F275709

General Info

Members Datasets Scaffolds Average Seq Length
180 114 180 289

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10003042|Ga0207660_100030423
Length 317
Sequence MRRRSRSPALAGTAGRAPRWMRIGRGYVAEGMADAALRLPENVEGDFYVDSTCIDCDACRVLAPTVFSDERDQSFVFHQPETDEELLAAQKALITCPTSSIGSGRSARNAIDALPELLEDDVYRCGYASESSFGAISYYLADRNILIDSPRFAGPLVKRLEAMGGVRRMLLTHQDDVADHANYHERFGCERVLHRDDVRAKTSMMELQPAGSEAIELERDLLMIPTPGHTRGHAVFLYRDRFLFTGDHLAWSPTRGHLYAFRSACWYSWTEQIASMQRLLDYSFEYVLPGHGRPVRMPAEEMRASLVRCIDWMNAKR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 6.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10185970 3300003320 Bacteria 1619
2 Ga0065715_10154003 3300005293 Bacteria 1697
3 Ga0070658_10115822 3300005327 Bacteria 2223
4 Ga0070658_10728330 3300005327 Unclassified 861
5 Ga0070683_100000037 3300005329 Bacteria 120863
6 Ga0070683_100312589 3300005329 Bacteria 1495
7 Ga0070670_100000163 3300005331 Bacteria 60453
8 Ga0070670_100117687 3300005331 Bacteria 2292
9 Ga0070670_100118634 3300005331 Bacteria 2282
10 Ga0070670_100122417 3300005331 Bacteria 2244
11 Ga0070677_10021205 3300005333 Bacteria 2381
12 Ga0068869_100006416 3300005334 Bacteria 7460
13 Ga0068869_100044132 3300005334 Bacteria 3205
14 Ga0068869_100069600 3300005334 Bacteria 2602
15 Ga0068869_100353018 3300005334 Bacteria 1199
16 Ga0070680_100100210 3300005336 Bacteria 2404
17 Ga0070682_100000004 3300005337 Bacteria 388780
18 Ga0070682_100058183 3300005337 Unclassified 2437
19 Ga0068868_100000055 3300005338 Bacteria 64085
20 Ga0068868_100003949 3300005338 Bacteria 10354
21 Ga0070689_100001266 3300005340 Bacteria 16062
22 Ga0070692_10004944 3300005345 Bacteria 5623
23 Ga0070675_100000030 3300005354 Bacteria 100523
24 Ga0070674_100196530 3300005356 Bacteria 1555
25 Ga0070713_100007117 3300005436 Bacteria 7820
26 Ga0070701_10001587 3300005438 Bacteria 8461
27 Ga0070700_100000009 3300005441 Bacteria 181474
28 Ga0070694_100245902 3300005444 Bacteria 1351
29 Ga0070708_100031810 3300005445 Bacteria 4570
30 Ga0070708_100088434 3300005445 Bacteria 2817
31 Ga0070708_100213135 3300005445 Bacteria 1810
32 Ga0070678_100259050 3300005456 Bacteria 1462
33 Ga0068867_100138389 3300005459 Bacteria 1900
34 Ga0070706_100013673 3300005467 Bacteria 7504
35 Ga0070706_100161801 3300005467 Bacteria 2090
36 Ga0070706_100201417 3300005467 Bacteria 1859
37 Ga0070706_100486865 3300005467 Bacteria 1148
38 Ga0070706_100524814 3300005467 Unclassified 1101
39 Ga0070707_100007799 3300005468 Bacteria 9944
40 Ga0070707_100041327 3300005468 Bacteria 4413
41 Ga0070707_100107520 3300005468 Bacteria 2706
42 Ga0070698_100008987 3300005471 Bacteria 10747
43 Ga0070698_100032102 3300005471 Bacteria 5441
44 Ga0070698_100105739 3300005471 Bacteria 2784
45 Ga0070698_100126760 3300005471 Bacteria 2510
46 Ga0070698_100273172 3300005471 Bacteria 1622
47 Ga0070699_100027828 3300005518 Bacteria 4876
48 Ga0070699_100052735 3300005518 Bacteria 3519
49 Ga0070684_100000375 3300005535 Bacteria 30935
50 Ga0070697_100082468 3300005536 Unclassified 2650
51 Ga0070697_100148964 3300005536 Bacteria 1972
52 Ga0068853_100029372 3300005539 Bacteria 4634
53 Ga0070672_100002121 3300005543 Bacteria 12526
54 Ga0070686_100151811 3300005544 Bacteria 1623
55 Ga0070693_100090735 3300005547 Bacteria 1841
56 Ga0070664_100296165 3300005564 Unclassified 1461
57 Ga0068854_100003210 3300005578 Bacteria 10200
58 Ga0068854_100021023 3300005578 Bacteria 4424
59 Ga0070702_100003372 3300005615 Bacteria 7134
60 Ga0070702_100186086 3300005615 Bacteria 1363
61 Ga0068864_100000025 3300005618 Bacteria 250062
62 Ga0068861_100089002 3300005719 Bacteria 2433
63 Ga0068870_10036527 3300005840 Bacteria 2528
64 Ga0068870_10350445 3300005840 Unclassified 947
65 Ga0068858_100000524 3300005842 Bacteria 40268
66 Ga0070717_10000147 3300006028 Bacteria 52381
67 Ga0097621_100089972 3300006237 Bacteria 2567
68 Ga0068871_100187292 3300006358 Unclassified 1781
69 Ga0075428_100004601 3300006844 Bacteria 15254
70 Ga0075428_100181223 3300006844 Bacteria 2280
71 Ga0075431_100000956 3300006847 Bacteria 25586
72 Ga0075435_100001604 3300007076 Bacteria 14611
73 Ga0075435_100002642 3300007076 Bacteria 11939
74 Ga0105240_10089681 3300009093 Bacteria 3760
75 Ga0111539_10000007 3300009094 Bacteria 418059
76 Ga0111539_10015817 3300009094 Bacteria 9371
77 Ga0111539_10517828 3300009094 Bacteria 1389
78 Ga0105245_10000014 3300009098 Bacteria 230684
79 Ga0105245_10002032 3300009098 Bacteria 18358
80 Ga0105245_10017209 3300009098 Bacteria 6306
81 Ga0114129_10077415 3300009147 Bacteria 4626
82 Ga0114129_10551476 3300009147 Unclassified 1499
83 Ga0105242_10005510 3300009176 Bacteria 9768
84 Ga0105242_10470049 3300009176 Bacteria 1189
85 Ga0105238_10000010 3300009551 Bacteria 271274
86 Ga0157369_10001741 3300013105 Bacteria 26432
87 Ga0157374_10000008 3300013296 Bacteria 588863
88 Ga0157378_10001632 3300013297 Bacteria 20276
89 Ga0157378_10002808 3300013297 Bacteria 15533
90 Ga0157378_10004418 3300013297 Bacteria 12374
91 Ga0163162_10005801 3300013306 Bacteria 11949
92 Ga0163162_10047668 3300013306 Bacteria 4294
93 Ga0157375_10000034 3300013308 Bacteria 184385
94 Ga0157375_10000046 3300013308 Bacteria 150644
95 Ga0157375_10000532 3300013308 Bacteria 34172
96 Ga0163163_10000183 3300014325 Bacteria 64505
97 Ga0163163_10019783 3300014325 Bacteria 6331
98 Ga0157380_10107529 3300014326 Bacteria 2336
99 Ga0157377_10000012 3300014745 Bacteria 274497
100 Ga0157377_10000165 3300014745 Bacteria 39470
101 Ga0157376_10000044 3300014969 Bacteria 110557
102 Ga0213873_10000001 3300021358 Bacteria 1657979
103 Ga0213873_10000486 3300021358 Bacteria 6388
104 Ga0213876_10000008 3300021384 Bacteria 506740
105 Ga0213876_10000015 3300021384 Bacteria 304025
106 Ga0213876_10127920 3300021384 Bacteria 1349
107 Ga0207682_10046940 3300025893 Bacteria 1776
108 Ga0207643_10045177 3300025908 Bacteria 2487
109 Ga0207643_10306573 3300025908 Unclassified 989
110 Ga0207684_10040058 3300025910 Bacteria 3972
111 Ga0207684_10324070 3300025910 Bacteria 1328
112 Ga0207695_10050105 3300025913 Bacteria 4396
113 Ga0207660_10003042 3300025917 Bacteria 10975
114 Ga0207662_10006614 3300025918 Bacteria 6260
115 Ga0207646_10032348 3300025922 Bacteria 4734
116 Ga0207694_10000002 3300025924 Bacteria 1165763
117 Ga0207694_10000003 3300025924 Bacteria 1165533
118 Ga0207650_10000096 3300025925 Bacteria 115850
119 Ga0207650_10083500 3300025925 Bacteria 2426
120 Ga0207659_10000002 3300025926 Bacteria 619441
121 Ga0207687_10000010 3300025927 Bacteria 403706
122 Ga0207687_10001329 3300025927 Bacteria 16896
123 Ga0207687_10003868 3300025927 Bacteria 10053
124 Ga0207700_10052963 3300025928 Bacteria 3037
125 Ga0207686_10005578 3300025934 Bacteria 6745
126 Ga0207670_10017765 3300025936 Bacteria 4307
127 Ga0207669_10014214 3300025937 Bacteria 3985
128 Ga0207665_10114745 3300025939 Unclassified 1897
129 Ga0207691_10002410 3300025940 Bacteria 18303
130 Ga0207689_10008547 3300025942 Bacteria 8924
131 Ga0207689_10016870 3300025942 Bacteria 6180
132 Ga0207689_10098616 3300025942 Bacteria 2401
133 Ga0207661_10000009 3300025944 Bacteria 421876
134 Ga0207661_10205607 3300025944 Bacteria 1733
135 Ga0207640_10001727 3300025981 Bacteria 11724
136 Ga0207640_10012714 3300025981 Bacteria 4802
137 Ga0207677_10000020 3300026023 Bacteria 137014
138 Ga0207677_10000066 3300026023 Bacteria 87846
139 Ga0207703_10000192 3300026035 Bacteria 71634
140 Ga0207639_10000073 3300026041 Bacteria 93577
141 Ga0207708_10000003 3300026075 Bacteria 324662
142 Ga0207708_10291898 3300026075 Bacteria 1324
143 Ga0207648_10335892 3300026089 Bacteria 1360
144 Ga0207676_10000002 3300026095 Bacteria 1198607
145 Ga0207674_10010046 3300026116 Bacteria 10767
146 Ga0207675_100089181 3300026118 Bacteria 2897
147 Ga0207683_10038146 3300026121 Unclassified 4185
148 Ga0207428_10000008 3300027907 Bacteria 423201
149 Ga0207428_10014301 3300027907 Bacteria 6905
150 Ga0265334_10002967 3300028573 Bacteria 7771
151 Ga0265338_10022656 3300028800 Bacteria 6491
152 Ga0307511_10000120 3300030521 Bacteria 71419
153 Ga0307513_10062776 3300031456 Bacteria 3925
154 Ga0373932_0000196 3300035112 Bacteria 17626
155 Ga0436364_0790424 3300037853 Bacteria 1421
156 Ga0436365_0199623 3300039437 Bacteria 40041
157 Ga0436365_0351866 3300039437 Bacteria 17267
158 Ga0436365_0724408 3300039437 Bacteria 3473
159 Ga0436365_0973417 3300039437 Bacteria 57549
160 Ga0436362_0612980 3300039453 Unclassified 4125
161 Ga0436362_1305298 3300039453 Bacteria 131464
162 Ga0453683_0093232 3300044673 Bacteria 1888
163 Ga0495620_0001822 3300046515 Bacteria 12536
164 Ga0495670_0186028 3300046691 Bacteria 1098
165 Ga0495636_0056980 3300047318 Bacteria 1645
166 Ga0495679_015823 3300047446 Bacteria 2745
167 Ga0496104_0124237 3300048907 Bacteria 2478
168 Ga0501038_0008547 3300049574 Bacteria 9402
169 Ga0501073_0000609 3300049589 Bacteria 25240
170 Ga0501080_0000860 3300049742 Bacteria 24875
171 nmdc:mga05p37_608166_c1 3300050507 Unclassified 1232
172 nmdc:mga06r32_3787_c2 3300050510 Bacteria 5375
173 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
174 nmdc:mga08y16_213622_c1 3300050511 Bacteria 1998
175 nmdc:mga08y16_476670_c1 3300050511 Bacteria 1270
176 nmdc:mga0rr50_2872_c1 3300050513 Bacteria 9819
177 nmdc:mga0rr50_384_c1 3300050513 Bacteria 24106
178 nmdc:mga0rr50_79900_c1 3300050513 Bacteria 2520
179 nmdc:mga08x19_4012_c1 3300050514 Bacteria 8758
180 Ga0495655_0000131 3300053083 Bacteria 13714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10728330 Ga0070658_107283301 234
2 3300025908 Ga0207643_10306573 Ga0207643_103065731 237
3 3300005615 Ga0070702_100186086 Ga0070702_1001860861 277
4 3300005293 Ga0065715_10154003 Ga0065715_101540032 278
5 3300025939 Ga0207665_10114745 Ga0207665_101147452 279
6 3300005438 Ga0070701_10001587 Ga0070701_100015875 281
7 3300006847 Ga0075431_100000956 Ga0075431_10000095623 281
8 3300046515 Ga0495620_0001822 Ga0495620_0001822_60_905 281
9 3300050510 nmdc:mga06r32_3787_c2 nmdc:mga06r32_3787_c2_50_901 281
10 3300005840 Ga0068870_10350445 Ga0068870_103504451 282
11 3300005333 Ga0070677_10021205 Ga0070677_100212051 283
12 3300005543 Ga0070672_100002121 Ga0070672_1000021213 283
13 3300005618 Ga0068864_100000025 Ga0068864_100000025123 283
14 3300013308 Ga0157375_10000034 Ga0157375_1000003468 283
15 3300014326 Ga0157380_10107529 Ga0157380_101075292 283
16 3300025893 Ga0207682_10046940 Ga0207682_100469403 283
17 3300025940 Ga0207691_10002410 Ga0207691_100024103 283
18 3300026095 Ga0207676_10000002 Ga0207676_10000002953 283
19 3300049589 Ga0501073_0000609 Ga0501073_0000609_7952_8806 283
20 3300049742 Ga0501080_0000860 Ga0501080_0000860_6522_7376 283
21 3300005337 Ga0070682_100000004 Ga0070682_100000004125 284
22 3300005340 Ga0070689_100001266 Ga0070689_1000012663 284
23 3300005840 Ga0068870_10036527 Ga0068870_100365272 284
24 3300005842 Ga0068858_100000524 Ga0068858_10000052423 284
25 3300009098 Ga0105245_10002032 Ga0105245_1000203210 284
26 3300013297 Ga0157378_10004418 Ga0157378_100044187 284
27 3300025908 Ga0207643_10045177 Ga0207643_100451772 284
28 3300025927 Ga0207687_10001329 Ga0207687_100013294 284
29 3300025936 Ga0207670_10017765 Ga0207670_100177653 284
30 3300026035 Ga0207703_10000192 Ga0207703_1000019231 284
31 3300005334 Ga0068869_100069600 Ga0068869_1000696002 285
32 3300005336 Ga0070680_100100210 Ga0070680_1001002103 285
33 3300005338 Ga0068868_100003949 Ga0068868_1000039493 285
34 3300005354 Ga0070675_100000030 Ga0070675_1000000305 285
35 3300005436 Ga0070713_100007117 Ga0070713_1000071176 285
36 3300005547 Ga0070693_100090735 Ga0070693_1000907352 285
37 3300005719 Ga0068861_100089002 Ga0068861_1000890022 285
38 3300006028 Ga0070717_10000147 Ga0070717_1000014744 285
39 3300006844 Ga0075428_100181223 Ga0075428_1001812232 285
40 3300009094 Ga0111539_10517828 Ga0111539_105178282 285
41 3300009147 Ga0114129_10551476 Ga0114129_105514762 285
42 3300009176 Ga0105242_10005510 Ga0105242_100055102 285
43 3300014745 Ga0157377_10000165 Ga0157377_1000016522 285
44 3300025926 Ga0207659_10000002 Ga0207659_1000000284 285
45 3300025928 Ga0207700_10052963 Ga0207700_100529632 285
46 3300025934 Ga0207686_10005578 Ga0207686_100055783 285
47 3300025942 Ga0207689_10098616 Ga0207689_100986162 285
48 3300026023 Ga0207677_10000020 Ga0207677_1000002043 285
49 3300026118 Ga0207675_100089181 Ga0207675_1000891813 285
50 3300050511 nmdc:mga08y16_476670_c1 nmdc:mga08y16_476670_c1_58_918 285
51 3300050513 nmdc:mga0rr50_384_c1 nmdc:mga0rr50_384_c1_12467_13327 285
52 3300050514 nmdc:mga08x19_4012_c1 nmdc:mga08x19_4012_c1_3911_4771 285
53 3300053083 Ga0495655_0000131 Ga0495655_0000131_12282_13142 285
54 3300005445 Ga0070708_100088434 Ga0070708_1000884343 286
55 3300005467 Ga0070706_100013673 Ga0070706_1000136735 286
56 3300005467 Ga0070706_100486865 Ga0070706_1004868651 286
57 3300005468 Ga0070707_100007799 Ga0070707_1000077999 286
58 3300005468 Ga0070707_100041327 Ga0070707_1000413272 286
59 3300005471 Ga0070698_100126760 Ga0070698_1001267602 286
60 3300005471 Ga0070698_100273172 Ga0070698_1002731722 286
61 3300005518 Ga0070699_100052735 Ga0070699_1000527352 286
62 3300005536 Ga0070697_100148964 Ga0070697_1001489642 286
63 3300009147 Ga0114129_10077415 Ga0114129_100774157 286
64 3300025910 Ga0207684_10040058 Ga0207684_100400585 286
65 3300025910 Ga0207684_10324070 Ga0207684_103240702 286
66 3300025922 Ga0207646_10032348 Ga0207646_100323482 286
67 3300035112 Ga0373932_0000196 Ga0373932_0000196_16061_16924 286
68 3300050507 nmdc:mga05p37_608166_c1 nmdc:mga05p37_608166_c1_260_1123 286
69 3300005445 Ga0070708_100213135 Ga0070708_1002131352 287
70 3300005467 Ga0070706_100201417 Ga0070706_1002014172 287
71 3300005471 Ga0070698_100032102 Ga0070698_1000321026 287
72 3300005564 Ga0070664_100296165 Ga0070664_1002961652 287
73 3300006358 Ga0068871_100187292 Ga0068871_1001872922 287
74 3300014325 Ga0163163_10019783 Ga0163163_100197835 287
75 3300028573 Ga0265334_10002967 Ga0265334_100029679 287
76 3300028800 Ga0265338_10022656 Ga0265338_100226565 287
77 3300005327 Ga0070658_10115822 Ga0070658_101158221 288
78 3300005329 Ga0070683_100000037 Ga0070683_100000037107 288
79 3300005331 Ga0070670_100000163 Ga0070670_10000016334 288
80 3300005356 Ga0070674_100196530 Ga0070674_1001965302 288
81 3300005441 Ga0070700_100000009 Ga0070700_10000000924 288
82 3300005535 Ga0070684_100000375 Ga0070684_1000003755 288
83 3300005539 Ga0068853_100029372 Ga0068853_1000293723 288
84 3300005578 Ga0068854_100021023 Ga0068854_1000210232 288
85 3300009093 Ga0105240_10089681 Ga0105240_100896812 288
86 3300009094 Ga0111539_10000007 Ga0111539_1000000785 288
87 3300009551 Ga0105238_10000010 Ga0105238_1000001023 288
88 3300013105 Ga0157369_10001741 Ga0157369_1000174114 288
89 3300013296 Ga0157374_10000008 Ga0157374_10000008369 288
90 3300013297 Ga0157378_10001632 Ga0157378_1000163218 288
91 3300013308 Ga0157375_10000046 Ga0157375_100000461 288
92 3300013308 Ga0157375_10000532 Ga0157375_1000053216 288
93 3300014745 Ga0157377_10000012 Ga0157377_10000012257 288
94 3300021358 Ga0213873_10000001 Ga0213873_10000001231 288
95 3300021358 Ga0213873_10000486 Ga0213873_100004865 288
96 3300021384 Ga0213876_10000008 Ga0213876_1000000824 288
97 3300021384 Ga0213876_10000015 Ga0213876_1000001539 288
98 3300021384 Ga0213876_10127920 Ga0213876_101279202 288
99 3300025913 Ga0207695_10050105 Ga0207695_100501054 288
100 3300025918 Ga0207662_10006614 Ga0207662_100066142 288
101 3300025924 Ga0207694_10000002 Ga0207694_10000002198 288
102 3300025924 Ga0207694_10000003 Ga0207694_10000003902 288
103 3300025925 Ga0207650_10000096 Ga0207650_1000009686 288
104 3300025937 Ga0207669_10014214 Ga0207669_100142143 288
105 3300025944 Ga0207661_10000009 Ga0207661_10000009301 288
106 3300025981 Ga0207640_10012714 Ga0207640_100127142 288
107 3300026041 Ga0207639_10000073 Ga0207639_1000007328 288
108 3300026075 Ga0207708_10000003 Ga0207708_1000000324 288
109 3300027907 Ga0207428_10000008 Ga0207428_1000000889 288
110 3300030521 Ga0307511_10000120 Ga0307511_1000012057 288
111 3300037853 Ga0436364_0790424 Ga0436364_0790424_56_925 288
112 3300039437 Ga0436365_0199623 Ga0436365_0199623_5902_6771 288
113 3300039437 Ga0436365_0351866 Ga0436365_0351866_6909_7778 288
114 3300039453 Ga0436362_1305298 Ga0436362_1305298_122925_123794 288
115 3300048907 Ga0496104_0124237 Ga0496104_0124237_537_1406 288
116 3300050511 nmdc:mga08y16_13_c2 nmdc:mga08y16_13_c2_89993_90862 288
117 3300050513 nmdc:mga0rr50_79900_c1 nmdc:mga0rr50_79900_c1_1152_2021 288
118 3300005334 Ga0068869_100006416 Ga0068869_1000064161 289
119 3300005337 Ga0070682_100058183 Ga0070682_1000581833 289
120 3300005338 Ga0068868_100000055 Ga0068868_10000005549 289
121 3300005445 Ga0070708_100031810 Ga0070708_1000318105 289
122 3300005456 Ga0070678_100259050 Ga0070678_1002590502 289
123 3300005459 Ga0068867_100138389 Ga0068867_1001383892 289
124 3300005467 Ga0070706_100524814 Ga0070706_1005248141 289
125 3300005471 Ga0070698_100105739 Ga0070698_1001057393 289
126 3300005536 Ga0070697_100082468 Ga0070697_1000824682 289
127 3300005578 Ga0068854_100003210 Ga0068854_1000032104 289
128 3300005615 Ga0070702_100003372 Ga0070702_1000033724 289
129 3300006237 Ga0097621_100089972 Ga0097621_1000899722 289
130 3300007076 Ga0075435_100002642 Ga0075435_10000264210 289
131 3300009094 Ga0111539_10015817 Ga0111539_100158172 289
132 3300009098 Ga0105245_10017209 Ga0105245_100172093 289
133 3300013297 Ga0157378_10002808 Ga0157378_1000280810 289
134 3300013306 Ga0163162_10005801 Ga0163162_100058015 289
135 3300014969 Ga0157376_10000044 Ga0157376_1000004468 289
136 3300025925 Ga0207650_10083500 Ga0207650_100835001 289
137 3300025927 Ga0207687_10003868 Ga0207687_100038683 289
138 3300025942 Ga0207689_10008547 Ga0207689_100085477 289
139 3300025981 Ga0207640_10001727 Ga0207640_100017275 289
140 3300026023 Ga0207677_10000066 Ga0207677_1000006648 289
141 3300026075 Ga0207708_10291898 Ga0207708_102918981 289
142 3300026089 Ga0207648_10335892 Ga0207648_103358922 289
143 3300026121 Ga0207683_10038146 Ga0207683_100381465 289
144 3300027907 Ga0207428_10014301 Ga0207428_100143012 289
145 3300039437 Ga0436365_0973417 Ga0436365_0973417_22512_23390 289
146 3300039453 Ga0436362_0612980 Ga0436362_0612980_3136_4014 289
147 3300046691 Ga0495670_0186028 Ga0495670_0186028_43_915 289
148 3300047318 Ga0495636_0056980 Ga0495636_0056980_628_1500 289
149 3300047446 Ga0495679_015823 Ga0495679_015823_51_929 289
150 3300050511 nmdc:mga08y16_213622_c1 nmdc:mga08y16_213622_c1_615_1487 289
151 3300050513 nmdc:mga0rr50_2872_c1 nmdc:mga0rr50_2872_c1_2333_3214 289
152 3300039437 Ga0436365_0724408 Ga0436365_0724408_1865_2746 290
153 3300005331 Ga0070670_100118634 Ga0070670_1001186341 291
154 3300005331 Ga0070670_100122417 Ga0070670_1001224173 291
155 3300005334 Ga0068869_100044132 Ga0068869_1000441322 291
156 3300005471 Ga0070698_100008987 Ga0070698_1000089876 291
157 3300005544 Ga0070686_100151811 Ga0070686_1001518112 291
158 3300006844 Ga0075428_100004601 Ga0075428_1000046016 291
159 3300009176 Ga0105242_10470049 Ga0105242_104700491 291
160 3300025942 Ga0207689_10016870 Ga0207689_100168702 291
161 3300049574 Ga0501038_0008547 Ga0501038_0008547_4214_5089 291
162 3300005444 Ga0070694_100245902 Ga0070694_1002459021 292
163 3300005467 Ga0070706_100161801 Ga0070706_1001618012 292
164 3300005518 Ga0070699_100027828 Ga0070699_1000278283 292
165 3300007076 Ga0075435_100001604 Ga0075435_1000016045 292
166 3300013306 Ga0163162_10047668 Ga0163162_100476682 292
167 3300031456 Ga0307513_10062776 Ga0307513_100627763 292
168 3300005329 Ga0070683_100312589 Ga0070683_1003125892 294
169 3300005468 Ga0070707_100107520 Ga0070707_1001075201 294
170 3300025917 Ga0207660_10003042 Ga0207660_100030423 294
171 3300025944 Ga0207661_10205607 Ga0207661_102056072 294
172 3300026116 Ga0207674_10010046 Ga0207674_100100464 296
173 3300044673 Ga0453683_0093232 Ga0453683_0093232_644_1549 298
174 3300005345 Ga0070692_10004944 Ga0070692_100049442 299
175 3300009098 Ga0105245_10000014 Ga0105245_10000014218 301
176 3300025927 Ga0207687_10000010 Ga0207687_10000010266 301
177 3300005334 Ga0068869_100353018 Ga0068869_1003530181 303
178 3300003320 rootH2_10185970 rootH2_101859701 304
179 3300005331 Ga0070670_100117687 Ga0070670_1001176871 304
180 3300014325 Ga0163163_10000183 Ga0163163_100001839 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

49

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8amp-assembly1.cif.gz_A crystal structure of m.tuberculosis ferredoxin fdx 0.8457 27 87
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.8299 102 300
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.8006 118 278
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7995 102 300
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.7942 118 278
ID Description Score Start End Superfamily
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9314 104 295 3.60.15.10
af_Q8RWE1_65_123_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9254 27 89 3.30.70.20
af_Q8RWE1_65_123_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9103 27 89 3.30.70.20
3pniA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9066 27 87 3.30.70.20
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9038 104 295 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7V9R3N3-F1-model_v4 Ferredoxin 0.9951 13 98
AF-A0A1I0AHW6-F1-model_v4 Ferredoxin 0.9951 13 84 GO:0005506
GO:0009055
GO:0051536
AF-A0A7W1JCX9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9911 181 304
AF-A0A845YSI2-F1-model_v4 MBL fold metallo-hydrolase 0.9893 201 303 GO:0016787
AF-A0A838F4U1-F1-model_v4 Ferredoxin 0.9878 13 84

Feature Viewer

pLDDT pTM Quality
93.26 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map