F273877

General Info

Members Datasets Scaffolds Average Seq Length
179 105 358 280

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10011097|Ga0182007_100110975
Length 304
Sequence MSKEYLAVGIFSIELKNGILARMDIYAIRKRQLIKLIGNQKKGACAERWGMAPAHLSQILSDKTAKNLGDDVARRIELVEKLPRGWFDSLPVDEESASPDQAEINAAPVSESNSSAADQVKRMLAKVQGLSLEARDRIVAAAEEPDDGVPHQLSGSLASLRPTNEEIVIPQYDIRAAMGHGQVPPDYTEVVRNLVVREEILREKGVTYTSKTSLGMINGWGQSMEGTINDKDLVIVDKGVRDFIGEGIYVLTWHNELYIKRVMRLDEDHYRLISDNPHYENQTARIDDVTIHAKVLLIWNARKA

Samples

Sample ID Description Type Environment
1 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
18 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
24 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
31 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
43 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
44 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
45 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
46 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
49 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
50 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
51 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
52 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
55 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
56 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
57 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
61 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
62 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
65 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
73 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
76 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
77 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
93 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
94 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
95 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
96 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
97 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
98 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
99 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
100 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
101 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
102 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
103 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
104 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
105 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.18
Metatranscriptomes 0
Isolates 7.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.26
Nodule 0
Rhizoplane 5.03
Rhizosphere 75.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182007_10011097 3300015262 Bacteria 3520
2 SwRhRL2b_contig_278822 2162886007 Bacteria 1031
3 JGI25155J39150_1002046 3300002704 Bacteria 1167
4 Ga0055539_1000138 3300003752 Bacteria 75896
5 Ga0055533_1000142 3300003756 Bacteria 75896
6 Ga0055532_1000152 3300003758 Bacteria 61495
7 Ga0055525_1000546 3300003759 Bacteria 17546
8 Ga0055535_1005009 3300003761 Bacteria 3029
9 Ga0055541_1000091 3300003841 Bacteria 75896
10 Ga0065704_10079061 3300005289 Bacteria 4266
11 Ga0070670_100000149 3300005331 Bacteria 64139
12 Ga0068853_100115360 3300005539 Bacteria 2390
13 Ga0105251_10000601 3300009011 Bacteria 33006
14 Ga0105251_10016975 3300009011 Bacteria 3912
15 Ga0105251_10022597 3300009011 Bacteria 3262
16 Ga0105251_10067633 3300009011 Bacteria 1668
17 Ga0105244_10010642 3300009036 Bacteria 5564
18 Ga0105250_10000152 3300009092 Bacteria 59872
19 Ga0105246_10001772 3300011119 Bacteria 12922
20 Ga0157373_10002273 3300013100 Bacteria 14560
21 Ga0157370_10053558 3300013104 Bacteria 3847
22 Ga0163162_10002134 3300013306 Bacteria 18556
23 Ga0182008_10012432 3300014497 Bacteria 4493
24 Ga0182007_10000115 3300015262 Bacteria 54892
25 Ga0182007_10001993 3300015262 Bacteria 10530
26 Ga0182005_1001608 3300015265 Bacteria 8853
27 Ga0163161_10008747 3300017792 Bacteria 6997
28 Ga0163161_10049004 3300017792 Bacteria 3052
29 Ga0209435_100180 3300025206 Bacteria 18929
30 Ga0209784_100128 3300025224 Bacteria 76497
31 Ga0209566_100157 3300025225 Bacteria 76430
32 Ga0209674_100180 3300025226 Bacteria 76497
33 Ga0209147_100183 3300025229 Bacteria 75926
34 Ga0209563_100144 3300025230 Bacteria 76497
35 Ga0209258_100310 3300025242 Bacteria 76430
36 Ga0209646_1000402 3300025246 Bacteria 25607
37 Ga0209677_100127 3300025253 Bacteria 76548
38 Ga0209759_1005660 3300025256 Bacteria 4319
39 Ga0207696_1000090 3300025711 Bacteria 188474
40 Ga0207655_1007822 3300025728 Bacteria 6882
41 Ga0207655_1009091 3300025728 Bacteria 6216
42 Ga0207655_1019896 3300025728 Bacteria 3480
43 Ga0207713_1000483 3300025735 Bacteria 41307
44 Ga0207713_1008077 3300025735 Bacteria 6103
45 Ga0207650_10000549 3300025925 Bacteria 30465
46 Ga0207639_10033478 3300026041 Bacteria 3792
47 Ga0307509_10138995 3300031507 Bacteria 2369
48 Ga0307408_100017843 3300031548 Bacteria 4755
49 Ga0307412_10001606 3300031911 Bacteria 12458
50 Ga0307414_10000559 3300032004 Bacteria 19428
51 Ga0307414_10111431 3300032004 Bacteria 2084
52 Ga0439466_0000041 3300041411 Bacteria 50608
53 Ga0439466_0008106 3300041411 Bacteria 3960
54 Ga0439432_001385 3300042006 Bacteria 9175
55 Ga0439452_000954 3300042010 Bacteria 12983
56 Ga0495617_000540 3300046452 Bacteria 19610
57 Ga0495617_033163 3300046452 Bacteria 1733
58 Ga0495591_000058 3300046458 Bacteria 130659
59 Ga0495591_001577 3300046458 Bacteria 13867
60 Ga0495638_0000372 3300046460 Bacteria 55671
61 Ga0495638_0205434 3300046460 Bacteria 1109
62 Ga0495653_0000170 3300046463 Bacteria 53800
63 Ga0495650_0000596 3300046471 Bacteria 49833
64 Ga0495605_0014449 3300046474 Bacteria 4325
65 Ga0495584_0012484 3300046491 Bacteria 4336
66 Ga0495585_0000044 3300046492 Bacteria 123462
67 Ga0495585_0000137 3300046492 Bacteria 79585
68 Ga0495594_0000138 3300046499 Bacteria 34577
69 Ga0495596_0000010 3300046500 Bacteria 145028
70 Ga0495607_0000054 3300046501 Bacteria 116402
71 Ga0495607_0000670 3300046501 Bacteria 33214
72 Ga0495607_0002044 3300046501 Bacteria 16904
73 Ga0495607_0002394 3300046501 Bacteria 15297
74 Ga0495583_0000695 3300046506 Bacteria 43437
75 Ga0495583_0004045 3300046506 Bacteria 10785
76 Ga0495606_0002985 3300046507 Bacteria 18594
77 Ga0495606_0004076 3300046507 Bacteria 14859
78 Ga0495606_0005521 3300046507 Bacteria 12075
79 Ga0495610_0000714 3300046512 Bacteria 31603
80 Ga0495610_0002609 3300046512 Bacteria 14927
81 Ga0495610_0009789 3300046512 Bacteria 6019
82 Ga0495610_0047365 3300046512 Bacteria 2115
83 Ga0495610_0051175 3300046512 Bacteria 2012
84 Ga0495616_0001829 3300046513 Bacteria 14412
85 Ga0495616_0002883 3300046513 Bacteria 11224
86 Ga0495616_0015703 3300046513 Bacteria 4205
87 Ga0495620_0000004 3300046515 Bacteria 344148
88 Ga0495632_0000841 3300046519 Bacteria 27046
89 Ga0495632_0024279 3300046519 Bacteria 3223
90 Ga0495632_0026850 3300046519 Bacteria 3024
91 Ga0495637_0000224 3300046520 Bacteria 43789
92 Ga0495637_0000241 3300046520 Bacteria 42667
93 Ga0495637_0001646 3300046520 Bacteria 12915
94 Ga0495643_0008637 3300046522 Bacteria 6428
95 Ga0495643_0109190 3300046522 Bacteria 1408
96 Ga0495644_0037308 3300046523 Bacteria 1834
97 Ga0495648_0000479 3300046524 Bacteria 42927
98 Ga0495648_0003049 3300046524 Bacteria 14990
99 Ga0495648_0010065 3300046524 Bacteria 7245
100 Ga0495648_0121276 3300046524 Bacteria 1405
101 Ga0495654_0000105 3300046530 Bacteria 95038
102 Ga0495654_0000221 3300046530 Bacteria 53356
103 Ga0495654_0000290 3300046530 Bacteria 45364
104 Ga0495654_0001783 3300046530 Bacteria 14351
105 Ga0495654_0007802 3300046530 Bacteria 5951
106 Ga0495609_0014614 3300046538 Bacteria 3687
107 Ga0495609_0054782 3300046538 Bacteria 1770
108 Ga0495597_0000020 3300046542 Bacteria 161793
109 Ga0495597_0000382 3300046542 Bacteria 38423
110 Ga0495597_0000646 3300046542 Bacteria 28282
111 Ga0495597_0009423 3300046542 Bacteria 4824
112 Ga0495668_0000238 3300046616 Bacteria 78527
113 Ga0495611_0007274 3300046648 Bacteria 4703
114 Ga0495611_0037146 3300046648 Bacteria 2164
115 Ga0495611_0038507 3300046648 Bacteria 2127
116 Ga0495625_0005386 3300046660 Bacteria 11702
117 Ga0495625_0021758 3300046660 Bacteria 4929
118 Ga0495625_0029912 3300046660 Bacteria 4067
119 Ga0495659_0031894 3300046664 Bacteria 1841
120 Ga0495661_0000163 3300046665 Bacteria 78896
121 Ga0495670_0000093 3300046691 Bacteria 39095
122 Ga0495670_0002881 3300046691 Bacteria 8479
123 Ga0495670_0004946 3300046691 Bacteria 6546
124 Ga0495670_0063678 3300046691 Bacteria 1857
125 Ga0495670_0085570 3300046691 Bacteria 1609
126 Ga0495671_0004297 3300046692 Bacteria 8561
127 Ga0495649_0000036 3300046694 Bacteria 134537
128 Ga0495649_0002221 3300046694 Bacteria 13833
129 Ga0495660_0000161 3300046810 Bacteria 72505
130 Ga0495660_0000927 3300046810 Bacteria 21608
131 Ga0495660_0002400 3300046810 Bacteria 11961
132 Ga0495660_0019283 3300046810 Bacteria 3916
133 Ga0495660_0024169 3300046810 Bacteria 3462
134 Ga0495660_0027664 3300046810 Bacteria 3207
135 Ga0495672_0000271 3300047320 Bacteria 71554
136 Ga0495680_0032281 3300047322 Bacteria 4252
137 Ga0495683_0000065 3300047323 Bacteria 112239
138 Ga0495673_0010587 3300047469 Bacteria 5005
139 Ga0495673_0047705 3300047469 Bacteria 1891
140 Ga0495681_0000283 3300047470 Bacteria 40484
141 Ga0495681_0000956 3300047470 Bacteria 22180
142 Ga0495681_0001564 3300047470 Bacteria 17056
143 Ga0495681_0001823 3300047470 Bacteria 15666
144 Ga0495681_0007426 3300047470 Bacteria 7006
145 Ga0495681_0009292 3300047470 Bacteria 6071
146 Ga0495626_0000208 3300048091 Bacteria 70166
147 Ga0495626_0000369 3300048091 Bacteria 47042
148 Ga0495626_0004881 3300048091 Bacteria 8067
149 Ga0496110_0374672 3300048913 Bacteria 1297
150 Ga0496117_0000924 3300048920 Bacteria 44955
151 Ga0496117_0001123 3300048920 Bacteria 40309
152 Ga0496117_0005830 3300048920 Bacteria 12760
153 Ga0496118_0000965 3300048921 Bacteria 44933
154 Ga0496118_0006020 3300048921 Bacteria 13512
155 Ga0496122_0000175 3300048925 Bacteria 153295
156 Ga0496122_0000696 3300048925 Bacteria 66890
157 Ga0496122_0002173 3300048925 Bacteria 28733
158 Ga0496123_0000079 3300048926 Bacteria 191201
159 Ga0496123_0000886 3300048926 Bacteria 47379
160 Ga0496123_0001235 3300048926 Bacteria 37166
161 Ga0496124_0000031 3300048927 Bacteria 344232
162 Ga0496125_0000284 3300048928 Bacteria 100114
163 Ga0496125_0055749 3300048928 Bacteria 3216
164 Ga0495678_017162 3300049459 Bacteria 3288
165 Ga0495678_048182 3300049459 Bacteria 1663
166 2599357675 2599185160 Bacteria 6844013
167 2599382609 2599185164 Bacteria 6841688
168 2599389056 2599185165 Bacteria 6843250
169 2599463836 2599185181 Bacteria 6844519
170 2599492856 2599185186 Bacteria 6831633
171 2600216975 2599185356 Bacteria 6843884
172 2601690236 2600255296 Bacteria 5784754
173 2601777147 2600255313 Bacteria 6842543
174 2644621824 2643221713 Bacteria 6554480
175 2852613204 2852612431 Bacteria 6885235
176 2852669061 2852667396 Bacteria 6885555
177 2919159151 2919155634 Bacteria 4860545
178 2939656938 2939651529 Bacteria 5895393
179 3007873519 3007872151 Bacteria 5268868
180 Ga0182007_10011097
181 SwRhRL2b_contig_278822
182 JGI25155J39150_1002046
183 Ga0055539_1000138
184 Ga0055533_1000142
185 Ga0055532_1000152
186 Ga0055525_1000546
187 Ga0055535_1005009
188 Ga0055541_1000091
189 Ga0065704_10079061
190 Ga0070670_100000149
191 Ga0068853_100115360
192 Ga0105251_10000601
193 Ga0105251_10016975
194 Ga0105251_10022597
195 Ga0105251_10067633
196 Ga0105244_10010642
197 Ga0105250_10000152
198 Ga0105246_10001772
199 Ga0157373_10002273
200 Ga0157370_10053558
201 Ga0163162_10002134
202 Ga0182008_10012432
203 Ga0182007_10000115
204 Ga0182007_10001993
205 Ga0182005_1001608
206 Ga0163161_10008747
207 Ga0163161_10049004
208 Ga0209435_100180
209 Ga0209784_100128
210 Ga0209566_100157
211 Ga0209674_100180
212 Ga0209147_100183
213 Ga0209563_100144
214 Ga0209258_100310
215 Ga0209646_1000402
216 Ga0209677_100127
217 Ga0209759_1005660
218 Ga0207696_1000090
219 Ga0207655_1007822
220 Ga0207655_1009091
221 Ga0207655_1019896
222 Ga0207713_1000483
223 Ga0207713_1008077
224 Ga0207650_10000549
225 Ga0207639_10033478
226 Ga0307509_10138995
227 Ga0307408_100017843
228 Ga0307412_10001606
229 Ga0307414_10000559
230 Ga0307414_10111431
231 Ga0439466_0000041
232 Ga0439466_0008106
233 Ga0439432_001385
234 Ga0439452_000954
235 Ga0495617_000540
236 Ga0495617_033163
237 Ga0495591_000058
238 Ga0495591_001577
239 Ga0495638_0000372
240 Ga0495638_0205434
241 Ga0495653_0000170
242 Ga0495650_0000596
243 Ga0495605_0014449
244 Ga0495584_0012484
245 Ga0495585_0000044
246 Ga0495585_0000137
247 Ga0495594_0000138
248 Ga0495596_0000010
249 Ga0495607_0000054
250 Ga0495607_0000670
251 Ga0495607_0002044
252 Ga0495607_0002394
253 Ga0495583_0000695
254 Ga0495583_0004045
255 Ga0495606_0002985
256 Ga0495606_0004076
257 Ga0495606_0005521
258 Ga0495610_0000714
259 Ga0495610_0002609
260 Ga0495610_0009789
261 Ga0495610_0047365
262 Ga0495610_0051175
263 Ga0495616_0001829
264 Ga0495616_0002883
265 Ga0495616_0015703
266 Ga0495620_0000004
267 Ga0495632_0000841
268 Ga0495632_0024279
269 Ga0495632_0026850
270 Ga0495637_0000224
271 Ga0495637_0000241
272 Ga0495637_0001646
273 Ga0495643_0008637
274 Ga0495643_0109190
275 Ga0495644_0037308
276 Ga0495648_0000479
277 Ga0495648_0003049
278 Ga0495648_0010065
279 Ga0495648_0121276
280 Ga0495654_0000105
281 Ga0495654_0000221
282 Ga0495654_0000290
283 Ga0495654_0001783
284 Ga0495654_0007802
285 Ga0495609_0014614
286 Ga0495609_0054782
287 Ga0495597_0000020
288 Ga0495597_0000382
289 Ga0495597_0000646
290 Ga0495597_0009423
291 Ga0495668_0000238
292 Ga0495611_0007274
293 Ga0495611_0037146
294 Ga0495611_0038507
295 Ga0495625_0005386
296 Ga0495625_0021758
297 Ga0495625_0029912
298 Ga0495659_0031894
299 Ga0495661_0000163
300 Ga0495670_0000093
301 Ga0495670_0002881
302 Ga0495670_0004946
303 Ga0495670_0063678
304 Ga0495670_0085570
305 Ga0495671_0004297
306 Ga0495649_0000036
307 Ga0495649_0002221
308 Ga0495660_0000161
309 Ga0495660_0000927
310 Ga0495660_0002400
311 Ga0495660_0019283
312 Ga0495660_0024169
313 Ga0495660_0027664
314 Ga0495672_0000271
315 Ga0495680_0032281
316 Ga0495683_0000065
317 Ga0495673_0010587
318 Ga0495673_0047705
319 Ga0495681_0000283
320 Ga0495681_0000956
321 Ga0495681_0001564
322 Ga0495681_0001823
323 Ga0495681_0007426
324 Ga0495681_0009292
325 Ga0495626_0000208
326 Ga0495626_0000369
327 Ga0495626_0004881
328 Ga0496110_0374672
329 Ga0496117_0000924
330 Ga0496117_0001123
331 Ga0496117_0005830
332 Ga0496118_0000965
333 Ga0496118_0006020
334 Ga0496122_0000175
335 Ga0496122_0000696
336 Ga0496122_0002173
337 Ga0496123_0000079
338 Ga0496123_0000886
339 Ga0496123_0001235
340 Ga0496124_0000031
341 Ga0496125_0000284
342 Ga0496125_0055749
343 Ga0495678_017162
344 Ga0495678_048182
345 2599357675
346 2599382609
347 2599389056
348 2599463836
349 2599492856
350 2600216975
351 2601690236
352 2601777147
353 2644621824
354 2852613204
355 2852669061
356 2919159151
357 2939656938
358 3007873519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00717

Peptidase_S24

Peptidase S24-like

170

296

0.82

Map