAAGVVDVYYAQQEISATTYQTEPMLLVACLWYLALTSVLMIGQYYIERHYARGSVRELPPTPLQRFKSLVGRRNVLPPATVDLEAQAVLGGLGRGPGGQHL

Samples

Sample ID Description Type Environment
1 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
5 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
6 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
7 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
8 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
9 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
10 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
11 2808606394 Promicromonospora sp. C35 Isolate Unclassified
12 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
13 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
14 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
15 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
103 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
143 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
144 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.44
Metatranscriptomes 1.11
Isolates 9.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0.56
Rhizoplane 3.33
Rhizosphere 85
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1040945 3300003578 Bacteria 1700
2 Ga0070676_10020087 3300005328 Bacteria 3723
3 Ga0070683_100237243 3300005329 Bacteria 1734
4 Ga0070670_100025632 3300005331 Bacteria 5072
5 Ga0068868_100107849 3300005338 Bacteria 2260
6 Ga0070689_100048328 3300005340 Bacteria 3281
7 Ga0070661_100154004 3300005344 Bacteria 1739
8 Ga0070661_100345981 3300005344 Bacteria 1166
9 Ga0070668_100031562 3300005347 Bacteria 4031
10 Ga0070714_100149430 3300005435 Bacteria 2104
11 Ga0070708_100056440 3300005445 Bacteria 3493
12 Ga0070708_100150341 3300005445 Bacteria 2165
13 Ga0070708_100204271 3300005445 Bacteria 1850
14 Ga0070678_100340480 3300005456 Bacteria 1286
15 Ga0070685_10022953 3300005466 Bacteria 3409
16 Ga0070706_100000083 3300005467 Bacteria 109341
17 Ga0070706_100000323 3300005467 Bacteria 58191
18 Ga0070706_100120999 3300005467 Bacteria 2440
19 Ga0070707_100013319 3300005468 Bacteria 7692
20 Ga0070698_100009269 3300005471 Bacteria 10561
21 Ga0070698_100183833 3300005471 Bacteria 2028
22 Ga0070698_100261646 3300005471 Bacteria 1662
23 Ga0070699_100000109 3300005518 Bacteria 77030
24 Ga0070679_100187261 3300005530 Bacteria 2040
25 Ga0070697_100046476 3300005536 Bacteria 3518
26 Ga0068853_100123652 3300005539 Bacteria 2310
27 Ga0070672_100165124 3300005543 Bacteria 1839
28 Ga0070665_100196649 3300005548 Bacteria 2017
29 Ga0070664_100365339 3300005564 Bacteria 1315
30 Ga0068856_100079949 3300005614 Bacteria 3242
31 Ga0068856_100107252 3300005614 Bacteria 2789
32 Ga0070702_100070803 3300005615 Bacteria 2059
33 Ga0068861_100127592 3300005719 Bacteria 2060
34 Ga0068870_10037701 3300005840 Bacteria 2493
35 Ga0068860_100224268 3300005843 Bacteria 1825
36 Ga0068862_100026741 3300005844 Bacteria 4851
37 Ga0070717_10029611 3300006028 Bacteria 4393
38 Ga0070716_100117536 3300006173 Bacteria 1659
39 Ga0111539_10056447 3300009094 Bacteria 4667
40 Ga0105245_10601094 3300009098 Bacteria 1126
41 Ga0105242_10078759 3300009176 Bacteria 2751
42 Ga0105237_10864872 3300009545 Bacteria 911
43 Ga0105238_10009689 3300009551 Bacteria 9642
44 Ga0105238_10235096 3300009551 Bacteria 1810
45 Ga0157369_10134802 3300013105 Bacteria 2615
46 Ga0157369_10220263 3300013105 Bacteria 1986
47 Ga0157374_10195949 3300013296 Bacteria 1977
48 Ga0163162_10054901 3300013306 Bacteria 4008
49 Ga0206353_11310748 3300020082 Bacteria 3307
50 Ga0213876_10000552 3300021384 Bacteria 28013
51 Ga0207647_10023776 3300025904 Bacteria 4049
52 Ga0207643_10041059 3300025908 Bacteria 2606
53 Ga0207705_10052600 3300025909 Bacteria 2932
54 Ga0207684_10000006 3300025910 Bacteria 688605
55 Ga0207684_10000104 3300025910 Bacteria 161447
56 Ga0207684_10234107 3300025910 Bacteria 1585
57 Ga0207654_10198757 3300025911 Bacteria 1319
58 Ga0207662_10046209 3300025918 Bacteria 2575
59 Ga0207657_10029210 3300025919 Bacteria 5021
60 Ga0207649_10029106 3300025920 Bacteria 3260
61 Ga0207652_10408072 3300025921 Bacteria 1226
62 Ga0207646_10000914 3300025922 Bacteria 38039
63 Ga0207646_10000978 3300025922 Bacteria 36791
64 Ga0207646_10040289 3300025922 Bacteria 4201
65 Ga0207646_10459642 3300025922 Bacteria 1148
66 Ga0207659_10142945 3300025926 Bacteria 1859
67 Ga0207687_10058538 3300025927 Bacteria 2711
68 Ga0207664_10201917 3300025929 Bacteria 1716
69 Ga0207706_10032986 3300025933 Bacteria 4608
70 Ga0207665_10066402 3300025939 Bacteria 2455
71 Ga0207691_10022900 3300025940 Bacteria 5887
72 Ga0207689_10020461 3300025942 Bacteria 5569
73 Ga0207679_10510188 3300025945 Bacteria 1074
74 Ga0207668_10047181 3300025972 Bacteria 2948
75 Ga0207658_10079649 3300025986 Bacteria 2507
76 Ga0207703_10422513 3300026035 Bacteria 1241
77 Ga0207708_10044543 3300026075 Bacteria 3381
78 Ga0207702_10064770 3300026078 Bacteria 3128
79 Ga0207648_10041298 3300026089 Bacteria 4051
80 Ga0207674_10028265 3300026116 Bacteria 5920
81 Ga0207674_10075403 3300026116 Bacteria 3383
82 Ga0207675_100177717 3300026118 Bacteria 2037
83 Ga0207683_10057638 3300026121 Bacteria 3410
84 Ga0209588_1014499 3300027671 Bacteria 2414
85 Ga0265319_1014845 3300028563 Bacteria 3039
86 Ga0265318_10011101 3300028577 Bacteria 3893
87 Ga0265338_10055984 3300028800 Bacteria 3502
88 Ga0265320_10026902 3300031240 Bacteria 3005
89 Ga0265327_10032287 3300031251 Bacteria 2932
90 Ga0265316_10091605 3300031344 Bacteria 2319
91 Ga0316576_10018018 3300031727 Bacteria 4812
92 Ga0316578_10037963 3300031728 Bacteria 2776
93 Ga0316574_0018796 3300035398 Bacteria 4068
94 Ga0316584_0002023 3300036712 Bacteria 12688
95 Ga0395899_0081631 3300037312 Bacteria 2352
96 Ga0395899_0263469 3300037312 Bacteria 1178
97 Ga0395900_0012486 3300037418 Bacteria 8686
98 Ga0395900_0034044 3300037418 Bacteria 5244
99 Ga0395898_0081724 3300037466 Bacteria 3115
100 Ga0395898_0158407 3300037466 Bacteria 2165
101 Ga0395905_0016383 3300037471 Bacteria 7042
102 Ga0436364_0400910 3300037853 Bacteria 5636
103 Ga0395901_0108600 3300038443 Bacteria 2912
104 Ga0436365_1781586 3300039437 Bacteria 55120
105 Ga0439439_0017143 3300041406 Bacteria 1778
106 Ga0439431_0024244 3300041997 Bacteria 1475
107 Ga0439433_0002057 3300041999 Bacteria 4231
108 Ga0439442_009967 3300042002 Bacteria 1923
109 Ga0439449_0025083 3300042007 Bacteria 2228
110 Ga0439457_000032 3300042014 Bacteria 28723
111 Ga0466969_0064278 3300044656 Bacteria 1777
112 Ga0466966_0025950 3300044684 Bacteria 3827
113 Ga0466966_0080225 3300044684 Bacteria 2033
114 Ga0466961_0007076 3300044693 Bacteria 7136
115 Ga0466961_0018000 3300044693 Bacteria 4543
116 Ga0466963_0173655 3300044694 Bacteria 1503
117 Ga0466964_0148996 3300044706 Bacteria 1083
118 Ga0466971_0080505 3300044719 Bacteria 1485
119 Ga0466970_0155932 3300044765 Bacteria 1262
120 Ga0466957_0006331 3300044842 Bacteria 6674
121 Ga0466957_0016917 3300044842 Bacteria 4267
122 Ga0466957_0028158 3300044842 Bacteria 3344
123 Ga0466960_0009816 3300044901 Bacteria 3957
124 Ga0466960_0013805 3300044901 Bacteria 3441
125 Ga0466960_0017532 3300044901 Bacteria 3124
126 Ga0466960_0053088 3300044901 Bacteria 1963
127 Ga0466959_0011311 3300045049 Bacteria 6408
128 Ga0466959_0039684 3300045049 Bacteria 3480
129 Ga0466959_0055812 3300045049 Bacteria 2883
130 Ga0466959_0097439 3300045049 Bacteria 2108
131 Ga0466958_0007503 3300045836 Bacteria 6005
132 Ga0466958_0019796 3300045836 Bacteria 3919
133 Ga0466967_0016041 3300045976 Bacteria 5893
134 Ga0466967_0109346 3300045976 Bacteria 2538
135 Ga0466967_0136004 3300045976 Bacteria 2285
136 Ga0466967_0690214 3300045976 Bacteria 1011
137 Ga0495627_006853 3300046453 Bacteria 4430
138 Ga0495596_0020802 3300046500 Bacteria 2683
139 Ga0495616_0018526 3300046513 Bacteria 3820
140 Ga0495631_0008894 3300046518 Bacteria 5040
141 Ga0495588_0153222 3300046674 Bacteria 1218
142 Ga0495657_0048248 3300046675 Bacteria 2874
143 Ga0495604_0004927 3300047317 Bacteria 10585
144 Ga0495673_0043444 3300047469 Bacteria 2012
145 Ga0495686_0000020 3300047472 Bacteria 429191
146 Ga0495686_0015292 3300047472 Bacteria 5247
147 Ga0495686_0070815 3300047472 Bacteria 2148
148 Ga0496101_0166459 3300048904 Bacteria 1693
149 Ga0496106_0282750 3300048909 Bacteria 1329
150 Ga0496108_0189305 3300048911 Bacteria 1783
151 Ga0496109_0098435 3300048912 Bacteria 2711
152 Ga0496112_0184349 3300048915 Bacteria 2051
153 Ga0496113_0235075 3300048916 Bacteria 1462
154 Ga0496120_0087592 3300048923 Bacteria 1671
155 Ga0501031_0019006 3300049568 Bacteria 4473
156 Ga0501043_0005595 3300049579 Bacteria 10123
157 Ga0501047_0000107 3300049581 Bacteria 102041
158 Ga0501047_0003422 3300049581 Bacteria 15003
159 Ga0501048_0000381 3300049582 Bacteria 30814
160 Ga0501081_0027878 3300049743 Bacteria 3808
161 Ga0501035_0078441 3300049822 Bacteria 2917
162 Ga0501045_0259382 3300049824 Bacteria 1294
163 Ga0500568_0015492 3300053139 Bacteria 3412

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0148996 Ga0466964_0148996_223_1068 239
2 3300049581 Ga0501047_0000107 Ga0501047_0000107_98579_99475 239
3 3300005471 Ga0070698_100009269 Ga0070698_1000092698 241
4 3300048909 Ga0496106_0282750 Ga0496106_0282750_548_1306 244
5 3300044684 Ga0466966_0080225 Ga0466966_0080225_1132_2010 249
6 3300005467 Ga0070706_100000323 Ga0070706_10000032319 250
7 3300005518 Ga0070699_100000109 Ga0070699_10000010937 250
8 3300025910 Ga0207684_10000006 Ga0207684_10000006181 250
9 3300025922 Ga0207646_10000914 Ga0207646_1000091416 250
10 3300005445 Ga0070708_100150341 Ga0070708_1001503412 252
11 3300005471 Ga0070698_100261646 Ga0070698_1002616462 255
12 3300009551 Ga0105238_10009689 Ga0105238_100096892 257
13 3300009545 Ga0105237_10864872 Ga0105237_108648721 259
14 3300037312 Ga0395899_0081631 Ga0395899_0081631_52_951 259
15 3300037466 Ga0395898_0158407 Ga0395898_0158407_1238_2137 259
16 3300044719 Ga0466971_0080505 Ga0466971_0080505_555_1427 260
17 3300005445 Ga0070708_100204271 Ga0070708_1002042711 261
18 3300005467 Ga0070706_100000083 Ga0070706_10000008392 261
19 3300005468 Ga0070707_100013319 Ga0070707_1000133199 261
20 3300005536 Ga0070697_100046476 Ga0070697_1000464763 261
21 3300044842 Ga0466957_0016917 Ga0466957_0016917_2884_3852 261
22 3300045976 Ga0466967_0136004 Ga0466967_0136004_159_1127 261
23 3300048923 Ga0496120_0087592 Ga0496120_0087592_50_943 264
24 iso_pu_bacteria 2558860280 2559428096 267
25 3300044901 Ga0466960_0053088 Ga0466960_0053088_577_1503 269
26 3300045049 Ga0466959_0097439 Ga0466959_0097439_767_1735 269
27 3300027671 Ga0209588_1014499 Ga0209588_10144992 270
28 3300035398 Ga0316574_0018796 Ga0316574_0018796_1376_2212 271
29 3300036712 Ga0316584_0002023 Ga0316584_0002023_7358_8194 271
30 3300005344 Ga0070661_100154004 Ga0070661_1001540042 272
31 3300005530 Ga0070679_100187261 Ga0070679_1001872612 272
32 3300005614 Ga0068856_100107252 Ga0068856_1001072522 272
33 3300009551 Ga0105238_10235096 Ga0105238_102350962 272
34 3300026078 Ga0207702_10064770 Ga0207702_100647703 272
35 3300009098 Ga0105245_10601094 Ga0105245_106010942 274
36 3300045049 Ga0466959_0039684 Ga0466959_0039684_879_1805 274
37 3300045976 Ga0466967_0109346 Ga0466967_0109346_1521_2447 275
38 3300005539 Ga0068853_100123652 Ga0068853_1001236521 276
39 3300031251 Ga0265327_10032287 Ga0265327_100322873 276
40 3300045049 Ga0466959_0055812 Ga0466959_0055812_873_1796 278
41 3300044842 Ga0466957_0006331 Ga0466957_0006331_3645_4544 279
42 3300044901 Ga0466960_0013805 Ga0466960_0013805_1251_2150 279
43 3300045976 Ga0466967_0690214 Ga0466967_0690214_16_915 279
44 3300046500 Ga0495596_0020802 Ga0495596_0020802_1216_2172 279
45 3300046513 Ga0495616_0018526 Ga0495616_0018526_1840_2796 279
46 3300046518 Ga0495631_0008894 Ga0495631_0008894_2181_3137 279
47 3300047469 Ga0495673_0043444 Ga0495673_0043444_12_968 279
48 3300047472 Ga0495686_0070815 Ga0495686_0070815_491_1447 279
49 3300005328 Ga0070676_10020087 Ga0070676_100200874 280
50 3300005329 Ga0070683_100237243 Ga0070683_1002372432 280
51 3300005331 Ga0070670_100025632 Ga0070670_1000256325 280
52 3300005338 Ga0068868_100107849 Ga0068868_1001078492 280
53 3300005340 Ga0070689_100048328 Ga0070689_1000483282 280
54 3300005347 Ga0070668_100031562 Ga0070668_1000315623 280
55 3300005456 Ga0070678_100340480 Ga0070678_1003404802 280
56 3300005466 Ga0070685_10022953 Ga0070685_100229533 280
57 3300005471 Ga0070698_100183833 Ga0070698_1001838332 280
58 3300005543 Ga0070672_100165124 Ga0070672_1001651242 280
59 3300005548 Ga0070665_100196649 Ga0070665_1001966492 280
60 3300005614 Ga0068856_100079949 Ga0068856_1000799492 280
61 3300005615 Ga0070702_100070803 Ga0070702_1000708032 280
62 3300005719 Ga0068861_100127592 Ga0068861_1001275922 280
63 3300005840 Ga0068870_10037701 Ga0068870_100377013 280
64 3300005843 Ga0068860_100224268 Ga0068860_1002242682 280
65 3300005844 Ga0068862_100026741 Ga0068862_1000267416 280
66 3300009094 Ga0111539_10056447 Ga0111539_100564472 280
67 3300009176 Ga0105242_10078759 Ga0105242_100787594 280
68 3300013105 Ga0157369_10134802 Ga0157369_101348022 280
69 3300013296 Ga0157374_10195949 Ga0157374_101959492 280
70 3300013306 Ga0163162_10054901 Ga0163162_100549012 280
71 3300025904 Ga0207647_10023776 Ga0207647_100237762 280
72 3300025908 Ga0207643_10041059 Ga0207643_100410592 280
73 3300025909 Ga0207705_10052600 Ga0207705_100526004 280
74 3300025910 Ga0207684_10000104 Ga0207684_100001043 280
75 3300025911 Ga0207654_10198757 Ga0207654_101987572 280
76 3300025918 Ga0207662_10046209 Ga0207662_100462094 280
77 3300025919 Ga0207657_10029210 Ga0207657_100292105 280
78 3300025920 Ga0207649_10029106 Ga0207649_100291062 280
79 3300025921 Ga0207652_10408072 Ga0207652_104080722 280
80 3300025922 Ga0207646_10000978 Ga0207646_100009782 280
81 3300025926 Ga0207659_10142945 Ga0207659_101429452 280
82 3300025927 Ga0207687_10058538 Ga0207687_100585383 280
83 3300025933 Ga0207706_10032986 Ga0207706_100329862 280
84 3300025940 Ga0207691_10022900 Ga0207691_100229005 280
85 3300025942 Ga0207689_10020461 Ga0207689_100204615 280
86 3300025945 Ga0207679_10510188 Ga0207679_105101881 280
87 3300025972 Ga0207668_10047181 Ga0207668_100471813 280
88 3300025986 Ga0207658_10079649 Ga0207658_100796492 280
89 3300026035 Ga0207703_10422513 Ga0207703_104225132 280
90 3300026075 Ga0207708_10044543 Ga0207708_100445433 280
91 3300026089 Ga0207648_10041298 Ga0207648_100412982 280
92 3300026116 Ga0207674_10028265 Ga0207674_100282655 280
93 3300026118 Ga0207675_100177717 Ga0207675_1001777172 280
94 3300026121 Ga0207683_10057638 Ga0207683_100576384 280
95 3300047472 Ga0495686_0000020 Ga0495686_0000020_138055_139035 280
96 3300048904 Ga0496101_0166459 Ga0496101_0166459_255_1121 280
97 3300048911 Ga0496108_0189305 Ga0496108_0189305_552_1418 280
98 3300048912 Ga0496109_0098435 Ga0496109_0098435_1247_2113 280
99 3300048915 Ga0496112_0184349 Ga0496112_0184349_818_1684 280
100 3300048916 Ga0496113_0235075 Ga0496113_0235075_241_1107 280
101 3300005344 Ga0070661_100345981 Ga0070661_1003459812 281
102 3300026116 Ga0207674_10075403 Ga0207674_100754034 282
103 3300044901 Ga0466960_0017532 Ga0466960_0017532_613_1581 282
104 3300044765 Ga0466970_0155932 Ga0466970_0155932_257_1225 283
105 3300037418 Ga0395900_0012486 Ga0395900_0012486_1095_2069 284
106 3300037471 Ga0395905_0016383 Ga0395905_0016383_4129_5103 284
107 3300038443 Ga0395901_0108600 Ga0395901_0108600_969_1943 284
108 3300049743 Ga0501081_0027878 Ga0501081_0027878_393_1373 284
109 3300037312 Ga0395899_0263469 Ga0395899_0263469_25_981 287
110 3300046453 Ga0495627_006853 Ga0495627_006853_1703_2674 287
111 3300053139 Ga0500568_0015492 Ga0500568_0015492_816_1787 287
112 3300049824 Ga0501045_0259382 Ga0501045_0259382_167_1108 288
113 iso_pu_bacteria 2513237164 2514037550 288
114 3300037418 Ga0395900_0034044 Ga0395900_0034044_1488_2450 289
115 3300037466 Ga0395898_0081724 Ga0395898_0081724_742_1704 289
116 3300025922 Ga0207646_10040289 Ga0207646_100402892 290
117 3300045976 Ga0466967_0016041 Ga0466967_0016041_3702_4667 291
118 3300005445 Ga0070708_100056440 Ga0070708_1000564402 295
119 3300005467 Ga0070706_100120999 Ga0070706_1001209992 295
120 3300006028 Ga0070717_10029611 Ga0070717_100296114 295
121 3300025910 Ga0207684_10234107 Ga0207684_102341072 295
122 3300025922 Ga0207646_10459642 Ga0207646_104596422 295
123 3300006173 Ga0070716_100117536 Ga0070716_1001175362 296
124 3300025939 Ga0207665_10066402 Ga0207665_100664022 296
125 3300042002 Ga0439442_009967 Ga0439442_009967_309_1241 297
126 3300044901 Ga0466960_0009816 Ga0466960_0009816_513_1508 298
127 3300047472 Ga0495686_0015292 Ga0495686_0015292_4254_5210 298
128 3300042007 Ga0439449_0025083 Ga0439449_0025083_1030_1968 299
129 3300044694 Ga0466963_0173655 Ga0466963_0173655_162_1163 299
130 3300046675 Ga0495657_0048248 Ga0495657_0048248_1173_2105 299
131 3300005564 Ga0070664_100365339 Ga0070664_1003653391 300
132 3300041406 Ga0439439_0017143 Ga0439439_0017143_598_1533 300
133 3300041999 Ga0439433_0002057 Ga0439433_0002057_1777_2712 300
134 3300042014 Ga0439457_000032 Ga0439457_000032_5301_6236 300
135 3300044656 Ga0466969_0064278 Ga0466969_0064278_744_1754 300
136 3300044693 Ga0466961_0007076 Ga0466961_0007076_1119_2129 300
137 3300037853 Ga0436364_0400910 Ga0436364_0400910_4157_5089 301
138 iso_pu_bacteria 2758568522 2760305500 301
139 iso_pu_bacteria 2835188231 2835190341 301
140 3300028563 Ga0265319_1014845 Ga0265319_10148453 302
141 3300028577 Ga0265318_10011101 Ga0265318_100111013 302
142 3300028800 Ga0265338_10055984 Ga0265338_100559843 302
143 3300031240 Ga0265320_10026902 Ga0265320_100269023 302
144 3300031344 Ga0265316_10091605 Ga0265316_100916052 302
145 3300031727 Ga0316576_10018018 Ga0316576_100180183 302
146 3300031728 Ga0316578_10037963 Ga0316578_100379632 302
147 iso_pu_bacteria 2739367654 2739609379 302
148 iso_pu_bacteria 2758568621 2760626021 302
149 iso_pu_bacteria 2808606394 2809031027 302
150 iso_pu_bacteria 8001781756 8001789842 302
151 iso_pu_bacteria 8056579771 8056584410 303
152 3300021384 Ga0213876_10000552 Ga0213876_1000055234 304
153 3300025929 Ga0207664_10201917 Ga0207664_102019172 304
154 3300039437 Ga0436365_1781586 Ga0436365_1781586_44363_45325 304
155 3300044684 Ga0466966_0025950 Ga0466966_0025950_1422_2366 305
156 3300044693 Ga0466961_0018000 Ga0466961_0018000_2047_2991 305
157 3300045049 Ga0466959_0011311 Ga0466959_0011311_4093_5037 305
158 3300045836 Ga0466958_0019796 Ga0466958_0019796_1552_2496 305
159 iso_pu_bacteria 2643221601 2644017604 305
160 iso_pu_bacteria 2643221631 2644173436 305
161 iso_pu_bacteria 2784746763 2785341298 306
162 3300041997 Ga0439431_0024244 Ga0439431_0024244_279_1256 307
163 iso_pu_bacteria 2738541272 2738694209 307
164 iso_pu_bacteria 2738543027 2739325249 307
165 iso_pu_bacteria 2862507626 2862512764 307
166 iso_pu_bacteria 2990059506 2990064049 307
167 iso_pu_bacteria 8048406513 8048406561 307
168 3300046674 Ga0495588_0153222 Ga0495588_0153222_209_1198 308
169 3300047317 Ga0495604_0004927 Ga0495604_0004927_4292_5266 308
170 3300005435 Ga0070714_100149430 Ga0070714_1001494302 309
171 3300013105 Ga0157369_10220263 Ga0157369_102202632 309
172 3300020082 Ga0206353_11310748 Ga0206353_113107483 310
173 3300049568 Ga0501031_0019006 Ga0501031_0019006_3204_4241 310
174 3300049579 Ga0501043_0005595 Ga0501043_0005595_1123_2160 310
175 3300049581 Ga0501047_0003422 Ga0501047_0003422_2271_3308 310
176 3300049582 Ga0501048_0000381 Ga0501048_0000381_21226_22263 310
177 3300049822 Ga0501035_0078441 Ga0501035_0078441_735_1772 310
178 3300044842 Ga0466957_0028158 Ga0466957_0028158_393_1427 312
179 3300045836 Ga0466958_0007503 Ga0466958_0007503_1841_2875 312
180 3300003578 Ga0006562J51391_1040945 Ga0006562J51391_10409452 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

94

296

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.9072 56 282
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8953 56 282
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7688 71 289
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7635 71 276
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7489 70 289
ID Description Score Start End Superfamily
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9175 78 283 1.10.3720.10
af_Q2FVL3_18_236_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9149 68 286 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9116 56 283 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9099 67 286 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9096 56 283 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1V2PYK4-F1-model_v4 ABC transporter permease 0.9615 27 289 GO:0006865
GO:0022857
GO:0043190
AF-A0A434CJX5-F1-model_v4 Amino acid ABC transporter permease 0.9566 155 285 GO:0005886
GO:0006865
GO:0055085
AF-A0A530ZMR9-F1-model_v4 Ectoine/hydroxyectoine ABC transporter permease subunit EhuD 0.9561 161 289 GO:0005886
GO:0006865
GO:0055085
AF-A0A1V2PYK4-F1-model_v4 ABC transporter permease 0.9474 27 289 GO:0006865
GO:0022857
GO:0043190
AF-A0A848I6N7-F1-model_v4 Histidine/lysine/arginine/ornithine transport system permease protein HisM 0.9473 14 290 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
81.17 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map