F274459

General Info

Members Datasets Scaffolds Average Seq Length
179 129 358 146

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0064330|Ga0496111_0064330_432_935
Length 167
Sequence LGQEYRLRLFSYDFRGGRMMIAQLITSFIASAAFGVIFNVPKNSLLQCGFVGMLGWILYFFLVENEINSIIATLAAAFTVAVISQYFAKRYKTPITIFNVSGIIPLVPGGLSYDAMKHFVGNDFYVAVQLAAKVFMLAGAIAMGLIFAEVMNQLVTKYNRRKLRLRS

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
11 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
14 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
19 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
20 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
23 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
24 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
25 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
26 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
27 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
28 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
29 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
30 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
31 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
32 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
35 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
36 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
37 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
38 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
39 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
40 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
41 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
42 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
63 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
64 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
65 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
66 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
67 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
68 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
69 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
70 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
71 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
72 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
73 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
74 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
75 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
76 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
77 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
78 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
79 2738541295 Bacillus sp. OK085 Isolate Unclassified
80 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
81 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
82 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
83 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
84 2818991459 Paenibacillus sp. 597 Isolate Unclassified
85 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
86 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
87 2842682962 Bacillus sp. R-72492 Isolate Unclassified
88 2849139964 Bacillus sp. R-71875 Isolate Unclassified
89 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
90 2857581216 Bacillus sp. R-71922 Isolate Unclassified
91 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
92 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
93 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
94 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
95 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
96 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
97 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
98 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
99 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
100 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
101 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
102 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
103 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
104 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
105 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
106 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
107 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
108 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
109 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
110 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
111 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
112 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
113 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
114 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
115 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
116 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
117 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
118 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
119 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
120 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
121 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
122 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
123 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
124 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
125 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
126 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
127 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
128 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
129 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 48.6
Metatranscriptomes 15.08
Isolates 36.31

Biome Distribution

Category Percentage (%)
Aerial Root 1.12
Bulb 0
Endosphere 11.73
Nodule 0
Rhizoplane 2.79
Rhizosphere 50.84
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0064330 3300048914 Bacteria 2660
2 JGI25151J46595_10004164 3300003187 Bacteria 7722
3 JGI25151J46595_10073699 3300003187 Bacteria 1020
4 JGI25151J46595_10077449 3300003187 Bacteria 977
5 Ga0055538_1000517 3300003751 Bacteria 13798
6 Ga0055536_1026980 3300003781 Bacteria 1599
7 Ga0055536_1049813 3300003781 Bacteria 928
8 Ga0055541_1030544 3300003841 Bacteria 534
9 Ga0070710_11273878 3300005437 Unclassified 546
10 Ga0105251_10028404 3300009011 Bacteria 2825
11 Ga0105244_10044579 3300009036 Bacteria 2284
12 Ga0105244_10049722 3300009036 Bacteria 2141
13 Ga0105244_10066540 3300009036 Bacteria 1803
14 Ga0105244_10441303 3300009036 Bacteria 599
15 Ga0105246_10004944 3300011119 Bacteria 8115
16 Ga0157371_10136098 3300013102 Bacteria 1749
17 Ga0157371_10377367 3300013102 Bacteria 1035
18 Ga0209784_100542 3300025224 Bacteria 13823
19 Ga0209784_104059 3300025224 Bacteria 1109
20 Ga0209566_100269 3300025225 Bacteria 48732
21 Ga0209566_100968 3300025225 Bacteria 12718
22 Ga0209437_101393 3300025233 Bacteria 6102
23 Ga0209676_1000833 3300025292 Bacteria 39972
24 Ga0209676_1015381 3300025292 Bacteria 2817
25 Ga0209676_1034238 3300025292 Bacteria 1504
26 Ga0209676_1035865 3300025292 Bacteria 1449
27 Ga0209025_1001415 3300025294 Bacteria 31780
28 Ga0209025_1002248 3300025294 Bacteria 21251
29 Ga0209025_1009359 3300025294 Bacteria 6848
30 Ga0209025_1009921 3300025294 Bacteria 6543
31 Ga0209025_1024457 3300025294 Bacteria 3115
32 Ga0207655_1016019 3300025728 Bacteria 4127
33 Ga0207713_1155265 3300025735 Bacteria 735
34 Ga0209371_1004411 3300027312 Bacteria 6153
35 Ga0268256_1001244 3300030500 Bacteria 15959
36 Ga0307409_100166697 3300031995 Bacteria 1934
37 Ga0307409_100233389 3300031995 Bacteria 1669
38 Ga0307409_101005546 3300031995 Bacteria 852
39 Ga0307409_101194776 3300031995 Bacteria 784
40 Ga0307409_102967008 3300031995 Bacteria 501
41 Ga0307416_100020191 3300032002 Bacteria 4747
42 Ga0307416_100087894 3300032002 Bacteria 2655
43 Ga0307416_101130055 3300032002 Bacteria 888
44 Ga0395899_0026199 3300037312 Bacteria 4400
45 Ga0395899_0207432 3300037312 Bacteria 1363
46 Ga0395899_0373325 3300037312 Bacteria 949
47 Ga0466961_0161456 3300044693 Unclassified 1397
48 Ga0495641_0378270 3300046461 Bacteria 642
49 Ga0495585_0584747 3300046492 Bacteria 526
50 Ga0495622_0025863 3300046557 Bacteria 2742
51 Ga0495661_0100586 3300046665 Bacteria 1628
52 Ga0495670_0105964 3300046691 Bacteria 1452
53 Ga0496108_0596766 3300048911 Bacteria 962
54 Ga0496110_0000723 3300048913 Bacteria 22822
55 Ga0496110_0596116 3300048913 Bacteria 1003
56 Ga0496116_0000384 3300048919 Bacteria 64788
57 Ga0496116_0057766 3300048919 Unclassified 2534
58 Ga0496116_0128115 3300048919 Bacteria 1452
59 Ga0496116_0160961 3300048919 Bacteria 1231
60 Ga0496116_0218738 3300048919 Bacteria 979
61 Ga0496117_0034306 3300048920 Bacteria 3825
62 Ga0496118_0608848 3300048921 Bacteria 521
63 Ga0496119_0005695 3300048922 Bacteria 11817
64 Ga0496119_0155679 3300048922 Unclassified 1220
65 Ga0496120_0004838 3300048923 Bacteria 11019
66 Ga0496120_0056786 3300048923 Unclassified 2207
67 Ga0496121_0198132 3300048924 Bacteria 1434
68 Ga0496121_0317728 3300048924 Bacteria 1050
69 Ga0496121_0427516 3300048924 Bacteria 860
70 Ga0496121_0573360 3300048924 Bacteria 702
71 Ga0496121_0915428 3300048924 Bacteria 503
72 Ga0496122_0027439 3300048925 Unclassified 4867
73 Ga0496122_0045755 3300048925 Bacteria 3397
74 Ga0496122_0075012 3300048925 Bacteria 2389
75 Ga0496122_0359870 3300048925 Bacteria 756
76 Ga0496123_0048570 3300048926 Bacteria 2854
77 Ga0496124_0000183 3300048927 Bacteria 124048
78 Ga0496124_0000215 3300048927 Bacteria 112587
79 Ga0496124_0018110 3300048927 Bacteria 6612
80 Ga0496125_0002678 3300048928 Bacteria 22739
81 Ga0496125_0054744 3300048928 Bacteria 3257
82 Ga0496126_0000281 3300048929 Bacteria 107633
83 Ga0496126_0001740 3300048929 Bacteria 32284
84 Ga0496126_0633280 3300048929 Bacteria 839
85 Ga0501343_003493 3300049132 Bacteria 1157
86 Ga0501343_005739 3300049132 Bacteria 958
87 Ga0501344_00254 3300049133 Bacteria 2042
88 Ga0501311_027827 3300049527 Bacteria 804
89 Ga0501312_039737 3300049528 Bacteria 765
90 Ga0501315_018276 3300049531 Bacteria 923
91 Ga0501316_019442 3300049532 Bacteria 846
92 Ga0501317_007055 3300049533 Bacteria 1256
93 Ga0501318_006985 3300049534 Bacteria 1166
94 Ga0501318_022884 3300049534 Bacteria 804
95 Ga0501321_005207 3300049537 Bacteria 1276
96 Ga0501322_004659 3300049538 Bacteria 930
97 Ga0501323_013963 3300049539 Bacteria 999
98 Ga0501328_02874 3300049544 Bacteria 776
99 Ga0501330_011450 3300049546 Bacteria 639
100 Ga0501332_02904 3300049548 Bacteria 974
101 Ga0501332_04246 3300049548 Unclassified 848
102 Ga0501333_003264 3300049549 Bacteria 984
103 Ga0501334_00995 3300049550 Bacteria 1482
104 Ga0501334_04369 3300049550 Bacteria 906
105 Ga0501335_004355 3300049551 Bacteria 1233
106 Ga0501335_009641 3300049551 Bacteria 923
107 Ga0501336_002757 3300049552 Bacteria 1148
108 Ga0501337_001715 3300049553 Bacteria 1279
109 Ga0501337_003690 3300049553 Bacteria 980
110 Ga0501338_02842 3300049554 Bacteria 1000
111 Ga0501338_03783 3300049554 Bacteria 905
112 Ga0501198_076782 3300049649 Bacteria 640
113 Ga0501202_060048 3300049652 Bacteria 858
114 Ga0501270_066164 3300049767 Unclassified 689
115 2512736878 2512564039 Bacteria 8739048
116 2556064589 2554235469 Bacteria 3590176
117 2571533472 2571042143 Bacteria 6986194
118 2573038038 2571042588 Bacteria 5045676
119 2578336661 2576861424 Bacteria 5270569
120 2580933943 2579778775 Bacteria 5360914
121 2587741283 2585428059 Bacteria 8696589
122 2601638344 2600255286 Bacteria 5390125
123 2621274891 2619619294 Bacteria 5575484
124 2643739507 2643221543 Bacteria 6628015
125 2644422745 2643221676 Bacteria 8119172
126 2672338765 2671180330 Bacteria 5521719
127 2712198916 2711768088 Bacteria 3195027
128 2728532406 2728368933 Bacteria 7044283
129 2738815815 2738541295 Bacteria 5730091
130 2791211722 2788500588 Bacteria 4584915
131 2793183290 2791355222 Bacteria 5898266
132 2816865307 2816332186 Bacteria 5331395
133 2819628627 2818991451 Bacteria 4697364
134 2819668747 2818991459 Bacteria 8736032
135 2821116016 2821111986 Bacteria 6894338
136 2831906384 2831905167 Bacteria 3319172
137 2842687618 2842682962 Bacteria 5589973
138 2849143033 2849139964 Bacteria 5613304
139 2857454152 2857453340 Bacteria 8090534
140 2857583067 2857581216 Bacteria 5522813
141 2864739150 2864733723 Bacteria 6770668
142 2881641144 2881636855 Bacteria 5205297
143 2885530709 2885526491 Bacteria 7164189
144 2889044037 2889042446 Bacteria 7618936
145 2904118514 2904113452 Bacteria 7796941
146 2904166268 2904162308 Bacteria 7086713
147 2904490924 2904490793 Bacteria 7046938
148 2904609056 2904606771 Bacteria 4684500
149 2907203528 2907202186 Bacteria 6632024
150 2919165885 2919160200 Bacteria 6929020
151 2919419506 2919414237 Bacteria 5429133
152 2919426679 2919425241 Bacteria 8055701
153 2929212101 2929206907 Bacteria 5918291
154 2931387493 2931384279 Bacteria 7299545
155 2938653168 2938649242 Bacteria 7118381
156 2939597339 2939593269 Bacteria 4798695
157 2939683737 2939679117 Bacteria 6921672
158 2945993914 2945991243 Bacteria 7008369
159 2946056680 2946053406 Bacteria 6978655
160 2968563421 2968558590 Bacteria 6956864
161 2971405689 2971403814 Bacteria 7370929
162 2971415108 2971410472 Bacteria 8311090
163 2971515677 2971511577 Bacteria 5404012
164 2977259146 2977254563 Bacteria 4828420
165 2980129636 2980125574 Bacteria 5567337
166 2980180163 2980176882 Bacteria 5397533
167 2984528399 2984527788 Bacteria 5288478
168 2984534506 2984532647 Bacteria 5288506
169 2988230812 2988225383 Bacteria 7221625
170 2990280185 2990275345 Bacteria 4887158
171 2996638962 2996632988 Bacteria 6921523
172 3001895626 3001892409 Bacteria 6328293
173 3006830247 3006826541 Bacteria 4678913
174 3006977946 3006973921 Bacteria 4423788
175 8002320657 8002317523 Bacteria 8051857
176 8046996886 8046991243 Bacteria 8497463
177 8054468071 8054465665 Bacteria 7323556
178 8055532304 8055531788 Bacteria 5249694
179 8055638135 8055632911 Bacteria 5283357
180 Ga0496111_0064330
181 JGI25151J46595_10004164
182 JGI25151J46595_10073699
183 JGI25151J46595_10077449
184 Ga0055538_1000517
185 Ga0055536_1026980
186 Ga0055536_1049813
187 Ga0055541_1030544
188 Ga0070710_11273878
189 Ga0105251_10028404
190 Ga0105244_10044579
191 Ga0105244_10049722
192 Ga0105244_10066540
193 Ga0105244_10441303
194 Ga0105246_10004944
195 Ga0157371_10136098
196 Ga0157371_10377367
197 Ga0209784_100542
198 Ga0209784_104059
199 Ga0209566_100269
200 Ga0209566_100968
201 Ga0209437_101393
202 Ga0209676_1000833
203 Ga0209676_1015381
204 Ga0209676_1034238
205 Ga0209676_1035865
206 Ga0209025_1001415
207 Ga0209025_1002248
208 Ga0209025_1009359
209 Ga0209025_1009921
210 Ga0209025_1024457
211 Ga0207655_1016019
212 Ga0207713_1155265
213 Ga0209371_1004411
214 Ga0268256_1001244
215 Ga0307409_100166697
216 Ga0307409_100233389
217 Ga0307409_101005546
218 Ga0307409_101194776
219 Ga0307409_102967008
220 Ga0307416_100020191
221 Ga0307416_100087894
222 Ga0307416_101130055
223 Ga0395899_0026199
224 Ga0395899_0207432
225 Ga0395899_0373325
226 Ga0466961_0161456
227 Ga0495641_0378270
228 Ga0495585_0584747
229 Ga0495622_0025863
230 Ga0495661_0100586
231 Ga0495670_0105964
232 Ga0496108_0596766
233 Ga0496110_0000723
234 Ga0496110_0596116
235 Ga0496116_0000384
236 Ga0496116_0057766
237 Ga0496116_0128115
238 Ga0496116_0160961
239 Ga0496116_0218738
240 Ga0496117_0034306
241 Ga0496118_0608848
242 Ga0496119_0005695
243 Ga0496119_0155679
244 Ga0496120_0004838
245 Ga0496120_0056786
246 Ga0496121_0198132
247 Ga0496121_0317728
248 Ga0496121_0427516
249 Ga0496121_0573360
250 Ga0496121_0915428
251 Ga0496122_0027439
252 Ga0496122_0045755
253 Ga0496122_0075012
254 Ga0496122_0359870
255 Ga0496123_0048570
256 Ga0496124_0000183
257 Ga0496124_0000215
258 Ga0496124_0018110
259 Ga0496125_0002678
260 Ga0496125_0054744
261 Ga0496126_0000281
262 Ga0496126_0001740
263 Ga0496126_0633280
264 Ga0501343_003493
265 Ga0501343_005739
266 Ga0501344_00254
267 Ga0501311_027827
268 Ga0501312_039737
269 Ga0501315_018276
270 Ga0501316_019442
271 Ga0501317_007055
272 Ga0501318_006985
273 Ga0501318_022884
274 Ga0501321_005207
275 Ga0501322_004659
276 Ga0501323_013963
277 Ga0501328_02874
278 Ga0501330_011450
279 Ga0501332_02904
280 Ga0501332_04246
281 Ga0501333_003264
282 Ga0501334_00995
283 Ga0501334_04369
284 Ga0501335_004355
285 Ga0501335_009641
286 Ga0501336_002757
287 Ga0501337_001715
288 Ga0501337_003690
289 Ga0501338_02842
290 Ga0501338_03783
291 Ga0501198_076782
292 Ga0501202_060048
293 Ga0501270_066164
294 2512736878
295 2556064589
296 2571533472
297 2573038038
298 2578336661
299 2580933943
300 2587741283
301 2601638344
302 2621274891
303 2643739507
304 2644422745
305 2672338765
306 2712198916
307 2728532406
308 2738815815
309 2791211722
310 2793183290
311 2816865307
312 2819628627
313 2819668747
314 2821116016
315 2831906384
316 2842687618
317 2849143033
318 2857454152
319 2857583067
320 2864739150
321 2881641144
322 2885530709
323 2889044037
324 2904118514
325 2904166268
326 2904490924
327 2904609056
328 2907203528
329 2919165885
330 2919419506
331 2919426679
332 2929212101
333 2931387493
334 2938653168
335 2939597339
336 2939683737
337 2945993914
338 2946056680
339 2968563421
340 2971405689
341 2971415108
342 2971515677
343 2977259146
344 2980129636
345 2980180163
346 2984528399
347 2984534506
348 2988230812
349 2990280185
350 2996638962
351 3001895626
352 3006830247
353 3006977946
354 8002320657
355 8046996886
356 8054468071
357 8055532304
358 8055638135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12821

ThrE_2

Threonine/Serine exporter, ThrE

23

151

0.98

PF06738

ThrE

Putative threonine/serine exporter

18

151

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fbz-assembly3.cif.gz_C crystal structure of orf140 of the archaeal virus acidianus filamentous virus 1 (afv1) 0.7337 3 89
5mrc-assembly1.cif.gz_R structure of the yeast mitochondrial ribosome - class a 0.7006 32 89
3j9x-assembly1.cif.gz_A a virus that infects a hyperthermophile encapsidates a-form dna 0.6834 4 88
3fbz-assembly3.cif.gz_C crystal structure of orf140 of the archaeal virus acidianus filamentous virus 1 (afv1) 0.5384 3 89
3j6b-assembly1.cif.gz_R structure of the yeast mitochondrial large ribosomal subunit 0.5237 6 89
ID Description Score Start End Superfamily
3fbzD01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7191 10 89 1.20.58.800
3fbzC01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6927 10 89 1.20.58.800
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.673 6 88 1.20.58.800
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5971 6 88 1.20.58.800
3fbzD01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5945 10 89 1.20.58.800
ID Description Score Start End GO Terms
AF-A0A7X8IB04-F1-model_v4 Threonine/serine exporter 0.9773 4 131 GO:0005886
GO:0015744
AF-A0A3D4HWH9-F1-model_v4 Threonine/serine exporter 0.9719 23 134 GO:0005886
GO:0015744
AF-A0A7U9JB17-F1-model_v4 Membrane protein 0.9695 4 130 GO:0005886
GO:0015744
AF-A0A1C5TVI5-F1-model_v4 Uncharacterized conserved protein 0.9689 4 134 GO:0005886
GO:0015744
AF-A0A7X5DFW2-F1-model_v4 Threonine/serine exporter 0.9657 2 134 GO:0005886
GO:0015744

Map