F275818

General Info

Members Datasets Scaffolds Average Seq Length
180 113 360 193

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10036976|Ga0265324_100369761
Length 185
Sequence VTVKKKEITSAAILGRPIAKASAGPDLKKVKPEWQKFCLHLLELREQLTKQMNGLAAESAQEMAGYSLHMADSGTDNFDRDFALSLLSSDQDAVYEIEEALKRIERKTYGVCELTGKNIPKARLEAIPWTRFTVEAQAQLEREGALRSRRLGTLGTIDSVGTTTDVDGEDEEHADETAKVNKEKD

Samples

Sample ID Description Type Environment
1 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 30.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265324_10036976 3300029957 Bacteria 1697
2 rootH1_10284720 3300003323 Bacteria 4296
3 Ga0070658_10553907 3300005327 Bacteria 995
4 Ga0070694_100002918 3300005444 Bacteria 10160
5 Ga0070679_100169969 3300005530 Bacteria 2153
6 Ga0068853_100769278 3300005539 Unclassified 921
7 Ga0070686_100020117 3300005544 Bacteria 3947
8 Ga0070704_100003107 3300005549 Bacteria 9466
9 Ga0068855_100021950 3300005563 Bacteria 7653
10 Ga0068855_100134283 3300005563 Unclassified 2824
11 Ga0068857_100304887 3300005577 Bacteria 1469
12 Ga0068856_100000079 3300005614 Bacteria 92486
13 Ga0068856_100202137 3300005614 Bacteria 2001
14 Ga0068856_100442212 3300005614 Bacteria 1321
15 Ga0068859_100173739 3300005617 Bacteria 2236
16 Ga0068859_100711187 3300005617 Unclassified 1095
17 Ga0068863_100465936 3300005841 Unclassified 1241
18 Ga0068858_100122398 3300005842 Unclassified 2434
19 Ga0081455_10073748 3300005937 Bacteria 2820
20 Ga0070717_10078969 3300006028 Bacteria 2758
21 Ga0070715_10083204 3300006163 Bacteria 1457
22 Ga0075428_100011603 3300006844 Bacteria 9805
23 Ga0075431_100366920 3300006847 Unclassified 1445
24 Ga0075434_100047744 3300006871 Bacteria 4248
25 Ga0075429_100562152 3300006880 Unclassified 1000
26 Ga0075429_100742852 3300006880 Bacteria 860
27 Ga0075436_100451486 3300006914 Unclassified 936
28 Ga0097620_100054412 3300006931 Unclassified 4025
29 Ga0097620_100173747 3300006931 Bacteria 2236
30 Ga0097620_100711117 3300006931 Unclassified 1095
31 Ga0105240_10132790 3300009093 Bacteria 2984
32 Ga0105240_10553012 3300009093 Bacteria 1273
33 Ga0105240_10949072 3300009093 Bacteria 923
34 Ga0111539_10014480 3300009094 Bacteria 9845
35 Ga0105241_10234824 3300009174 Bacteria 1547
36 Ga0105238_10003252 3300009551 Bacteria 16217
37 Ga0105238_10014437 3300009551 Bacteria 7987
38 Ga0105249_10166715 3300009553 Bacteria 2133
39 Ga0157369_10378712 3300013105 Bacteria 1469
40 Ga0157374_10125115 3300013296 Unclassified 2485
41 Ga0157374_11480682 3300013296 Unclassified 702
42 Ga0157378_10051585 3300013297 Bacteria 3661
43 Ga0157376_10044168 3300014969 Bacteria 3661
44 Ga0207685_10062229 3300025905 Unclassified 1482
45 Ga0207705_10881632 3300025909 Unclassified 693
46 Ga0207707_10208247 3300025912 Bacteria 1704
47 Ga0207695_10282618 3300025913 Bacteria 1553
48 Ga0207695_10468763 3300025913 Bacteria 1142
49 Ga0207652_10227131 3300025921 Bacteria 1683
50 Ga0207694_10011188 3300025924 Bacteria 6773
51 Ga0207706_10901097 3300025933 Bacteria 747
52 Ga0207667_10064790 3300025949 Bacteria 3814
53 Ga0207667_10087247 3300025949 Unclassified 3228
54 Ga0207667_10161631 3300025949 Bacteria 2303
55 Ga0207703_10223478 3300026035 Unclassified 1685
56 Ga0207639_10179019 3300026041 Bacteria 1802
57 Ga0207702_10000669 3300026078 Bacteria 37291
58 Ga0207702_10104549 3300026078 Bacteria 2506
59 Ga0207702_10306001 3300026078 Unclassified 1510
60 Ga0207641_10133228 3300026088 Unclassified 2234
61 Ga0207648_11064925 3300026089 Unclassified 758
62 Ga0207676_10664651 3300026095 Eukaryota 1007
63 Ga0207428_10484220 3300027907 Unclassified 900
64 Ga0265319_1000019 3300028563 Bacteria 154537
65 Ga0265319_1005132 3300028563 Bacteria 6337
66 Ga0265318_10075374 3300028577 Bacteria 1248
67 Ga0265338_10000145 3300028800 Bacteria 130629
68 Ga0265338_10009538 3300028800 Bacteria 11551
69 Ga0265338_10032385 3300028800 Bacteria 5100
70 Ga0265338_10040849 3300028800 Bacteria 4350
71 Ga0265338_10096683 3300028800 Bacteria 2422
72 Ga0265338_10117039 3300028800 Bacteria 2133
73 Ga0265338_10176764 3300028800 Bacteria 1631
74 Ga0265338_10435229 3300028800 Bacteria 930
75 Ga0265324_10014052 3300029957 Bacteria 2971
76 Ga0265324_10014462 3300029957 Unclassified 2919
77 Ga0265324_10045221 3300029957 Bacteria 1516
78 Ga0265324_10049164 3300029957 Bacteria 1450
79 Ga0265324_10178985 3300029957 Unclassified 720
80 Ga0265320_10011918 3300031240 Bacteria 5091
81 Ga0265320_10036788 3300031240 Bacteria 2471
82 Ga0265320_10175625 3300031240 Bacteria 961
83 Ga0265325_10015665 3300031241 Bacteria 4258
84 Ga0265325_10204359 3300031241 Unclassified 909
85 Ga0265340_10023583 3300031247 Bacteria 3135
86 Ga0265339_10007758 3300031249 Bacteria 6900
87 Ga0265339_10020223 3300031249 Unclassified 3892
88 Ga0265327_10002539 3300031251 Bacteria 19022
89 Ga0265327_10165628 3300031251 Bacteria 1018
90 Ga0265316_10013762 3300031344 Bacteria 7167
91 Ga0265316_10064382 3300031344 Bacteria 2840
92 Ga0265316_10126655 3300031344 Bacteria 1925
93 Ga0265316_10256923 3300031344 Unclassified 1282
94 Ga0307408_100524680 3300031548 Bacteria 1041
95 Ga0265313_10001645 3300031595 Bacteria 20708
96 Ga0265313_10077981 3300031595 Bacteria 1511
97 Ga0265314_10086692 3300031711 Bacteria 2049
98 Ga0265314_10099832 3300031711 Bacteria 1868
99 Ga0373926_0136446 3300035083 Unclassified 931
100 Ga0373929_0000713 3300035085 Bacteria 6438
101 Ga0373940_0126110 3300035088 Bacteria 798
102 Ga0373944_0008967 3300035089 Unclassified 2705
103 Ga0373944_0129047 3300035089 Unclassified 877
104 Ga0373949_0003098 3300035090 Bacteria 4063
105 Ga0373951_0003697 3300035091 Bacteria 3691
106 Ga0373951_0063071 3300035091 Unclassified 931
107 Ga0373932_0000001 3300035112 Bacteria 1459067
108 Ga0373945_0081495 3300035116 Bacteria 1240
109 Ga0373945_0163718 3300035116 Unclassified 908
110 Ga0373953_0089228 3300035117 Unclassified 1288
111 Ga0373956_0047996 3300035119 Unclassified 1911
112 Ga0373957_0095192 3300035120 Bacteria 1187
113 Ga0373955_0068029 3300035172 Unclassified 1984
114 Ga0373962_0000147 3300035242 Bacteria 14702
115 Ga0373931_0000004 3300035691 Bacteria 535140
116 Ga0373931_0121609 3300035691 Unclassified 1493
117 Ga0373927_0014364 3300035695 Bacteria 5244
118 Ga0373927_0242921 3300035695 Unclassified 1183
119 Ga0373933_0100518 3300035724 Unclassified 1794
120 Ga0373937_0007459 3300036401 Bacteria 9463
121 Ga0373925_0001492 3300037068 Bacteria 20098
122 Ga0373925_0392181 3300037068 Unclassified 1132
123 Ga0373925_0757657 3300037068 Bacteria 800
124 Ga0451577_0023113 3300042876 Bacteria 5675
125 Ga0451577_0102652 3300042876 Unclassified 2555
126 Ga0451577_0137575 3300042876 Unclassified 2194
127 Ga0451577_0679529 3300042876 Bacteria 933
128 Ga0453683_0316053 3300044673 Bacteria 1000
129 Ga0453684_0002169 3300044712 Bacteria 49058
130 Ga0453684_0023495 3300044712 Bacteria 9073
131 Ga0453684_0329474 3300044712 Bacteria 1727
132 Ga0453684_0454530 3300044712 Bacteria 1425
133 Ga0453684_0716369 3300044712 Bacteria 1086
134 Ga0451576_0083466 3300045051 Viruses 3324
135 Ga0451576_0343481 3300045051 Unclassified 1563
136 Ga0451576_0426008 3300045051 Bacteria 1392
137 Ga0495592_0439794 3300046454 Bacteria 819
138 Ga0495592_0517514 3300046454 Bacteria 738
139 Ga0495629_0212912 3300046459 Bacteria 1334
140 Ga0495639_0281263 3300046475 Unclassified 827
141 Ga0495618_0031274 3300046514 Unclassified 3329
142 Ga0495628_0885928 3300046516 Unclassified 620
143 Ga0495630_0022244 3300046517 Bacteria 4685
144 Ga0495630_0141098 3300046517 Bacteria 1832
145 Ga0495630_0163371 3300046517 Unclassified 1695
146 Ga0495640_0062268 3300046533 Unclassified 2531
147 Ga0495586_0006909 3300046535 Bacteria 6047
148 Ga0495586_0120576 3300046535 Bacteria 1465
149 Ga0495586_0151390 3300046535 Bacteria 1305
150 Ga0495586_0281605 3300046535 Bacteria 952
151 Ga0495587_0046190 3300046536 Bacteria 2586
152 Ga0495645_0070355 3300046543 Bacteria 2525
153 Ga0495645_0193497 3300046543 Bacteria 1384
154 Ga0495645_0434381 3300046543 Bacteria 831
155 Ga0495645_0591476 3300046543 Unclassified 683
156 Ga0495622_0092944 3300046557 Bacteria 1385
157 Ga0495667_0023119 3300046559 Unclassified 4189
158 Ga0495634_0062073 3300046642 Bacteria 2482
159 Ga0495634_0414300 3300046642 Bacteria 799
160 Ga0495599_0094023 3300046678 Bacteria 1870
161 Ga0495658_0010416 3300046683 Bacteria 4652
162 Ga0495613_0005951 3300046689 Bacteria 9124
163 Ga0495674_0010471 3300047319 Bacteria 8779
164 Ga0495680_0056379 3300047322 Bacteria 3042
165 Ga0495675_0375820 3300047444 Bacteria 832
166 Ga0501031_0000638 3300049568 Bacteria 20752
167 Ga0501033_0085415 3300049570 Bacteria 2311
168 Ga0501034_0518750 3300049571 Unclassified 1104
169 Ga0501036_0374431 3300049572 Unclassified 1189
170 Ga0501046_0280285 3300049580 Unclassified 1221
171 Ga0501047_0459637 3300049581 Bacteria 1102
172 Ga0501035_0004373 3300049822 Bacteria 13422
173 Ga0501044_0000611 3300049823 Bacteria 43362
174 Ga0501044_0324095 3300049823 Unclassified 1464
175 nmdc:mga05p37_1210596_c1 3300050507 Bacteria 779
176 nmdc:mga06r32_1091256_c1 3300050510 Unclassified 747
177 nmdc:mga08y16_21885_c1 3300050511 Bacteria 6748
178 nmdc:mga0n895_112837_c1 3300050512 Unclassified 2735
179 nmdc:mga0n895_743666_c1 3300050512 Unclassified 974
180 nmdc:mga0a205_325447_c1 3300050515 Unclassified 1407
181 Ga0265324_10036976
182 rootH1_10284720
183 Ga0070658_10553907
184 Ga0070694_100002918
185 Ga0070679_100169969
186 Ga0068853_100769278
187 Ga0070686_100020117
188 Ga0070704_100003107
189 Ga0068855_100021950
190 Ga0068855_100134283
191 Ga0068857_100304887
192 Ga0068856_100000079
193 Ga0068856_100202137
194 Ga0068856_100442212
195 Ga0068859_100173739
196 Ga0068859_100711187
197 Ga0068863_100465936
198 Ga0068858_100122398
199 Ga0081455_10073748
200 Ga0070717_10078969
201 Ga0070715_10083204
202 Ga0075428_100011603
203 Ga0075431_100366920
204 Ga0075434_100047744
205 Ga0075429_100562152
206 Ga0075429_100742852
207 Ga0075436_100451486
208 Ga0097620_100054412
209 Ga0097620_100173747
210 Ga0097620_100711117
211 Ga0105240_10132790
212 Ga0105240_10553012
213 Ga0105240_10949072
214 Ga0111539_10014480
215 Ga0105241_10234824
216 Ga0105238_10003252
217 Ga0105238_10014437
218 Ga0105249_10166715
219 Ga0157369_10378712
220 Ga0157374_10125115
221 Ga0157374_11480682
222 Ga0157378_10051585
223 Ga0157376_10044168
224 Ga0207685_10062229
225 Ga0207705_10881632
226 Ga0207707_10208247
227 Ga0207695_10282618
228 Ga0207695_10468763
229 Ga0207652_10227131
230 Ga0207694_10011188
231 Ga0207706_10901097
232 Ga0207667_10064790
233 Ga0207667_10087247
234 Ga0207667_10161631
235 Ga0207703_10223478
236 Ga0207639_10179019
237 Ga0207702_10000669
238 Ga0207702_10104549
239 Ga0207702_10306001
240 Ga0207641_10133228
241 Ga0207648_11064925
242 Ga0207676_10664651
243 Ga0207428_10484220
244 Ga0265319_1000019
245 Ga0265319_1005132
246 Ga0265318_10075374
247 Ga0265338_10000145
248 Ga0265338_10009538
249 Ga0265338_10032385
250 Ga0265338_10040849
251 Ga0265338_10096683
252 Ga0265338_10117039
253 Ga0265338_10176764
254 Ga0265338_10435229
255 Ga0265324_10014052
256 Ga0265324_10014462
257 Ga0265324_10045221
258 Ga0265324_10049164
259 Ga0265324_10178985
260 Ga0265320_10011918
261 Ga0265320_10036788
262 Ga0265320_10175625
263 Ga0265325_10015665
264 Ga0265325_10204359
265 Ga0265340_10023583
266 Ga0265339_10007758
267 Ga0265339_10020223
268 Ga0265327_10002539
269 Ga0265327_10165628
270 Ga0265316_10013762
271 Ga0265316_10064382
272 Ga0265316_10126655
273 Ga0265316_10256923
274 Ga0307408_100524680
275 Ga0265313_10001645
276 Ga0265313_10077981
277 Ga0265314_10086692
278 Ga0265314_10099832
279 Ga0373926_0136446
280 Ga0373929_0000713
281 Ga0373940_0126110
282 Ga0373944_0008967
283 Ga0373944_0129047
284 Ga0373949_0003098
285 Ga0373951_0003697
286 Ga0373951_0063071
287 Ga0373932_0000001
288 Ga0373945_0081495
289 Ga0373945_0163718
290 Ga0373953_0089228
291 Ga0373956_0047996
292 Ga0373957_0095192
293 Ga0373955_0068029
294 Ga0373962_0000147
295 Ga0373931_0000004
296 Ga0373931_0121609
297 Ga0373927_0014364
298 Ga0373927_0242921
299 Ga0373933_0100518
300 Ga0373937_0007459
301 Ga0373925_0001492
302 Ga0373925_0392181
303 Ga0373925_0757657
304 Ga0451577_0023113
305 Ga0451577_0102652
306 Ga0451577_0137575
307 Ga0451577_0679529
308 Ga0453683_0316053
309 Ga0453684_0002169
310 Ga0453684_0023495
311 Ga0453684_0329474
312 Ga0453684_0454530
313 Ga0453684_0716369
314 Ga0451576_0083466
315 Ga0451576_0343481
316 Ga0451576_0426008
317 Ga0495592_0439794
318 Ga0495592_0517514
319 Ga0495629_0212912
320 Ga0495639_0281263
321 Ga0495618_0031274
322 Ga0495628_0885928
323 Ga0495630_0022244
324 Ga0495630_0141098
325 Ga0495630_0163371
326 Ga0495640_0062268
327 Ga0495586_0006909
328 Ga0495586_0120576
329 Ga0495586_0151390
330 Ga0495586_0281605
331 Ga0495587_0046190
332 Ga0495645_0070355
333 Ga0495645_0193497
334 Ga0495645_0434381
335 Ga0495645_0591476
336 Ga0495622_0092944
337 Ga0495667_0023119
338 Ga0495634_0062073
339 Ga0495634_0414300
340 Ga0495599_0094023
341 Ga0495658_0010416
342 Ga0495613_0005951
343 Ga0495674_0010471
344 Ga0495680_0056379
345 Ga0495675_0375820
346 Ga0501031_0000638
347 Ga0501033_0085415
348 Ga0501034_0518750
349 Ga0501036_0374431
350 Ga0501046_0280285
351 Ga0501047_0459637
352 Ga0501035_0004373
353 Ga0501044_0000611
354 Ga0501044_0324095
355 nmdc:mga05p37_1210596_c1
356 nmdc:mga06r32_1091256_c1
357 nmdc:mga08y16_21885_c1
358 nmdc:mga0n895_112837_c1
359 nmdc:mga0n895_743666_c1
360 nmdc:mga0a205_325447_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

107

142

0.95

Map