F274452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 124 | 358 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0004943|Ga0496109_0004943_8028_8714 |
| Length | 228 |
| Sequence | MSARPLSEILDPGWAKALEPVAPNIAAMGEFLREEKAAGRETLPEGKNVLRAFKQPFDDVKVLIVGQDPYPTKGNAVGLSFSVGPDVPVPRSLVSIYTEYMSDLDFPPPKNGDLTPWTKEGVLLLNRALSVERDKANSHQGKGWEAITEHAVRALAERGAPLVAILWGANARQLKPLLGGAPAIESAHPSPLSAHRGFFGSHPFTRANASLVEQGAEPVNWRLPAQGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 11 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 12 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 13 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 14 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 20 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 23 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 24 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 25 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 26 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 35 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 36 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 37 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 38 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 39 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 40 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 41 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 42 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 43 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 44 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 47 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 48 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 49 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 50 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 51 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 52 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 53 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 54 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 55 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 56 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 57 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 58 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 59 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 60 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 61 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 62 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 63 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 64 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 65 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 66 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 67 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 68 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 69 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 70 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 71 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 72 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 73 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 74 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 75 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 78 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 79 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 80 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 81 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 82 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 83 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 84 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 85 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 86 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 87 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 88 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 89 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 90 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 91 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 92 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 93 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 94 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 95 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 96 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 97 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 98 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 99 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 100 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 101 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 102 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 103 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 104 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 105 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 106 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 107 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 108 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 109 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 110 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 111 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 112 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 113 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 114 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 115 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 116 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 117 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 118 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 119 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 120 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 121 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 122 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 123 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 124 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.86 |
| Metatranscriptomes | 2.79 |
| Isolates | 22.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.12 |
| Bulb | 0 |
| Endosphere | 9.5 |
| Nodule | 0 |
| Rhizoplane | 15.08 |
| Rhizosphere | 37.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496109_0004943 | 3300048912 | Bacteria | 11131 |
| 2 | JGI24740J21852_10008539 | 3300001979 | Bacteria | 4074 |
| 3 | Ga0006562J51391_1020130 | 3300003578 | Bacteria | 8850 |
| 4 | Ga0070683_100619991 | 3300005329 | Bacteria | 1035 |
| 5 | Ga0070714_100242802 | 3300005435 | Bacteria | 1663 |
| 6 | Ga0070663_100036710 | 3300005455 | Bacteria | 3405 |
| 7 | Ga0070681_10269746 | 3300005458 | Bacteria | 1613 |
| 8 | Ga0070679_100126290 | 3300005530 | Bacteria | 2540 |
| 9 | Ga0070665_100222307 | 3300005548 | Bacteria | 1889 |
| 10 | Ga0068856_100436390 | 3300005614 | Bacteria | 1330 |
| 11 | Ga0075365_10010914 | 3300006038 | Bacteria | 5319 |
| 12 | Ga0075365_10092914 | 3300006038 | Bacteria | 2057 |
| 13 | Ga0075364_10012244 | 3300006051 | Bacteria | 5243 |
| 14 | Ga0075364_10013474 | 3300006051 | Bacteria | 5028 |
| 15 | Ga0075364_10079725 | 3300006051 | Bacteria | 2163 |
| 16 | Ga0075364_10142902 | 3300006051 | Bacteria | 1610 |
| 17 | Ga0075367_10012823 | 3300006178 | Bacteria | 4487 |
| 18 | Ga0105244_10032866 | 3300009036 | Bacteria | 2742 |
| 19 | Ga0105244_10053498 | 3300009036 | Bacteria | 2051 |
| 20 | Ga0105240_10511988 | 3300009093 | Bacteria | 1333 |
| 21 | Ga0105243_10018343 | 3300009148 | Bacteria | 5299 |
| 22 | Ga0105243_10096069 | 3300009148 | Bacteria | 2451 |
| 23 | Ga0105237_10029151 | 3300009545 | Bacteria | 5614 |
| 24 | Ga0157370_10170054 | 3300013104 | Bacteria | 2026 |
| 25 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 26 | Ga0163162_10127083 | 3300013306 | Bacteria | 2656 |
| 27 | Ga0157372_10084364 | 3300013307 | Bacteria | 3600 |
| 28 | Ga0157372_10431997 | 3300013307 | Bacteria | 1535 |
| 29 | Ga0206356_10454660 | 3300020070 | Bacteria | 1266 |
| 30 | Ga0206354_10583095 | 3300020081 | Bacteria | 1138 |
| 31 | Ga0206353_10336942 | 3300020082 | Bacteria | 1350 |
| 32 | Ga0224712_10122774 | 3300022467 | Bacteria | 1126 |
| 33 | Ga0207655_1036600 | 3300025728 | Bacteria | 2174 |
| 34 | Ga0207647_10183853 | 3300025904 | Bacteria | 1213 |
| 35 | Ga0207705_10180397 | 3300025909 | Bacteria | 1593 |
| 36 | Ga0207707_10092535 | 3300025912 | Bacteria | 2642 |
| 37 | Ga0207657_10056137 | 3300025919 | Bacteria | 3399 |
| 38 | Ga0207664_10191139 | 3300025929 | Bacteria | 1762 |
| 39 | Ga0207709_10009691 | 3300025935 | Bacteria | 5307 |
| 40 | Ga0207709_10123968 | 3300025935 | Bacteria | 1749 |
| 41 | Ga0207678_10041878 | 3300026067 | Bacteria | 3969 |
| 42 | Ga0307406_10000025 | 3300031901 | Bacteria | 92128 |
| 43 | Ga0307406_10122612 | 3300031901 | Bacteria | 1810 |
| 44 | Ga0307406_10321145 | 3300031901 | Bacteria | 1198 |
| 45 | Ga0307409_100253370 | 3300031995 | Bacteria | 1611 |
| 46 | Ga0307409_100259800 | 3300031995 | Bacteria | 1593 |
| 47 | Ga0307416_100127551 | 3300032002 | Bacteria | 2282 |
| 48 | Ga0373925_0000542 | 3300037068 | Bacteria | 37258 |
| 49 | Ga0439433_0013993 | 3300041999 | Bacteria | 1765 |
| 50 | Ga0466972_0091637 | 3300044658 | Bacteria | 1441 |
| 51 | Ga0466965_0025186 | 3300044683 | Bacteria | 2880 |
| 52 | Ga0466965_0169584 | 3300044683 | Bacteria | 1148 |
| 53 | Ga0466970_0000835 | 3300044765 | Bacteria | 14806 |
| 54 | Ga0466960_0049829 | 3300044901 | Bacteria | 2017 |
| 55 | Ga0451576_0098750 | 3300045051 | Bacteria | 3037 |
| 56 | Ga0495645_0073480 | 3300046543 | Bacteria | 2463 |
| 57 | Ga0495649_0026838 | 3300046694 | Bacteria | 3199 |
| 58 | Ga0496100_0035768 | 3300048903 | Bacteria | 3126 |
| 59 | Ga0496100_0234014 | 3300048903 | Bacteria | 1353 |
| 60 | Ga0496101_0214641 | 3300048904 | Bacteria | 1491 |
| 61 | Ga0496102_0403908 | 3300048905 | Bacteria | 1284 |
| 62 | Ga0496103_0148745 | 3300048906 | Bacteria | 1500 |
| 63 | Ga0496104_0035817 | 3300048907 | Bacteria | 4636 |
| 64 | Ga0496104_0141550 | 3300048907 | Bacteria | 2311 |
| 65 | Ga0496104_0443116 | 3300048907 | Bacteria | 1210 |
| 66 | Ga0496104_0510897 | 3300048907 | Bacteria | 1113 |
| 67 | Ga0496105_0021740 | 3300048908 | Bacteria | 5192 |
| 68 | Ga0496105_0027044 | 3300048908 | Bacteria | 4682 |
| 69 | Ga0496107_0088992 | 3300048910 | Bacteria | 2254 |
| 70 | Ga0496108_0054364 | 3300048911 | Bacteria | 3360 |
| 71 | Ga0496108_0460919 | 3300048911 | Bacteria | 1110 |
| 72 | Ga0496109_0108301 | 3300048912 | Bacteria | 2582 |
| 73 | Ga0496110_0230364 | 3300048913 | Bacteria | 1685 |
| 74 | Ga0496111_0026150 | 3300048914 | Bacteria | 4120 |
| 75 | Ga0496112_0086235 | 3300048915 | Bacteria | 3107 |
| 76 | Ga0496112_0405775 | 3300048915 | Bacteria | 1302 |
| 77 | Ga0496113_0021771 | 3300048916 | Bacteria | 4527 |
| 78 | Ga0496113_0072010 | 3300048916 | Bacteria | 2629 |
| 79 | Ga0496114_0005398 | 3300048917 | Bacteria | 9998 |
| 80 | Ga0496114_0056580 | 3300048917 | Bacteria | 3273 |
| 81 | Ga0496114_0357635 | 3300048917 | Bacteria | 1291 |
| 82 | Ga0496115_0330619 | 3300048918 | Bacteria | 1245 |
| 83 | Ga0496116_0050272 | 3300048919 | Bacteria | 2778 |
| 84 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 85 | Ga0496117_0001743 | 3300048920 | Bacteria | 30010 |
| 86 | Ga0496117_0043990 | 3300048920 | Bacteria | 3238 |
| 87 | Ga0496117_0049613 | 3300048920 | Bacteria | 2983 |
| 88 | Ga0496118_0012708 | 3300048921 | Bacteria | 8050 |
| 89 | Ga0496118_0035596 | 3300048921 | Bacteria | 4039 |
| 90 | Ga0496119_0002724 | 3300048922 | Bacteria | 19053 |
| 91 | Ga0496119_0003102 | 3300048922 | Bacteria | 17539 |
| 92 | Ga0496119_0004343 | 3300048922 | Bacteria | 14146 |
| 93 | Ga0496119_0007866 | 3300048922 | Bacteria | 9494 |
| 94 | Ga0496119_0009566 | 3300048922 | Bacteria | 8289 |
| 95 | Ga0496119_0023350 | 3300048922 | Bacteria | 4391 |
| 96 | Ga0496120_0001254 | 3300048923 | Bacteria | 31918 |
| 97 | Ga0496120_0001547 | 3300048923 | Bacteria | 26928 |
| 98 | Ga0496120_0009859 | 3300048923 | Bacteria | 6729 |
| 99 | Ga0496120_0020128 | 3300048923 | Bacteria | 4250 |
| 100 | Ga0496122_0000055 | 3300048925 | Bacteria | 258485 |
| 101 | Ga0496122_0000948 | 3300048925 | Bacteria | 52491 |
| 102 | Ga0496122_0095841 | 3300048925 | Bacteria | 2003 |
| 103 | Ga0496122_0208576 | 3300048925 | Bacteria | 1134 |
| 104 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 105 | Ga0496123_0000169 | 3300048926 | Bacteria | 130983 |
| 106 | Ga0496123_0008632 | 3300048926 | Bacteria | 9319 |
| 107 | Ga0496123_0042540 | 3300048926 | Bacteria | 3133 |
| 108 | Ga0496124_0001959 | 3300048927 | Bacteria | 28130 |
| 109 | Ga0496124_0008428 | 3300048927 | Bacteria | 10782 |
| 110 | Ga0496124_0027904 | 3300048927 | Bacteria | 5056 |
| 111 | Ga0496124_0052596 | 3300048927 | Bacteria | 3459 |
| 112 | Ga0496124_0093137 | 3300048927 | Bacteria | 2453 |
| 113 | Ga0496124_0093938 | 3300048927 | Bacteria | 2440 |
| 114 | Ga0496125_0000120 | 3300048928 | Bacteria | 175991 |
| 115 | Ga0496125_0009988 | 3300048928 | Bacteria | 9646 |
| 116 | Ga0496125_0025707 | 3300048928 | Bacteria | 5385 |
| 117 | Ga0496125_0035899 | 3300048928 | Bacteria | 4338 |
| 118 | Ga0496126_0010586 | 3300048929 | Bacteria | 9645 |
| 119 | Ga0496126_0010971 | 3300048929 | Bacteria | 9433 |
| 120 | Ga0496126_0124166 | 3300048929 | Bacteria | 2236 |
| 121 | Ga0496126_0388995 | 3300048929 | Bacteria | 1133 |
| 122 | Ga0501034_0432889 | 3300049571 | Bacteria | 1235 |
| 123 | Ga0501038_0003027 | 3300049574 | Bacteria | 15678 |
| 124 | Ga0501038_0341961 | 3300049574 | Bacteria | 1167 |
| 125 | Ga0501039_0595113 | 3300049575 | Bacteria | 867 |
| 126 | Ga0501043_0191908 | 3300049579 | Bacteria | 1588 |
| 127 | Ga0501070_0002782 | 3300049586 | Bacteria | 15266 |
| 128 | Ga0501074_0056536 | 3300049590 | Bacteria | 2828 |
| 129 | Ga0501080_0151696 | 3300049742 | Bacteria | 2141 |
| 130 | nmdc:mga00v17_50338_c1 | 3300050491 | Bacteria | 2530 |
| 131 | nmdc:mga00v17_98677_c1 | 3300050491 | Bacteria | 1842 |
| 132 | nmdc:mga0yw44_20722_c1 | 3300050492 | Bacteria | 3655 |
| 133 | Ga0500643_000353 | 3300053087 | Bacteria | 36455 |
| 134 | Ga0500556_0000007 | 3300053104 | Bacteria | 331400 |
| 135 | Ga0500556_0001083 | 3300053104 | Bacteria | 13734 |
| 136 | Ga0500593_032406 | 3300053117 | Bacteria | 2339 |
| 137 | Ga0500621_087541 | 3300053126 | Bacteria | 1242 |
| 138 | Ga0500559_0000643 | 3300053136 | Bacteria | 23541 |
| 139 | Ga0500568_0000021 | 3300053139 | Bacteria | 185406 |
| 140 | 2588106715 | 2585428157 | Bacteria | 3018951 |
| 141 | 2643849402 | 2643221566 | Bacteria | 3460379 |
| 142 | 2643874698 | 2643221572 | Bacteria | 3614809 |
| 143 | 2643888559 | 2643221575 | Bacteria | 4022601 |
| 144 | 2643996417 | 2643221597 | Bacteria | 3347721 |
| 145 | 2644381754 | 2643221669 | Bacteria | 3611286 |
| 146 | 2758224406 | 2757320536 | Bacteria | 3629334 |
| 147 | 2774378494 | 2773857758 | Bacteria | 3592392 |
| 148 | 2774400222 | 2773857763 | Bacteria | 4180068 |
| 149 | 2793983695 | 2791355406 | Bacteria | 11364898 |
| 150 | 2808631717 | 2808606306 | Bacteria | 3608896 |
| 151 | 2808885070 | 2808606368 | Bacteria | 3174172 |
| 152 | 2812322470 | 2811994872 | Bacteria | 4121241 |
| 153 | 2821269391 | 2821268502 | Bacteria | 3750023 |
| 154 | 2833710298 | 2833709550 | Bacteria | 4008291 |
| 155 | 2837186486 | 2837183177 | Bacteria | 4637169 |
| 156 | 2852633074 | 2852632344 | Bacteria | 3463163 |
| 157 | 2857721066 | 2857720070 | Bacteria | 3189373 |
| 158 | 2865000983 | 2864997549 | Bacteria | 5139696 |
| 159 | 2865003519 | 2865002811 | Bacteria | 6333767 |
| 160 | 2870629759 | 2870628048 | Bacteria | 3696012 |
| 161 | 2895662929 | 2895660088 | Bacteria | 3782833 |
| 162 | 2904509993 | 2904509784 | Bacteria | 3520416 |
| 163 | 2908678794 | 2908678064 | Bacteria | 3482747 |
| 164 | 2919071146 | 2919069694 | Bacteria | 3622919 |
| 165 | 2919396865 | 2919395869 | Bacteria | 3704152 |
| 166 | 2928091218 | 2928090899 | Bacteria | 3158267 |
| 167 | 2974298028 | 2974294766 | Bacteria | 3767688 |
| 168 | 2974325734 | 2974324384 | Bacteria | 3750535 |
| 169 | 2977230690 | 2977228692 | Bacteria | 3450105 |
| 170 | 2977265921 | 2977264416 | Bacteria | 3750737 |
| 171 | 2984546240 | 2984542743 | Bacteria | 3569378 |
| 172 | 2984582031 | 2984580707 | Bacteria | 3351387 |
| 173 | 3006394423 | 3006393351 | Bacteria | 6615579 |
| 174 | 8016254680 | 8016254467 | Bacteria | 3797036 |
| 175 | 8045832694 | 8045830549 | Bacteria | 4444727 |
| 176 | 8047900994 | 8047893842 | Bacteria | 11723082 |
| 177 | 8048357908 | 8048356638 | Bacteria | 11044339 |
| 178 | 8048377935 | 8048369669 | Bacteria | 11666822 |
| 179 | 8048387033 | 8048379754 | Bacteria | 11877923 |
| 180 | Ga0496109_0004943 | |||
| 181 | JGI24740J21852_10008539 | |||
| 182 | Ga0006562J51391_1020130 | |||
| 183 | Ga0070683_100619991 | |||
| 184 | Ga0070714_100242802 | |||
| 185 | Ga0070663_100036710 | |||
| 186 | Ga0070681_10269746 | |||
| 187 | Ga0070679_100126290 | |||
| 188 | Ga0070665_100222307 | |||
| 189 | Ga0068856_100436390 | |||
| 190 | Ga0075365_10010914 | |||
| 191 | Ga0075365_10092914 | |||
| 192 | Ga0075364_10012244 | |||
| 193 | Ga0075364_10013474 | |||
| 194 | Ga0075364_10079725 | |||
| 195 | Ga0075364_10142902 | |||
| 196 | Ga0075367_10012823 | |||
| 197 | Ga0105244_10032866 | |||
| 198 | Ga0105244_10053498 | |||
| 199 | Ga0105240_10511988 | |||
| 200 | Ga0105243_10018343 | |||
| 201 | Ga0105243_10096069 | |||
| 202 | Ga0105237_10029151 | |||
| 203 | Ga0157370_10170054 | |||
| 204 | Ga0171462_1001 | |||
| 205 | Ga0163162_10127083 | |||
| 206 | Ga0157372_10084364 | |||
| 207 | Ga0157372_10431997 | |||
| 208 | Ga0206356_10454660 | |||
| 209 | Ga0206354_10583095 | |||
| 210 | Ga0206353_10336942 | |||
| 211 | Ga0224712_10122774 | |||
| 212 | Ga0207655_1036600 | |||
| 213 | Ga0207647_10183853 | |||
| 214 | Ga0207705_10180397 | |||
| 215 | Ga0207707_10092535 | |||
| 216 | Ga0207657_10056137 | |||
| 217 | Ga0207664_10191139 | |||
| 218 | Ga0207709_10009691 | |||
| 219 | Ga0207709_10123968 | |||
| 220 | Ga0207678_10041878 | |||
| 221 | Ga0307406_10000025 | |||
| 222 | Ga0307406_10122612 | |||
| 223 | Ga0307406_10321145 | |||
| 224 | Ga0307409_100253370 | |||
| 225 | Ga0307409_100259800 | |||
| 226 | Ga0307416_100127551 | |||
| 227 | Ga0373925_0000542 | |||
| 228 | Ga0439433_0013993 | |||
| 229 | Ga0466972_0091637 | |||
| 230 | Ga0466965_0025186 | |||
| 231 | Ga0466965_0169584 | |||
| 232 | Ga0466970_0000835 | |||
| 233 | Ga0466960_0049829 | |||
| 234 | Ga0451576_0098750 | |||
| 235 | Ga0495645_0073480 | |||
| 236 | Ga0495649_0026838 | |||
| 237 | Ga0496100_0035768 | |||
| 238 | Ga0496100_0234014 | |||
| 239 | Ga0496101_0214641 | |||
| 240 | Ga0496102_0403908 | |||
| 241 | Ga0496103_0148745 | |||
| 242 | Ga0496104_0035817 | |||
| 243 | Ga0496104_0141550 | |||
| 244 | Ga0496104_0443116 | |||
| 245 | Ga0496104_0510897 | |||
| 246 | Ga0496105_0021740 | |||
| 247 | Ga0496105_0027044 | |||
| 248 | Ga0496107_0088992 | |||
| 249 | Ga0496108_0054364 | |||
| 250 | Ga0496108_0460919 | |||
| 251 | Ga0496109_0108301 | |||
| 252 | Ga0496110_0230364 | |||
| 253 | Ga0496111_0026150 | |||
| 254 | Ga0496112_0086235 | |||
| 255 | Ga0496112_0405775 | |||
| 256 | Ga0496113_0021771 | |||
| 257 | Ga0496113_0072010 | |||
| 258 | Ga0496114_0005398 | |||
| 259 | Ga0496114_0056580 | |||
| 260 | Ga0496114_0357635 | |||
| 261 | Ga0496115_0330619 | |||
| 262 | Ga0496116_0050272 | |||
| 263 | Ga0496117_0000028 | |||
| 264 | Ga0496117_0001743 | |||
| 265 | Ga0496117_0043990 | |||
| 266 | Ga0496117_0049613 | |||
| 267 | Ga0496118_0012708 | |||
| 268 | Ga0496118_0035596 | |||
| 269 | Ga0496119_0002724 | |||
| 270 | Ga0496119_0003102 | |||
| 271 | Ga0496119_0004343 | |||
| 272 | Ga0496119_0007866 | |||
| 273 | Ga0496119_0009566 | |||
| 274 | Ga0496119_0023350 | |||
| 275 | Ga0496120_0001254 | |||
| 276 | Ga0496120_0001547 | |||
| 277 | Ga0496120_0009859 | |||
| 278 | Ga0496120_0020128 | |||
| 279 | Ga0496122_0000055 | |||
| 280 | Ga0496122_0000948 | |||
| 281 | Ga0496122_0095841 | |||
| 282 | Ga0496122_0208576 | |||
| 283 | Ga0496123_0000003 | |||
| 284 | Ga0496123_0000169 | |||
| 285 | Ga0496123_0008632 | |||
| 286 | Ga0496123_0042540 | |||
| 287 | Ga0496124_0001959 | |||
| 288 | Ga0496124_0008428 | |||
| 289 | Ga0496124_0027904 | |||
| 290 | Ga0496124_0052596 | |||
| 291 | Ga0496124_0093137 | |||
| 292 | Ga0496124_0093938 | |||
| 293 | Ga0496125_0000120 | |||
| 294 | Ga0496125_0009988 | |||
| 295 | Ga0496125_0025707 | |||
| 296 | Ga0496125_0035899 | |||
| 297 | Ga0496126_0010586 | |||
| 298 | Ga0496126_0010971 | |||
| 299 | Ga0496126_0124166 | |||
| 300 | Ga0496126_0388995 | |||
| 301 | Ga0501034_0432889 | |||
| 302 | Ga0501038_0003027 | |||
| 303 | Ga0501038_0341961 | |||
| 304 | Ga0501039_0595113 | |||
| 305 | Ga0501043_0191908 | |||
| 306 | Ga0501070_0002782 | |||
| 307 | Ga0501074_0056536 | |||
| 308 | Ga0501080_0151696 | |||
| 309 | nmdc:mga00v17_50338_c1 | |||
| 310 | nmdc:mga00v17_98677_c1 | |||
| 311 | nmdc:mga0yw44_20722_c1 | |||
| 312 | Ga0500643_000353 | |||
| 313 | Ga0500556_0000007 | |||
| 314 | Ga0500556_0001083 | |||
| 315 | Ga0500593_032406 | |||
| 316 | Ga0500621_087541 | |||
| 317 | Ga0500559_0000643 | |||
| 318 | Ga0500568_0000021 | |||
| 319 | 2588106715 | |||
| 320 | 2643849402 | |||
| 321 | 2643874698 | |||
| 322 | 2643888559 | |||
| 323 | 2643996417 | |||
| 324 | 2644381754 | |||
| 325 | 2758224406 | |||
| 326 | 2774378494 | |||
| 327 | 2774400222 | |||
| 328 | 2793983695 | |||
| 329 | 2808631717 | |||
| 330 | 2808885070 | |||
| 331 | 2812322470 | |||
| 332 | 2821269391 | |||
| 333 | 2833710298 | |||
| 334 | 2837186486 | |||
| 335 | 2852633074 | |||
| 336 | 2857721066 | |||
| 337 | 2865000983 | |||
| 338 | 2865003519 | |||
| 339 | 2870629759 | |||
| 340 | 2895662929 | |||
| 341 | 2904509993 | |||
| 342 | 2908678794 | |||
| 343 | 2919071146 | |||
| 344 | 2919396865 | |||
| 345 | 2928091218 | |||
| 346 | 2974298028 | |||
| 347 | 2974325734 | |||
| 348 | 2977230690 | |||
| 349 | 2977265921 | |||
| 350 | 2984546240 | |||
| 351 | 2984582031 | |||
| 352 | 3006394423 | |||
| 353 | 8016254680 | |||
| 354 | 8045832694 | |||
| 355 | 8047900994 | |||
| 356 | 8048357908 | |||
| 357 | 8048377935 | |||
| 358 | 8048387033 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8i6d-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi | 0.967 | 13 | 229 |
| 3tr7-assembly1.cif.gz_A | structure of a uracil-dna glycosylase (ung) from coxiella burnetii | 0.9492 | 27 | 229 |
| 5eug-assembly1.cif.gz_A | crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex | 0.9445 | 27 | 229 |
| 3ufm-assembly1.cif.gz_A | co-crystal structure of deinococcus radiodurans uracil-dna glycosylase and the c-terminus of the single-stranded dna-binding protein | 0.9431 | 13 | 229 |
| 8i6d-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis uracil-dna glycosylase in complex with 5-hydroxy-2,4(1h,3h)-pyrimidinedione, form vi | 0.9415 | 13 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3a7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9367 | 3 | 229 | 3.40.470.10 |
| 1okbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9348 | 13 | 229 | 3.40.470.10 |
| 3a7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9248 | 3 | 229 | 3.40.470.10 |
| af_Q1ZXM2_175_429_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9146 | 4 | 228 | 3.40.470.10 |
| 1okbB00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9067 | 13 | 229 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7D8AME6-F1-model_v4 | Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) | 0.9894 | 1 | 229 |
GO:0004844
GO:0005737 GO:0097510 |
| AF-A0A2V1HSJ8-F1-model_v4 | Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) | 0.9876 | 1 | 229 |
GO:0004844
GO:0005737 GO:0097510 |
| AF-A0A2V5JMK5-F1-model_v4 | Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) | 0.9854 | 13 | 229 |
GO:0004844
GO:0005737 GO:0097510 |
| AF-A0A7D8AME6-F1-model_v4 | Uracil-DNA glycosylase (UDG) (EC 3.2.2.27) | 0.9851 | 1 | 229 |
GO:0004844
GO:0005737 GO:0097510 |
| AF-A0A2W5C585-F1-model_v4 | deleted | 0.9844 | 1 | 228 |
|