F276228

General Info

Members Datasets Scaffolds Average Seq Length
180 149 360 95

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000975|Ga0496104_0000975_22001_22288
Length 95
Sequence MLFHVSIAVRIPYGTDPQTLKELSEREHERAKELQLAGKWTHLWRVAGKYSNISIFDVSDPAELHDILNSLPLYPFMEIEVVALCKHPGSLDLNK

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
93 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
111 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
128 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
129 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
130 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
131 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
132 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
133 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
134 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
135 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
136 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
137 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
138 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
139 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
140 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
141 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
142 2851182111 Bosea sp. Tri-44 Isolate Nodule
143 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
144 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
145 2904699407
146 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
147 641522639 Methylobacterium sp. 4-46 Isolate Nodule
148 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
149 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.94
Metatranscriptomes 0.56
Isolates 9.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 5.56
Rhizoplane 7.22
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000975 3300048907 Bacteria 24493
2 Ga0055532_1000312 3300003758 Bacteria 29468
3 Ga0070677_10091725 3300005333 Bacteria 1323
4 Ga0070668_101716380 3300005347 Bacteria 577
5 Ga0070674_100676816 3300005356 Bacteria 880
6 Ga0070688_100762039 3300005365 Bacteria 754
7 Ga0070709_10060754 3300005434 Bacteria 2403
8 Ga0070714_101712957 3300005435 Bacteria 614
9 Ga0070713_100014229 3300005436 Bacteria 5899
10 Ga0070710_10105364 3300005437 Bacteria 1685
11 Ga0070710_11040342 3300005437 Bacteria 598
12 Ga0070711_100072940 3300005439 Bacteria 2423
13 Ga0070697_100249859 3300005536 Bacteria 1516
14 Ga0070672_101271365 3300005543 Bacteria 657
15 Ga0070696_100543405 3300005546 Unclassified 930
16 Ga0068852_102368727 3300005616 Bacteria 552
17 Ga0068863_102233656 3300005841 Bacteria 557
18 Ga0081539_10009290 3300005985 Bacteria 8260
19 Ga0081539_10439447 3300005985 Bacteria 541
20 Ga0070717_10396510 3300006028 Bacteria 1239
21 Ga0070715_10008331 3300006163 Bacteria 3610
22 Ga0070716_100167157 3300006173 Bacteria 1431
23 Ga0070716_100568743 3300006173 Bacteria 848
24 Ga0070712_100283857 3300006175 Bacteria 1334
25 Ga0070712_101188014 3300006175 Bacteria 663
26 Ga0075362_10395940 3300006177 Bacteria 696
27 Ga0075370_10190668 3300006353 Bacteria 1208
28 Ga0075429_100000399 3300006880 Bacteria 31997
29 Ga0068865_100969029 3300006881 Bacteria 743
30 Ga0099794_10003840 3300007265 Bacteria 5811
31 Ga0099794_10277977 3300007265 Unclassified 865
32 Ga0105240_10004202 3300009093 Bacteria 22026
33 Ga0111539_11138087 3300009094 Bacteria 907
34 Ga0105243_10444035 3300009148 Bacteria 1215
35 Ga0105246_10652935 3300011119 Bacteria 916
36 Ga0157373_10742071 3300013100 Unclassified 721
37 Ga0163162_10156208 3300013306 Bacteria 2401
38 Ga0157375_10153711 3300013308 Bacteria 2438
39 Ga0157380_10557643 3300014326 Bacteria 1125
40 Ga0157379_10408249 3300014968 Bacteria 1249
41 Ga0157376_12316854 3300014969 Bacteria 576
42 Ga0163161_10060916 3300017792 Bacteria 2747
43 Ga0209147_100153 3300025229 Bacteria 97432
44 Ga0209233_1059349 3300025261 Bacteria 744
45 Ga0209025_1000040 3300025294 Bacteria 376228
46 Ga0207682_10109646 3300025893 Bacteria 1214
47 Ga0207692_10064264 3300025898 Bacteria 1910
48 Ga0207688_10192363 3300025901 Bacteria 1221
49 Ga0207685_10015203 3300025905 Bacteria 2433
50 Ga0207699_10093497 3300025906 Bacteria 1893
51 Ga0207645_10770498 3300025907 Bacteria 654
52 Ga0207695_10000628 3300025913 Bacteria 70699
53 Ga0207671_10753145 3300025914 Bacteria 773
54 Ga0207693_10029904 3300025915 Bacteria 4299
55 Ga0207663_10184931 3300025916 Bacteria 1491
56 Ga0207659_11134748 3300025926 Bacteria 672
57 Ga0207700_10170908 3300025928 Bacteria 1813
58 Ga0207700_10303726 3300025928 Bacteria 1379
59 Ga0207664_10776276 3300025929 Bacteria 862
60 Ga0207664_10905352 3300025929 Bacteria 792
61 Ga0207669_10060333 3300025937 Bacteria 2325
62 Ga0207704_11462257 3300025938 Bacteria 586
63 Ga0207665_10006609 3300025939 Bacteria 7690
64 Ga0207665_11271519 3300025939 Bacteria 587
65 Ga0207691_10187916 3300025940 Bacteria 1803
66 Ga0207702_11156591 3300026078 Unclassified 768
67 Ga0207648_11023055 3300026089 Bacteria 774
68 Ga0207683_10216366 3300026121 Bacteria 1745
69 Ga0207683_10329051 3300026121 Bacteria 1400
70 Ga0207683_10477451 3300026121 Bacteria 1150
71 Ga0207683_10523872 3300026121 Bacteria 1095
72 Ga0207698_12654453 3300026142 Bacteria 510
73 Ga0209281_1002430 3300027111 Bacteria 7501
74 Ga0209588_1033812 3300027671 Bacteria 1640
75 Ga0268266_11514188 3300028379 Bacteria 646
76 Ga0265762_1131312 3300030760 Unclassified 581
77 Ga0307508_10389798 3300031616 Bacteria 984
78 Ga0307516_10873723 3300031730 Unclassified 564
79 Ga0307406_11703930 3300031901 Bacteria 559
80 Ga0307406_11826405 3300031901 Bacteria 541
81 Ga0307412_10201530 3300031911 Bacteria 1512
82 Ga0307409_100373886 3300031995 Bacteria 1352
83 Ga0307411_10572567 3300032005 Bacteria 967
84 Ga0307411_10912757 3300032005 Bacteria 781
85 Ga0307411_11155342 3300032005 Bacteria 700
86 Ga0395900_0721473 3300037418 Bacteria 929
87 Ga0395900_1811079 3300037418 Bacteria 521
88 Ga0395905_0000842 3300037471 Bacteria 40040
89 Ga0395905_0004802 3300037471 Bacteria 13953
90 Ga0395905_0461676 3300037471 Bacteria 1168
91 Ga0395905_0893758 3300037471 Bacteria 791
92 Ga0436364_0160709 3300037853 Bacteria 552
93 Ga0436364_0734588 3300037853 Bacteria 2624
94 Ga0436364_1161589 3300037853 Bacteria 796
95 Ga0436363_1227463 3300039450 Bacteria 830
96 Ga0436363_1376609 3300039450 Bacteria 1105
97 Ga0436362_1268715 3300039453 Bacteria 602
98 Ga0451797_1237977 3300041453 Bacteria 597
99 Ga0451853_2278679 3300041512 Bacteria 571
100 Ga0451576_2041027 3300045051 Bacteria 590
101 Ga0495603_0338828 3300046455 Bacteria 863
102 Ga0495590_0012458 3300046457 Bacteria 3155
103 Ga0495580_0057070 3300046472 Bacteria 2748
104 Ga0495594_0039967 3300046499 Bacteria 2566
105 Ga0495583_0241415 3300046506 Bacteria 726
106 Ga0495606_0164050 3300046507 Bacteria 1294
107 Ga0495643_0005602 3300046522 Bacteria 8442
108 Ga0495643_0041104 3300046522 Bacteria 2522
109 Ga0495643_0169736 3300046522 Bacteria 1067
110 Ga0495648_0000736 3300046524 Bacteria 34882
111 Ga0495663_0014325 3300046525 Bacteria 2222
112 Ga0495666_0029485 3300046526 Bacteria 2699
113 Ga0495642_0014303 3300046528 Bacteria 3074
114 Ga0495642_0133880 3300046528 Bacteria 1068
115 Ga0495654_0000140 3300046530 Bacteria 75508
116 Ga0495598_0118444 3300046537 Bacteria 895
117 Ga0495621_0004841 3300046539 Bacteria 3819
118 Ga0495621_0329473 3300046539 Bacteria 637
119 Ga0495597_0021623 3300046542 Bacteria 2989
120 Ga0495597_0216870 3300046542 Bacteria 761
121 Ga0495633_0104086 3300046558 Bacteria 1317
122 Ga0495656_0000649 3300046615 Bacteria 11136
123 Ga0495668_0228723 3300046616 Bacteria 1018
124 Ga0495661_0003521 3300046665 Bacteria 11541
125 Ga0495588_0775297 3300046674 Unclassified 501
126 Ga0495599_0698945 3300046678 Bacteria 585
127 Ga0495624_0036750 3300046690 Bacteria 3156
128 Ga0495670_0105031 3300046691 Bacteria 1458
129 Ga0495649_0626242 3300046694 Bacteria 530
130 Ga0495589_0236441 3300046794 Unclassified 856
131 Ga0495660_0256941 3300046810 Bacteria 808
132 Ga0495604_0120126 3300047317 Bacteria 1903
133 Ga0495672_0168425 3300047320 Bacteria 1119
134 Ga0495687_003871 3300047443 Bacteria 10510
135 Ga0495685_036405 3300047447 Bacteria 1690
136 Ga0495673_0024568 3300047469 Bacteria 2909
137 Ga0495615_0011798 3300048090 Bacteria 1786
138 Ga0495626_0068043 3300048091 Bacteria 1607
139 Ga0496101_0354674 3300048904 Bacteria 1153
140 Ga0496105_0021921 3300048908 Bacteria 5170
141 Ga0496108_1550970 3300048911 Bacteria 550
142 Ga0496108_1677887 3300048911 Bacteria 524
143 Ga0496110_0823130 3300048913 Bacteria 833
144 Ga0496114_0336468 3300048917 Bacteria 1335
145 Ga0496114_1435904 3300048917 Bacteria 577
146 Ga0496115_0628618 3300048918 Bacteria 851
147 Ga0496121_0316675 3300048924 Bacteria 1052
148 Ga0496121_0433595 3300048924 Bacteria 852
149 Ga0496124_0224021 3300048927 Bacteria 1412
150 Ga0496124_0662889 3300048927 Bacteria 668
151 nmdc:mga0k408_290724_c1 3300050493 Bacteria 975
152 nmdc:mga06z11_322008_c1 3300050494 Bacteria 922
153 nmdc:mga07m45_281359_c1 3300050496 Bacteria 967
154 nmdc:mga09592_1247965_c1 3300050508 Bacteria 613
155 nmdc:mga09592_15100_c1 3300050508 Bacteria 6309
156 Ga0495601_0415769 3300053077 Bacteria 871
157 Ga0500578_0137485 3300053086 Bacteria 1529
158 Ga0500556_0000024 3300053104 Bacteria 167556
159 Ga0500621_288369 3300053126 Bacteria 531
160 Ga0500652_000481 3300053131 Bacteria 14157
161 Ga0500603_085006 3300053150 Unclassified 922
162 Ga0500627_0260121 3300053158 Bacteria 766
163 2511387944 2511231026 Bacteria 5225445
164 2545675791 2545555834 Bacteria 8130841
165 2599745677 2599185240 Bacteria 7968121
166 2600207585 2599185355 Bacteria 7968906
167 2657684758 2657244999 Bacteria 5946535
168 2676745310 2675903129 Bacteria 7964495
169 2792579995 2791355082 Bacteria 5973319
170 2792620348 2791355091 Bacteria 6135441
171 2792625706 2791355092 Bacteria 6248105
172 2804755902 2802429268 Bacteria 6094027
173 2851184343 2851182111 Bacteria 6047226
174 2870074836 2870068957 Bacteria 8925310
175 2904694958 2904690495 Bacteria 9412302
176 2904704067
177 2908759902 2908756301 Bacteria 8864324
178 641641609 641522639 Bacteria 7737025
179 8020948816 8020945358 Bacteria 8467355
180 8049297456 8049293176 Bacteria 6128433
181 Ga0496104_0000975
182 Ga0055532_1000312
183 Ga0070677_10091725
184 Ga0070668_101716380
185 Ga0070674_100676816
186 Ga0070688_100762039
187 Ga0070709_10060754
188 Ga0070714_101712957
189 Ga0070713_100014229
190 Ga0070710_10105364
191 Ga0070710_11040342
192 Ga0070711_100072940
193 Ga0070697_100249859
194 Ga0070672_101271365
195 Ga0070696_100543405
196 Ga0068852_102368727
197 Ga0068863_102233656
198 Ga0081539_10009290
199 Ga0081539_10439447
200 Ga0070717_10396510
201 Ga0070715_10008331
202 Ga0070716_100167157
203 Ga0070716_100568743
204 Ga0070712_100283857
205 Ga0070712_101188014
206 Ga0075362_10395940
207 Ga0075370_10190668
208 Ga0075429_100000399
209 Ga0068865_100969029
210 Ga0099794_10003840
211 Ga0099794_10277977
212 Ga0105240_10004202
213 Ga0111539_11138087
214 Ga0105243_10444035
215 Ga0105246_10652935
216 Ga0157373_10742071
217 Ga0163162_10156208
218 Ga0157375_10153711
219 Ga0157380_10557643
220 Ga0157379_10408249
221 Ga0157376_12316854
222 Ga0163161_10060916
223 Ga0209147_100153
224 Ga0209233_1059349
225 Ga0209025_1000040
226 Ga0207682_10109646
227 Ga0207692_10064264
228 Ga0207688_10192363
229 Ga0207685_10015203
230 Ga0207699_10093497
231 Ga0207645_10770498
232 Ga0207695_10000628
233 Ga0207671_10753145
234 Ga0207693_10029904
235 Ga0207663_10184931
236 Ga0207659_11134748
237 Ga0207700_10170908
238 Ga0207700_10303726
239 Ga0207664_10776276
240 Ga0207664_10905352
241 Ga0207669_10060333
242 Ga0207704_11462257
243 Ga0207665_10006609
244 Ga0207665_11271519
245 Ga0207691_10187916
246 Ga0207702_11156591
247 Ga0207648_11023055
248 Ga0207683_10216366
249 Ga0207683_10329051
250 Ga0207683_10477451
251 Ga0207683_10523872
252 Ga0207698_12654453
253 Ga0209281_1002430
254 Ga0209588_1033812
255 Ga0268266_11514188
256 Ga0265762_1131312
257 Ga0307508_10389798
258 Ga0307516_10873723
259 Ga0307406_11703930
260 Ga0307406_11826405
261 Ga0307412_10201530
262 Ga0307409_100373886
263 Ga0307411_10572567
264 Ga0307411_10912757
265 Ga0307411_11155342
266 Ga0395900_0721473
267 Ga0395900_1811079
268 Ga0395905_0000842
269 Ga0395905_0004802
270 Ga0395905_0461676
271 Ga0395905_0893758
272 Ga0436364_0160709
273 Ga0436364_0734588
274 Ga0436364_1161589
275 Ga0436363_1227463
276 Ga0436363_1376609
277 Ga0436362_1268715
278 Ga0451797_1237977
279 Ga0451853_2278679
280 Ga0451576_2041027
281 Ga0495603_0338828
282 Ga0495590_0012458
283 Ga0495580_0057070
284 Ga0495594_0039967
285 Ga0495583_0241415
286 Ga0495606_0164050
287 Ga0495643_0005602
288 Ga0495643_0041104
289 Ga0495643_0169736
290 Ga0495648_0000736
291 Ga0495663_0014325
292 Ga0495666_0029485
293 Ga0495642_0014303
294 Ga0495642_0133880
295 Ga0495654_0000140
296 Ga0495598_0118444
297 Ga0495621_0004841
298 Ga0495621_0329473
299 Ga0495597_0021623
300 Ga0495597_0216870
301 Ga0495633_0104086
302 Ga0495656_0000649
303 Ga0495668_0228723
304 Ga0495661_0003521
305 Ga0495588_0775297
306 Ga0495599_0698945
307 Ga0495624_0036750
308 Ga0495670_0105031
309 Ga0495649_0626242
310 Ga0495589_0236441
311 Ga0495660_0256941
312 Ga0495604_0120126
313 Ga0495672_0168425
314 Ga0495687_003871
315 Ga0495685_036405
316 Ga0495673_0024568
317 Ga0495615_0011798
318 Ga0495626_0068043
319 Ga0496101_0354674
320 Ga0496105_0021921
321 Ga0496108_1550970
322 Ga0496108_1677887
323 Ga0496110_0823130
324 Ga0496114_0336468
325 Ga0496114_1435904
326 Ga0496115_0628618
327 Ga0496121_0316675
328 Ga0496121_0433595
329 Ga0496124_0224021
330 Ga0496124_0662889
331 nmdc:mga0k408_290724_c1
332 nmdc:mga06z11_322008_c1
333 nmdc:mga07m45_281359_c1
334 nmdc:mga09592_1247965_c1
335 nmdc:mga09592_15100_c1
336 Ga0495601_0415769
337 Ga0500578_0137485
338 Ga0500556_0000024
339 Ga0500621_288369
340 Ga0500652_000481
341 Ga0500603_085006
342 Ga0500627_0260121
343 2511387944
344 2545675791
345 2599745677
346 2600207585
347 2657684758
348 2676745310
349 2792579995
350 2792620348
351 2792625706
352 2804755902
353 2851184343
354 2870074836
355 2904694958
356 2904704067
357 2908759902
358 641641609
359 8020948816
360 8049297456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02426

MIase

Muconolactone delta-isomerase

1

90

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.9808 1 91
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.9775 1 91
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.9757 1 91
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.9703 1 91
3znu-assembly1.cif.gz_I crystal structure of clcf in crystal form 2 0.9671 1 91
ID Description Score Start End Superfamily
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9657 1 94 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9558 1 94 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9228 1 91 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9128 3 91 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8492 3 91 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A6B8WNX9-F1-model_v4 Muconolactone Delta-isomerase (EC 5.3.3.4) 0.9915 2 88 GO:0016159
AF-A0A258T7C8-F1-model_v4 Muconolactone Delta-isomerase (MIase) (EC 5.3.3.4) 0.9907 1 91 GO:0016159
GO:0042952
AF-A0A6S7CXD0-F1-model_v4 Muconolactone Delta-isomerase (EC 5.3.3.4) 0.9904 1 91 GO:0016159
GO:0042952
AF-A0A7V8FSA6-F1-model_v4 Muconolactone Delta-isomerase (MIase) (EC 5.3.3.4) 0.9902 1 91 GO:0016159
GO:0042952
AF-I4CSM4-F1-model_v4 Muconolactone Delta-isomerase (EC 5.3.3.4) 0.9897 1 95 GO:0016159
GO:0042952

Map