F273891

General Info

Members Datasets Scaffolds Average Seq Length
179 93 358 82

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10186434|Ga0213876_101864342
Length 97
Sequence MTTVVIFGREGCCLCDQARAVLERVRATYPFKLEQRDIERDEELLRAYLERIPVVTIDGEEAFELFVDEAQLKVWLGGRVQGAAGASADDSQAGALK

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
27 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
44 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
73 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
93 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.5
Rhizosphere 78.77
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10186434 3300021384 Bacteria 1103
2 Ga0070683_102108135 3300005329 Bacteria 542
3 Ga0070714_100502889 3300005435 Bacteria 1156
4 Ga0070714_102382101 3300005435 Bacteria 514
5 Ga0070710_10731493 3300005437 Bacteria 701
6 Ga0070662_101767130 3300005457 Bacteria 534
7 Ga0070681_10311398 3300005458 Bacteria 1484
8 Ga0070679_100608517 3300005530 Bacteria 1036
9 Ga0070684_100616090 3300005535 Bacteria 1010
10 Ga0070696_101230122 3300005546 Bacteria 634
11 Ga0070664_102073499 3300005564 Bacteria 540
12 Ga0068856_100513404 3300005614 Bacteria 1219
13 Ga0068852_101893805 3300005616 Bacteria 619
14 Ga0068859_101363687 3300005617 Bacteria 782
15 Ga0081455_10040377 3300005937 Bacteria 4115
16 Ga0070717_10003068 3300006028 Bacteria 11906
17 Ga0070717_10180495 3300006028 Bacteria 1840
18 Ga0097620_101363306 3300006931 Bacteria 782
19 Ga0105240_12362843 3300009093 Bacteria 550
20 Ga0105245_13152541 3300009098 Bacteria 511
21 Ga0105241_11461150 3300009174 Bacteria 657
22 Ga0105248_13291247 3300009177 Bacteria 514
23 Ga0105239_11943155 3300010375 Bacteria 683
24 Ga0157369_11294076 3300013105 Bacteria 743
25 Ga0157378_13137971 3300013297 Bacteria 513
26 Ga0157372_10835225 3300013307 Bacteria 1070
27 Ga0163163_12591856 3300014325 Bacteria 565
28 Ga0213873_10197400 3300021358 Bacteria 623
29 Ga0213874_10000786 3300021377 Bacteria 6438
30 Ga0213874_10001218 3300021377 Bacteria 5284
31 Ga0213876_10195741 3300021384 Bacteria 1074
32 Ga0213875_10093116 3300021388 Bacteria 1405
33 Ga0213875_10448047 3300021388 Bacteria 618
34 Ga0207692_10591285 3300025898 Bacteria 713
35 Ga0207642_11070515 3300025899 Bacteria 521
36 Ga0207663_11732687 3300025916 Bacteria 503
37 Ga0207657_11453702 3300025919 Bacteria 513
38 Ga0207664_10046353 3300025929 Bacteria 3412
39 Ga0207664_11941389 3300025929 Unclassified 511
40 Ga0207665_11018291 3300025939 Bacteria 659
41 Ga0207711_12046183 3300025941 Bacteria 515
42 Ga0207661_10832072 3300025944 Bacteria 850
43 Ga0207658_11769769 3300025986 Bacteria 564
44 Ga0207702_11300474 3300026078 Bacteria 721
45 Ga0207698_10985830 3300026142 Bacteria 853
46 Ga0265319_1001805 3300028563 Bacteria 12239
47 Ga0265319_1023191 3300028563 Bacteria 2251
48 Ga0265338_10035939 3300028800 Bacteria 4751
49 Ga0265320_10010021 3300031240 Bacteria 5667
50 Ga0265320_10080902 3300031240 Bacteria 1517
51 Ga0265329_10284359 3300031242 Bacteria 557
52 Ga0265313_10084083 3300031595 Bacteria 1440
53 Ga0265313_10110973 3300031595 Bacteria 1206
54 Ga0265314_10487515 3300031711 Bacteria 651
55 Ga0265342_10223255 3300031712 Bacteria 1014
56 Ga0307406_10580079 3300031901 Bacteria 922
57 Ga0307407_10680927 3300031903 Bacteria 773
58 Ga0307415_100324498 3300032126 Bacteria 1285
59 Ga0395898_1797453 3300037466 Bacteria 534
60 Ga0436364_0164894 3300037853 Bacteria 1137
61 Ga0436364_0331749 3300037853 Bacteria 8159
62 Ga0436364_0589366 3300037853 Bacteria 1621
63 Ga0436364_0705467 3300037853 Bacteria 5245
64 Ga0436364_1262480 3300037853 Bacteria 600
65 Ga0436364_1415383 3300037853 Bacteria 4997
66 Ga0436365_0222289 3300039437 Bacteria 2729
67 Ga0436365_0386564 3300039437 Bacteria 1610
68 Ga0436365_0832005 3300039437 Bacteria 4050
69 Ga0436365_1142944 3300039437 Bacteria 8296
70 Ga0436363_0063969 3300039450 Bacteria 1247
71 Ga0436363_0426840 3300039450 Bacteria 14866
72 Ga0436363_0528901 3300039450 Bacteria 2112
73 Ga0436363_0604623 3300039450 Bacteria 742
74 Ga0436363_0841097 3300039450 Bacteria 564
75 Ga0436362_0487656 3300039453 Bacteria 1320
76 Ga0436362_0489496 3300039453 Bacteria 1247
77 Ga0436362_0556148 3300039453 Bacteria 1405
78 Ga0436362_0850863 3300039453 Bacteria 694
79 Ga0436362_0955395 3300039453 Bacteria 1468
80 Ga0439458_0101347 3300042157 Bacteria 748
81 Ga0439459_0156221 3300042438 Bacteria 599
82 Ga0466969_0014257 3300044656 Bacteria 4178
83 Ga0466969_0271505 3300044656 Bacteria 768
84 Ga0466969_0525825 3300044656 Bacteria 541
85 Ga0466969_0555194 3300044656 Bacteria 526
86 Ga0466965_0095480 3300044683 Bacteria 1516
87 Ga0466965_0118431 3300044683 Bacteria 1366
88 Ga0466965_0181429 3300044683 Bacteria 1111
89 Ga0466965_0233796 3300044683 Bacteria 982
90 Ga0466965_0465405 3300044683 Bacteria 705
91 Ga0466966_0028826 3300044684 Bacteria 3614
92 Ga0466966_0189517 3300044684 Bacteria 1246
93 Ga0466961_0008682 3300044693 Bacteria 6477
94 Ga0466961_0014558 3300044693 Bacteria 5053
95 Ga0466963_0012988 3300044694 Bacteria 5105
96 Ga0466963_0090760 3300044694 Bacteria 2080
97 Ga0466963_0097973 3300044694 Bacteria 2004
98 Ga0466963_0192898 3300044694 Bacteria 1423
99 Ga0466963_0760868 3300044694 Bacteria 683
100 Ga0466964_0043889 3300044706 Bacteria 1815
101 Ga0466964_0217108 3300044706 Bacteria 927
102 Ga0466971_0000920 3300044719 Bacteria 12081
103 Ga0466971_0105784 3300044719 Bacteria 1296
104 Ga0466971_0360466 3300044719 Bacteria 705
105 Ga0466971_0407479 3300044719 Bacteria 663
106 Ga0466971_0564924 3300044719 Bacteria 565
107 Ga0466968_0022435 3300044735 Bacteria 2566
108 Ga0466968_0053611 3300044735 Bacteria 1728
109 Ga0466968_0060391 3300044735 Bacteria 1634
110 Ga0466968_0092058 3300044735 Bacteria 1345
111 Ga0466968_0602089 3300044735 Unclassified 555
112 Ga0466968_0725044 3300044735 Bacteria 509
113 Ga0466970_0087750 3300044765 Bacteria 1687
114 Ga0466970_0317662 3300044765 Bacteria 880
115 Ga0466970_0499648 3300044765 Unclassified 700
116 Ga0466970_0542107 3300044765 Unclassified 672
117 Ga0466957_0011593 3300044842 Bacteria 5094
118 Ga0466957_0129554 3300044842 Bacteria 1615
119 Ga0466957_0243998 3300044842 Bacteria 1193
120 Ga0466957_0315963 3300044842 Bacteria 1053
121 Ga0466957_0760625 3300044842 Bacteria 687
122 Ga0466957_1104070 3300044842 Bacteria 572
123 Ga0466959_0003891 3300045049 Bacteria 9908
124 Ga0466959_0031637 3300045049 Bacteria 3915
125 Ga0466959_0038816 3300045049 Bacteria 3518
126 Ga0466959_0089692 3300045049 Bacteria 2209
127 Ga0466959_0092073 3300045049 Bacteria 2177
128 Ga0466959_0134796 3300045049 Bacteria 1749
129 Ga0466959_0170626 3300045049 Bacteria 1526
130 Ga0466959_0234867 3300045049 Bacteria 1268
131 Ga0466959_0364568 3300045049 Bacteria 984
132 Ga0466959_0661510 3300045049 Bacteria 701
133 Ga0466959_0932043 3300045049 Bacteria 579
134 Ga0466958_0000502 3300045836 Bacteria 16435
135 Ga0466958_0003412 3300045836 Bacteria 8247
136 Ga0466958_0035165 3300045836 Bacteria 2993
137 Ga0466958_0037832 3300045836 Bacteria 2893
138 Ga0466958_0038115 3300045836 Bacteria 2883
139 Ga0466958_0082121 3300045836 Bacteria 1984
140 Ga0466958_0330033 3300045836 Bacteria 981
141 Ga0466958_0422052 3300045836 Bacteria 862
142 Ga0466958_0438915 3300045836 Bacteria 845
143 Ga0466958_0518738 3300045836 Bacteria 773
144 Ga0466958_0726373 3300045836 Bacteria 647
145 Ga0466967_0025758 3300045976 Bacteria 4854
146 Ga0466967_0056737 3300045976 Bacteria 3455
147 Ga0466967_0216750 3300045976 Bacteria 1817
148 Ga0466967_0613357 3300045976 Bacteria 1074
149 Ga0466967_1015917 3300045976 Bacteria 826
150 Ga0495584_0087520 3300046491 Bacteria 1570
151 Ga0495585_0256226 3300046492 Bacteria 872
152 Ga0495620_0135778 3300046515 Bacteria 964
153 Ga0495628_1247679 3300046516 Bacteria 503
154 Ga0495656_0661029 3300046615 Bacteria 561
155 Ga0495671_0285328 3300046692 Bacteria 795
156 Ga0496100_0000375 3300048903 Bacteria 21768
157 Ga0496100_0809729 3300048903 Bacteria 734
158 Ga0496101_0001428 3300048904 Bacteria 14270
159 Ga0496101_0206626 3300048904 Bacteria 1520
160 Ga0496102_0098758 3300048905 Bacteria 2709
161 Ga0496104_0101454 3300048907 Bacteria 2755
162 Ga0496105_0354409 3300048908 Bacteria 1171
163 Ga0496106_0052555 3300048909 Bacteria 3074
164 Ga0496107_0038416 3300048910 Bacteria 3434
165 Ga0496108_0000926 3300048911 Bacteria 22877
166 Ga0496109_0001485 3300048912 Bacteria 19475
167 Ga0496110_0057401 3300048913 Bacteria 3426
168 Ga0496111_0007804 3300048914 Bacteria 7046
169 Ga0496112_0140328 3300048915 Bacteria 2386
170 Ga0496112_0209115 3300048915 Bacteria 1909
171 Ga0496113_0022995 3300048916 Bacteria 4417
172 Ga0496113_0075168 3300048916 Bacteria 2578
173 Ga0501048_1299558 3300049582 Bacteria 523
174 Ga0501067_0425333 3300049583 Bacteria 741
175 nmdc:mga06r32_1152709_c1 3300050510 Bacteria 723
176 Ga0495619_0347799 3300053085 Bacteria 1026
177 Ga0466962_0018590 3300061719 Bacteria 3343
178 Ga0466962_0391498 3300061719 Bacteria 695
179 Ga0466962_0429634 3300061719 Bacteria 664
180 Ga0213876_10186434
181 Ga0070683_102108135
182 Ga0070714_100502889
183 Ga0070714_102382101
184 Ga0070710_10731493
185 Ga0070662_101767130
186 Ga0070681_10311398
187 Ga0070679_100608517
188 Ga0070684_100616090
189 Ga0070696_101230122
190 Ga0070664_102073499
191 Ga0068856_100513404
192 Ga0068852_101893805
193 Ga0068859_101363687
194 Ga0081455_10040377
195 Ga0070717_10003068
196 Ga0070717_10180495
197 Ga0097620_101363306
198 Ga0105240_12362843
199 Ga0105245_13152541
200 Ga0105241_11461150
201 Ga0105248_13291247
202 Ga0105239_11943155
203 Ga0157369_11294076
204 Ga0157378_13137971
205 Ga0157372_10835225
206 Ga0163163_12591856
207 Ga0213873_10197400
208 Ga0213874_10000786
209 Ga0213874_10001218
210 Ga0213876_10195741
211 Ga0213875_10093116
212 Ga0213875_10448047
213 Ga0207692_10591285
214 Ga0207642_11070515
215 Ga0207663_11732687
216 Ga0207657_11453702
217 Ga0207664_10046353
218 Ga0207664_11941389
219 Ga0207665_11018291
220 Ga0207711_12046183
221 Ga0207661_10832072
222 Ga0207658_11769769
223 Ga0207702_11300474
224 Ga0207698_10985830
225 Ga0265319_1001805
226 Ga0265319_1023191
227 Ga0265338_10035939
228 Ga0265320_10010021
229 Ga0265320_10080902
230 Ga0265329_10284359
231 Ga0265313_10084083
232 Ga0265313_10110973
233 Ga0265314_10487515
234 Ga0265342_10223255
235 Ga0307406_10580079
236 Ga0307407_10680927
237 Ga0307415_100324498
238 Ga0395898_1797453
239 Ga0436364_0164894
240 Ga0436364_0331749
241 Ga0436364_0589366
242 Ga0436364_0705467
243 Ga0436364_1262480
244 Ga0436364_1415383
245 Ga0436365_0222289
246 Ga0436365_0386564
247 Ga0436365_0832005
248 Ga0436365_1142944
249 Ga0436363_0063969
250 Ga0436363_0426840
251 Ga0436363_0528901
252 Ga0436363_0604623
253 Ga0436363_0841097
254 Ga0436362_0487656
255 Ga0436362_0489496
256 Ga0436362_0556148
257 Ga0436362_0850863
258 Ga0436362_0955395
259 Ga0439458_0101347
260 Ga0439459_0156221
261 Ga0466969_0014257
262 Ga0466969_0271505
263 Ga0466969_0525825
264 Ga0466969_0555194
265 Ga0466965_0095480
266 Ga0466965_0118431
267 Ga0466965_0181429
268 Ga0466965_0233796
269 Ga0466965_0465405
270 Ga0466966_0028826
271 Ga0466966_0189517
272 Ga0466961_0008682
273 Ga0466961_0014558
274 Ga0466963_0012988
275 Ga0466963_0090760
276 Ga0466963_0097973
277 Ga0466963_0192898
278 Ga0466963_0760868
279 Ga0466964_0043889
280 Ga0466964_0217108
281 Ga0466971_0000920
282 Ga0466971_0105784
283 Ga0466971_0360466
284 Ga0466971_0407479
285 Ga0466971_0564924
286 Ga0466968_0022435
287 Ga0466968_0053611
288 Ga0466968_0060391
289 Ga0466968_0092058
290 Ga0466968_0602089
291 Ga0466968_0725044
292 Ga0466970_0087750
293 Ga0466970_0317662
294 Ga0466970_0499648
295 Ga0466970_0542107
296 Ga0466957_0011593
297 Ga0466957_0129554
298 Ga0466957_0243998
299 Ga0466957_0315963
300 Ga0466957_0760625
301 Ga0466957_1104070
302 Ga0466959_0003891
303 Ga0466959_0031637
304 Ga0466959_0038816
305 Ga0466959_0089692
306 Ga0466959_0092073
307 Ga0466959_0134796
308 Ga0466959_0170626
309 Ga0466959_0234867
310 Ga0466959_0364568
311 Ga0466959_0661510
312 Ga0466959_0932043
313 Ga0466958_0000502
314 Ga0466958_0003412
315 Ga0466958_0035165
316 Ga0466958_0037832
317 Ga0466958_0038115
318 Ga0466958_0082121
319 Ga0466958_0330033
320 Ga0466958_0422052
321 Ga0466958_0438915
322 Ga0466958_0518738
323 Ga0466958_0726373
324 Ga0466967_0025758
325 Ga0466967_0056737
326 Ga0466967_0216750
327 Ga0466967_0613357
328 Ga0466967_1015917
329 Ga0495584_0087520
330 Ga0495585_0256226
331 Ga0495620_0135778
332 Ga0495628_1247679
333 Ga0495656_0661029
334 Ga0495671_0285328
335 Ga0496100_0000375
336 Ga0496100_0809729
337 Ga0496101_0001428
338 Ga0496101_0206626
339 Ga0496102_0098758
340 Ga0496104_0101454
341 Ga0496105_0354409
342 Ga0496106_0052555
343 Ga0496107_0038416
344 Ga0496108_0000926
345 Ga0496109_0001485
346 Ga0496110_0057401
347 Ga0496111_0007804
348 Ga0496112_0140328
349 Ga0496112_0209115
350 Ga0496113_0022995
351 Ga0496113_0075168
352 Ga0501048_1299558
353 Ga0501067_0425333
354 nmdc:mga06r32_1152709_c1
355 Ga0495619_0347799
356 Ga0466962_0018590
357 Ga0466962_0391498
358 Ga0466962_0429634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05768

Glrx-like

Glutaredoxin-like domain (DUF836)

3

77

0.98

PF00462

Glutaredoxin

Glutaredoxin

4

62

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wjk-assembly1.cif.gz_A solution structure of hypothetical protein c330018d20rik from mus musculus 0.9063 2 72
1ttz-assembly1.cif.gz_A x-ray structure of northeast structural genomics target protein xcr50 from x. campestris 0.8707 2 73
2m46-assembly1.cif.gz_A solution nmr structure of sacol0876 from staphylococcus aureus col, nesg target zr353 and csgid target idp00841 0.8648 3 33
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8402 2 60
7zzn-assembly1.cif.gz_A-2 crystal structure of poplar glutathione transferase u20 0.8399 2 70
ID Description Score Start End Superfamily
af_Q9CWB7_29_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9041 2 72 3.40.30.10
af_Q54N68_13_94_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8983 2 72 3.40.30.10
1ttzA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8707 2 73 3.40.30.10
2m46A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8648 3 33 3.40.30.10
af_H2FLI1_195_263_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8458 1 57 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538CJC1-F1-model_v4 Glutaredoxin family protein 1.005 6 70
AF-A0A6J4RVP4-F1-model_v4 Glutaredoxin-like domain-containing protein PA3033 0.9882 1 75
AF-A0A6J5Z6Q7-F1-model_v4 Unannotated protein 0.9813 2 75
AF-A0A537X541-F1-model_v4 Glutaredoxin family protein 0.9797 2 69
AF-A0A222SH52-F1-model_v4 Thioredoxin family protein 0.9784 2 71

Map