F274452

General Info

Members Datasets Scaffolds Average Seq Length
179 124 358 229

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0004943|Ga0496109_0004943_8028_8714
Length 228
Sequence MSARPLSEILDPGWAKALEPVAPNIAAMGEFLREEKAAGRETLPEGKNVLRAFKQPFDDVKVLIVGQDPYPTKGNAVGLSFSVGPDVPVPRSLVSIYTEYMSDLDFPPPKNGDLTPWTKEGVLLLNRALSVERDKANSHQGKGWEAITEHAVRALAERGAPLVAILWGANARQLKPLLGGAPAIESAHPSPLSAHRGFFGSHPFTRANASLVEQGAEPVNWRLPAQGE

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
43 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
44 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
45 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
46 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
47 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
48 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
49 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
50 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
51 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
52 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
53 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
54 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
57 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
58 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
59 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
60 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
61 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
62 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
63 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
64 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
65 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
66 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
69 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
80 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
81 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
82 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
83 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
84 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
85 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
86 2643221566 Microbacterium sp. Root166 Isolate Unclassified
87 2643221572 Leifsonia sp. Root60 Isolate Unclassified
88 2643221575 Microbacterium sp. Root61 Isolate Unclassified
89 2643221597 Microbacterium sp. Root180 Isolate Unclassified
90 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
91 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
92 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
93 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
94 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
95 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
96 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
97 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
98 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
99 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
100 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
101 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
102 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
103 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
104 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
105 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
106 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
107 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
108 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
109 2919069694 Microbacterium sp. 1154 Isolate Unclassified
110 2919395869 Microbacterium resistens 2980 Isolate Unclassified
111 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
112 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
113 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
114 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
115 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
116 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
117 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
118 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
119 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
120 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
121 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
122 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
123 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
124 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.86
Metatranscriptomes 2.79
Isolates 22.35

Biome Distribution

Category Percentage (%)
Aerial Root 1.12
Bulb 0
Endosphere 9.5
Nodule 0
Rhizoplane 15.08
Rhizosphere 37.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0004943 3300048912 Bacteria 11131
2 JGI24740J21852_10008539 3300001979 Bacteria 4074
3 Ga0006562J51391_1020130 3300003578 Bacteria 8850
4 Ga0070683_100619991 3300005329 Bacteria 1035
5 Ga0070714_100242802 3300005435 Bacteria 1663
6 Ga0070663_100036710 3300005455 Bacteria 3405
7 Ga0070681_10269746 3300005458 Bacteria 1613
8 Ga0070679_100126290 3300005530 Bacteria 2540
9 Ga0070665_100222307 3300005548 Bacteria 1889
10 Ga0068856_100436390 3300005614 Bacteria 1330
11 Ga0075365_10010914 3300006038 Bacteria 5319
12 Ga0075365_10092914 3300006038 Bacteria 2057
13 Ga0075364_10012244 3300006051 Bacteria 5243
14 Ga0075364_10013474 3300006051 Bacteria 5028
15 Ga0075364_10079725 3300006051 Bacteria 2163
16 Ga0075364_10142902 3300006051 Bacteria 1610
17 Ga0075367_10012823 3300006178 Bacteria 4487
18 Ga0105244_10032866 3300009036 Bacteria 2742
19 Ga0105244_10053498 3300009036 Bacteria 2051
20 Ga0105240_10511988 3300009093 Bacteria 1333
21 Ga0105243_10018343 3300009148 Bacteria 5299
22 Ga0105243_10096069 3300009148 Bacteria 2451
23 Ga0105237_10029151 3300009545 Bacteria 5614
24 Ga0157370_10170054 3300013104 Bacteria 2026
25 Ga0171462_1001 3300013250 Bacteria 1135406
26 Ga0163162_10127083 3300013306 Bacteria 2656
27 Ga0157372_10084364 3300013307 Bacteria 3600
28 Ga0157372_10431997 3300013307 Bacteria 1535
29 Ga0206356_10454660 3300020070 Bacteria 1266
30 Ga0206354_10583095 3300020081 Bacteria 1138
31 Ga0206353_10336942 3300020082 Bacteria 1350
32 Ga0224712_10122774 3300022467 Bacteria 1126
33 Ga0207655_1036600 3300025728 Bacteria 2174
34 Ga0207647_10183853 3300025904 Bacteria 1213
35 Ga0207705_10180397 3300025909 Bacteria 1593
36 Ga0207707_10092535 3300025912 Bacteria 2642
37 Ga0207657_10056137 3300025919 Bacteria 3399
38 Ga0207664_10191139 3300025929 Bacteria 1762
39 Ga0207709_10009691 3300025935 Bacteria 5307
40 Ga0207709_10123968 3300025935 Bacteria 1749
41 Ga0207678_10041878 3300026067 Bacteria 3969
42 Ga0307406_10000025 3300031901 Bacteria 92128
43 Ga0307406_10122612 3300031901 Bacteria 1810
44 Ga0307406_10321145 3300031901 Bacteria 1198
45 Ga0307409_100253370 3300031995 Bacteria 1611
46 Ga0307409_100259800 3300031995 Bacteria 1593
47 Ga0307416_100127551 3300032002 Bacteria 2282
48 Ga0373925_0000542 3300037068 Bacteria 37258
49 Ga0439433_0013993 3300041999 Bacteria 1765
50 Ga0466972_0091637 3300044658 Bacteria 1441
51 Ga0466965_0025186 3300044683 Bacteria 2880
52 Ga0466965_0169584 3300044683 Bacteria 1148
53 Ga0466970_0000835 3300044765 Bacteria 14806
54 Ga0466960_0049829 3300044901 Bacteria 2017
55 Ga0451576_0098750 3300045051 Bacteria 3037
56 Ga0495645_0073480 3300046543 Bacteria 2463
57 Ga0495649_0026838 3300046694 Bacteria 3199
58 Ga0496100_0035768 3300048903 Bacteria 3126
59 Ga0496100_0234014 3300048903 Bacteria 1353
60 Ga0496101_0214641 3300048904 Bacteria 1491
61 Ga0496102_0403908 3300048905 Bacteria 1284
62 Ga0496103_0148745 3300048906 Bacteria 1500
63 Ga0496104_0035817 3300048907 Bacteria 4636
64 Ga0496104_0141550 3300048907 Bacteria 2311
65 Ga0496104_0443116 3300048907 Bacteria 1210
66 Ga0496104_0510897 3300048907 Bacteria 1113
67 Ga0496105_0021740 3300048908 Bacteria 5192
68 Ga0496105_0027044 3300048908 Bacteria 4682
69 Ga0496107_0088992 3300048910 Bacteria 2254
70 Ga0496108_0054364 3300048911 Bacteria 3360
71 Ga0496108_0460919 3300048911 Bacteria 1110
72 Ga0496109_0108301 3300048912 Bacteria 2582
73 Ga0496110_0230364 3300048913 Bacteria 1685
74 Ga0496111_0026150 3300048914 Bacteria 4120
75 Ga0496112_0086235 3300048915 Bacteria 3107
76 Ga0496112_0405775 3300048915 Bacteria 1302
77 Ga0496113_0021771 3300048916 Bacteria 4527
78 Ga0496113_0072010 3300048916 Bacteria 2629
79 Ga0496114_0005398 3300048917 Bacteria 9998
80 Ga0496114_0056580 3300048917 Bacteria 3273
81 Ga0496114_0357635 3300048917 Bacteria 1291
82 Ga0496115_0330619 3300048918 Bacteria 1245
83 Ga0496116_0050272 3300048919 Bacteria 2778
84 Ga0496117_0000028 3300048920 Bacteria 407392
85 Ga0496117_0001743 3300048920 Bacteria 30010
86 Ga0496117_0043990 3300048920 Bacteria 3238
87 Ga0496117_0049613 3300048920 Bacteria 2983
88 Ga0496118_0012708 3300048921 Bacteria 8050
89 Ga0496118_0035596 3300048921 Bacteria 4039
90 Ga0496119_0002724 3300048922 Bacteria 19053
91 Ga0496119_0003102 3300048922 Bacteria 17539
92 Ga0496119_0004343 3300048922 Bacteria 14146
93 Ga0496119_0007866 3300048922 Bacteria 9494
94 Ga0496119_0009566 3300048922 Bacteria 8289
95 Ga0496119_0023350 3300048922 Bacteria 4391
96 Ga0496120_0001254 3300048923 Bacteria 31918
97 Ga0496120_0001547 3300048923 Bacteria 26928
98 Ga0496120_0009859 3300048923 Bacteria 6729
99 Ga0496120_0020128 3300048923 Bacteria 4250
100 Ga0496122_0000055 3300048925 Bacteria 258485
101 Ga0496122_0000948 3300048925 Bacteria 52491
102 Ga0496122_0095841 3300048925 Bacteria 2003
103 Ga0496122_0208576 3300048925 Bacteria 1134
104 Ga0496123_0000003 3300048926 Bacteria 866556
105 Ga0496123_0000169 3300048926 Bacteria 130983
106 Ga0496123_0008632 3300048926 Bacteria 9319
107 Ga0496123_0042540 3300048926 Bacteria 3133
108 Ga0496124_0001959 3300048927 Bacteria 28130
109 Ga0496124_0008428 3300048927 Bacteria 10782
110 Ga0496124_0027904 3300048927 Bacteria 5056
111 Ga0496124_0052596 3300048927 Bacteria 3459
112 Ga0496124_0093137 3300048927 Bacteria 2453
113 Ga0496124_0093938 3300048927 Bacteria 2440
114 Ga0496125_0000120 3300048928 Bacteria 175991
115 Ga0496125_0009988 3300048928 Bacteria 9646
116 Ga0496125_0025707 3300048928 Bacteria 5385
117 Ga0496125_0035899 3300048928 Bacteria 4338
118 Ga0496126_0010586 3300048929 Bacteria 9645
119 Ga0496126_0010971 3300048929 Bacteria 9433
120 Ga0496126_0124166 3300048929 Bacteria 2236
121 Ga0496126_0388995 3300048929 Bacteria 1133
122 Ga0501034_0432889 3300049571 Bacteria 1235
123 Ga0501038_0003027 3300049574 Bacteria 15678
124 Ga0501038_0341961 3300049574 Bacteria 1167
125 Ga0501039_0595113 3300049575 Bacteria 867
126 Ga0501043_0191908 3300049579 Bacteria 1588
127 Ga0501070_0002782 3300049586 Bacteria 15266
128 Ga0501074_0056536 3300049590 Bacteria 2828
129 Ga0501080_0151696 3300049742 Bacteria 2141
130 nmdc:mga00v17_50338_c1 3300050491 Bacteria 2530
131 nmdc:mga00v17_98677_c1 3300050491 Bacteria 1842
132 nmdc:mga0yw44_20722_c1 3300050492 Bacteria 3655
133 Ga0500643_000353 3300053087 Bacteria 36455
134 Ga0500556_0000007 3300053104 Bacteria 331400
135 Ga0500556_0001083 3300053104 Bacteria 13734
136 Ga0500593_032406 3300053117 Bacteria 2339
137 Ga0500621_087541 3300053126 Bacteria 1242
138 Ga0500559_0000643 3300053136 Bacteria 23541
139 Ga0500568_0000021 3300053139 Bacteria 185406
140 2588106715 2585428157 Bacteria 3018951
141 2643849402 2643221566 Bacteria 3460379
142 2643874698 2643221572 Bacteria 3614809
143 2643888559 2643221575 Bacteria 4022601
144 2643996417 2643221597 Bacteria 3347721
145 2644381754 2643221669 Bacteria 3611286
146 2758224406 2757320536 Bacteria 3629334
147 2774378494 2773857758 Bacteria 3592392
148 2774400222 2773857763 Bacteria 4180068
149 2793983695 2791355406 Bacteria 11364898
150 2808631717 2808606306 Bacteria 3608896
151 2808885070 2808606368 Bacteria 3174172
152 2812322470 2811994872 Bacteria 4121241
153 2821269391 2821268502 Bacteria 3750023
154 2833710298 2833709550 Bacteria 4008291
155 2837186486 2837183177 Bacteria 4637169
156 2852633074 2852632344 Bacteria 3463163
157 2857721066 2857720070 Bacteria 3189373
158 2865000983 2864997549 Bacteria 5139696
159 2865003519 2865002811 Bacteria 6333767
160 2870629759 2870628048 Bacteria 3696012
161 2895662929 2895660088 Bacteria 3782833
162 2904509993 2904509784 Bacteria 3520416
163 2908678794 2908678064 Bacteria 3482747
164 2919071146 2919069694 Bacteria 3622919
165 2919396865 2919395869 Bacteria 3704152
166 2928091218 2928090899 Bacteria 3158267
167 2974298028 2974294766 Bacteria 3767688
168 2974325734 2974324384 Bacteria 3750535
169 2977230690 2977228692 Bacteria 3450105
170 2977265921 2977264416 Bacteria 3750737
171 2984546240 2984542743 Bacteria 3569378
172 2984582031 2984580707 Bacteria 3351387
173 3006394423 3006393351 Bacteria 6615579
174 8016254680 8016254467 Bacteria 3797036
175 8045832694 8045830549 Bacteria 4444727
176 8047900994 8047893842 Bacteria 11723082
177 8048357908 8048356638 Bacteria 11044339
178 8048377935 8048369669 Bacteria 11666822
179 8048387033 8048379754 Bacteria 11877923
180 Ga0496109_0004943
181 JGI24740J21852_10008539
182 Ga0006562J51391_1020130
183 Ga0070683_100619991
184 Ga0070714_100242802
185 Ga0070663_100036710
186 Ga0070681_10269746
187 Ga0070679_100126290
188 Ga0070665_100222307
189 Ga0068856_100436390
190 Ga0075365_10010914
191 Ga0075365_10092914
192 Ga0075364_10012244
193 Ga0075364_10013474
194 Ga0075364_10079725
195 Ga0075364_10142902
196 Ga0075367_10012823
197 Ga0105244_10032866
198 Ga0105244_10053498
199 Ga0105240_10511988
200 Ga0105243_10018343
201 Ga0105243_10096069
202 Ga0105237_10029151
203 Ga0157370_10170054
204 Ga0171462_1001
205 Ga0163162_10127083
206 Ga0157372_10084364
207 Ga0157372_10431997
208 Ga0206356_10454660
209 Ga0206354_10583095
210 Ga0206353_10336942
211 Ga0224712_10122774
212 Ga0207655_1036600
213 Ga0207647_10183853
214 Ga0207705_10180397
215 Ga0207707_10092535
216 Ga0207657_10056137
217 Ga0207664_10191139
218 Ga0207709_10009691
219 Ga0207709_10123968
220 Ga0207678_10041878
221 Ga0307406_10000025
222 Ga0307406_10122612
223 Ga0307406_10321145
224 Ga0307409_100253370
225 Ga0307409_100259800
226 Ga0307416_100127551
227 Ga0373925_0000542
228 Ga0439433_0013993
229 Ga0466972_0091637
230 Ga0466965_0025186
231 Ga0466965_0169584
232 Ga0466970_0000835
233 Ga0466960_0049829
234 Ga0451576_0098750
235 Ga0495645_0073480
236 Ga0495649_0026838
237 Ga0496100_0035768
238 Ga0496100_0234014
239 Ga0496101_0214641
240 Ga0496102_0403908
241 Ga0496103_0148745
242 Ga0496104_0035817
243 Ga0496104_0141550
244 Ga0496104_0443116
245 Ga0496104_0510897
246 Ga0496105_0021740
247 Ga0496105_0027044
248 Ga0496107_0088992
249 Ga0496108_0054364
250 Ga0496108_0460919
251 Ga0496109_0108301
252 Ga0496110_0230364
253 Ga0496111_0026150
254 Ga0496112_0086235
255 Ga0496112_0405775
256 Ga0496113_0021771
257 Ga0496113_0072010
258 Ga0496114_0005398
259 Ga0496114_0056580
260 Ga0496114_0357635
261 Ga0496115_0330619
262 Ga0496116_0050272
263 Ga0496117_0000028
264 Ga0496117_0001743
265 Ga0496117_0043990
266 Ga0496117_0049613
267 Ga0496118_0012708
268 Ga0496118_0035596
269 Ga0496119_0002724
270 Ga0496119_0003102
271 Ga0496119_0004343
272 Ga0496119_0007866
273 Ga0496119_0009566
274 Ga0496119_0023350
275 Ga0496120_0001254
276 Ga0496120_0001547
277 Ga0496120_0009859
278 Ga0496120_0020128
279 Ga0496122_0000055
280 Ga0496122_0000948
281 Ga0496122_0095841
282 Ga0496122_0208576
283 Ga0496123_0000003
284 Ga0496123_0000169
285 Ga0496123_0008632
286 Ga0496123_0042540
287 Ga0496124_0001959
288 Ga0496124_0008428
289 Ga0496124_0027904
290 Ga0496124_0052596
291 Ga0496124_0093137
292 Ga0496124_0093938
293 Ga0496125_0000120
294 Ga0496125_0009988
295 Ga0496125_0025707
296 Ga0496125_0035899
297 Ga0496126_0010586
298 Ga0496126_0010971
299 Ga0496126_0124166
300 Ga0496126_0388995
301 Ga0501034_0432889
302 Ga0501038_0003027
303 Ga0501038_0341961
304 Ga0501039_0595113
305 Ga0501043_0191908
306 Ga0501070_0002782
307 Ga0501074_0056536
308 Ga0501080_0151696
309 nmdc:mga00v17_50338_c1
310 nmdc:mga00v17_98677_c1
311 nmdc:mga0yw44_20722_c1
312 Ga0500643_000353
313 Ga0500556_0000007
314 Ga0500556_0001083
315 Ga0500593_032406
316 Ga0500621_087541
317 Ga0500559_0000643
318 Ga0500568_0000021
319 2588106715
320 2643849402
321 2643874698
322 2643888559
323 2643996417
324 2644381754
325 2758224406
326 2774378494
327 2774400222
328 2793983695
329 2808631717
330 2808885070
331 2812322470
332 2821269391
333 2833710298
334 2837186486
335 2852633074
336 2857721066
337 2865000983
338 2865003519
339 2870629759
340 2895662929
341 2904509993
342 2908678794
343 2919071146
344 2919396865
345 2928091218
346 2974298028
347 2974325734
348 2977230690
349 2977265921
350 2984546240
351 2984582031
352 3006394423
353 8016254680
354 8045832694
355 8047900994
356 8048357908
357 8048377935
358 8048387033

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

53

212

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i6d-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi 0.967 13 229
3tr7-assembly1.cif.gz_A structure of a uracil-dna glycosylase (ung) from coxiella burnetii 0.9492 27 229
5eug-assembly1.cif.gz_A crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex 0.9445 27 229
3ufm-assembly1.cif.gz_A co-crystal structure of deinococcus radiodurans uracil-dna glycosylase and the c-terminus of the single-stranded dna-binding protein 0.9431 13 229
8i6d-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi 0.9415 13 229
ID Description Score Start End Superfamily
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9367 3 229 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9348 13 229 3.40.470.10
3a7nA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9248 3 229 3.40.470.10
af_Q1ZXM2_175_429_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9146 4 228 3.40.470.10
1okbB00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9067 13 229 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7D8AME6-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9894 1 229 GO:0004844
GO:0005737
GO:0097510
AF-A0A2V1HSJ8-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9876 1 229 GO:0004844
GO:0005737
GO:0097510
AF-A0A2V5JMK5-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9854 13 229 GO:0004844
GO:0005737
GO:0097510
AF-A0A7D8AME6-F1-model_v4 Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) 0.9851 1 229 GO:0004844
GO:0005737
GO:0097510
AF-A0A2W5C585-F1-model_v4 deleted 0.9844 1 228

Map