F273825

General Info

Members Datasets Scaffolds Average Seq Length
179 122 179 312

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10001978|Ga0157374_1000197819
Length 345
Sequence VLCAGVLGDLCGKFFETFNRKDRKGAKKNIHRMASPLNLVFCGTPQFAVPNLQKLVEAGFVVQLVVTQPDRPKGRGMELTPSPVKKCALELKLPITQPAKIKHNEEFRAQLEVIKPDAIIVVGYGRIIPQWMLDLPPLGNINVHASLLPKYRGAAPIQWAIAEGETITGVTTMKIDAGLDTGDILLKAELPIDPSDTAETLSPKLAAIGADLLVETLNEIQTIKPKPQDNSKATLAPILKKEDGKISFDRTADQICNRLRGFQLWPGAFTSFRGKTLQVNQARALRQTIPPGELLVENDRLSAGCAEQTALQILELQPEGKKRMPAKDFIHGYHPKSGEKLGSGN

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
62 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 2.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.35
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001454 3300000546 Bacteria 3381
2 rootH2_10094890 3300003320 Bacteria 2993
3 rootL2_10340256 3300003322 Bacteria 1001
4 Ga0070658_10065122 3300005327 Bacteria 2974
5 Ga0070683_100429857 3300005329 Unclassified 1260
6 Ga0068869_100012141 3300005334 Bacteria 5680
7 Ga0070680_100135893 3300005336 Bacteria 2060
8 Ga0068868_100125206 3300005338 Bacteria 2099
9 Ga0068868_100155671 3300005338 Unclassified 1885
10 Ga0068868_100162969 3300005338 Bacteria 1842
11 Ga0070660_100160346 3300005339 Unclassified 1812
12 Ga0070660_100209530 3300005339 Bacteria 1582
13 Ga0070661_100007203 3300005344 Bacteria 7664
14 Ga0070692_10150429 3300005345 Unclassified 1325
15 Ga0070667_100116848 3300005367 Bacteria 2317
16 Ga0070709_10065352 3300005434 Bacteria 2329
17 Ga0070713_100057284 3300005436 Bacteria 3244
18 Ga0070713_100211702 3300005436 Bacteria 1755
19 Ga0070710_10031529 3300005437 Bacteria 2863
20 Ga0070708_100001715 3300005445 Bacteria 16862
21 Ga0070708_100003584 3300005445 Bacteria 12182
22 Ga0070708_100006436 3300005445 Bacteria 9353
23 Ga0070708_100018727 3300005445 Bacteria 5796
24 Ga0070708_100087946 3300005445 Bacteria 2824
25 Ga0070708_100097951 3300005445 Bacteria 2681
26 Ga0070708_100118093 3300005445 Unclassified 2443
27 Ga0070708_100240699 3300005445 Bacteria 1699
28 Ga0070706_100001385 3300005467 Bacteria 25705
29 Ga0070706_100002503 3300005467 Bacteria 18507
30 Ga0070707_100002130 3300005468 Bacteria 18942
31 Ga0070707_100012306 3300005468 Bacteria 7988
32 Ga0070707_100219162 3300005468 Bacteria 1854
33 Ga0070707_100437724 3300005468 Bacteria 1268
34 Ga0070698_100000589 3300005471 Bacteria 39008
35 Ga0070699_100000716 3300005518 Bacteria 30815
36 Ga0070699_100025935 3300005518 Bacteria 5054
37 Ga0070699_100110175 3300005518 Unclassified 2417
38 Ga0070697_100000280 3300005536 Bacteria 41171
39 Ga0070697_100001256 3300005536 Bacteria 19162
40 Ga0070697_100013559 3300005536 Bacteria 6393
41 Ga0068855_100592386 3300005563 Unclassified 1196
42 Ga0070664_100008272 3300005564 Bacteria 8414
43 Ga0068856_100023013 3300005614 Bacteria 6058
44 Ga0068852_100292071 3300005616 Bacteria 1575
45 Ga0068859_100014831 3300005617 Bacteria 7825
46 Ga0068851_10147101 3300005834 Bacteria 1285
47 Ga0068863_100209288 3300005841 Bacteria 1878
48 Ga0068863_100257387 3300005841 Bacteria 1687
49 Ga0068858_100004032 3300005842 Bacteria 14492
50 Ga0068860_100012091 3300005843 Bacteria 8501
51 Ga0068862_100151271 3300005844 Bacteria 2066
52 Ga0070716_100102040 3300006173 Bacteria 1761
53 Ga0070716_100147373 3300006173 Unclassified 1509
54 Ga0070712_100027377 3300006175 Bacteria 3807
55 Ga0097621_100024654 3300006237 Bacteria 4700
56 Ga0068871_100049645 3300006358 Bacteria 3392
57 Ga0075434_100001829 3300006871 Bacteria 18360
58 Ga0075434_100456294 3300006871 Unclassified 1299
59 Ga0068865_100044263 3300006881 Bacteria 3046
60 Ga0075436_100000516 3300006914 Bacteria 25085
61 Ga0075436_100056304 3300006914 Unclassified 2716
62 Ga0097620_100014831 3300006931 Bacteria 7825
63 Ga0075435_100016802 3300007076 Bacteria 5522
64 Ga0099794_10121381 3300007265 Unclassified 1315
65 Ga0105240_10459104 3300009093 Bacteria 1424
66 Ga0105245_10093343 3300009098 Unclassified 2773
67 Ga0105245_10179724 3300009098 Bacteria 2020
68 Ga0105245_10496726 3300009098 Bacteria 1236
69 Ga0105241_10100243 3300009174 Bacteria 2301
70 Ga0105237_10045567 3300009545 Bacteria 4412
71 Ga0105238_10138524 3300009551 Unclassified 2411
72 Ga0105249_10107235 3300009553 Bacteria 2636
73 Ga0105239_10070525 3300010375 Unclassified 3839
74 Ga0105239_10087659 3300010375 Bacteria 3431
75 Ga0105239_10146045 3300010375 Unclassified 2638
76 Ga0157373_10030097 3300013100 Unclassified 3907
77 Ga0157371_10112893 3300013102 Unclassified 1929
78 Ga0157369_10070527 3300013105 Unclassified 3754
79 Ga0157374_10001978 3300013296 Bacteria 17189
80 Ga0157374_10007704 3300013296 Bacteria 9195
81 Ga0157374_10042725 3300013296 Bacteria 4183
82 Ga0157374_10230007 3300013296 Bacteria 1821
83 Ga0157378_10072136 3300013297 Bacteria 3102
84 Ga0163162_10009643 3300013306 Bacteria 9392
85 Ga0157372_10135410 3300013307 Bacteria 2836
86 Ga0157372_10354090 3300013307 Bacteria 1711
87 Ga0157375_10073401 3300013308 Bacteria 3440
88 Ga0157375_10190470 3300013308 Bacteria 2206
89 Ga0163163_10507452 3300014325 Bacteria 1268
90 Ga0182007_10021786 3300015262 Unclassified 2271
91 Ga0213876_10138036 3300021384 Bacteria 1297
92 Ga0213875_10009890 3300021388 Bacteria 4809
93 Ga0224569_100063 3300022732 Bacteria 6837
94 Ga0228598_1000002 3300024227 Bacteria 37716
95 Ga0228598_1004818 3300024227 Unclassified 2849
96 Ga0207692_10020271 3300025898 Bacteria 3021
97 Ga0207647_10029904 3300025904 Bacteria 3519
98 Ga0207705_10022251 3300025909 Bacteria 4522
99 Ga0207684_10003613 3300025910 Bacteria 15050
100 Ga0207684_10005360 3300025910 Bacteria 11848
101 Ga0207684_10008000 3300025910 Bacteria 9445
102 Ga0207693_10013230 3300025915 Bacteria 6658
103 Ga0207693_10023945 3300025915 Bacteria 4847
104 Ga0207657_10029395 3300025919 Bacteria 5003
105 Ga0207657_10035967 3300025919 Bacteria 4436
106 Ga0207646_10001267 3300025922 Bacteria 31649
107 Ga0207646_10033930 3300025922 Bacteria 4612
108 Ga0207646_10045435 3300025922 Bacteria 3943
109 Ga0207687_10228948 3300025927 Unclassified 1467
110 Ga0207700_10406767 3300025928 Bacteria 1193
111 Ga0207664_10073009 3300025929 Bacteria 2768
112 Ga0207706_10022082 3300025933 Bacteria 5712
113 Ga0207704_10037263 3300025938 Bacteria 2808
114 Ga0207665_10054248 3300025939 Bacteria 2703
115 Ga0207665_10317365 3300025939 Unclassified 1168
116 Ga0207689_10000707 3300025942 Bacteria 31997
117 Ga0207640_10154786 3300025981 Bacteria 1688
118 Ga0207677_10111614 3300026023 Bacteria 2037
119 Ga0207677_10117715 3300026023 Bacteria 1992
120 Ga0207677_10136790 3300026023 Unclassified 1869
121 Ga0207703_10014707 3300026035 Bacteria 6107
122 Ga0207641_10208898 3300026088 Bacteria 1804
123 Ga0207675_100110358 3300026118 Bacteria 2595
124 Ga0207698_10060280 3300026142 Unclassified 2950
125 Ga0268265_10157892 3300028380 Bacteria 1922
126 Ga0268264_10004223 3300028381 Bacteria 12261
127 Ga0265762_1008042 3300030760 Bacteria 1877
128 Ga0265765_1002751 3300030879 Bacteria 1724
129 Ga0265760_10002485 3300031090 Bacteria 5380
130 Ga0265760_10002741 3300031090 Bacteria 5159
131 Ga0265328_10016817 3300031239 Bacteria 2840
132 Ga0265339_10027470 3300031249 Unclassified 3248
133 Ga0307405_10013300 3300031731 Bacteria 4387
134 Ga0307405_10017982 3300031731 Bacteria 3891
135 Ga0307413_10057751 3300031824 Bacteria 2375
136 Ga0307410_10001021 3300031852 Bacteria 12145
137 Ga0307410_10017116 3300031852 Unclassified 4343
138 Ga0307406_10083581 3300031901 Bacteria 2129
139 Ga0307406_10133745 3300031901 Bacteria 1745
140 Ga0307412_10086691 3300031911 Bacteria 2180
141 Ga0307409_100005701 3300031995 Bacteria 7214
142 Ga0307409_100085340 3300031995 Bacteria 2566
143 Ga0307409_100342384 3300031995 Bacteria 1407
144 Ga0307411_10024843 3300032005 Bacteria 3579
145 Ga0307411_10165107 3300032005 Bacteria 1663
146 Ga0316214_1006599 3300033545 Bacteria 1535
147 Ga0395900_0042154 3300037418 Bacteria 4702
148 Ga0395898_0043190 3300037466 Bacteria 4443
149 Ga0436364_0853142 3300037853 Bacteria 8364
150 Ga0436365_0675740 3300039437 Bacteria 3902
151 Ga0436363_0356673 3300039450 Bacteria 1835
152 Ga0436363_1029901 3300039450 Bacteria 3188
153 Ga0436363_1122484 3300039450 Bacteria 1855
154 Ga0436363_1404946 3300039450 Bacteria 1754
155 Ga0451839_0976625 3300041496 Bacteria 2143
156 Ga0439446_0000005 3300042156 Bacteria 101649
157 Ga0466964_0095755 3300044706 Bacteria 1300
158 Ga0466967_0002232 3300045976 Bacteria 11931
159 Ga0466967_0017316 3300045976 Bacteria 5716
160 Ga0466967_0085382 3300045976 Bacteria 2858
161 Ga0466967_0093669 3300045976 Bacteria 2734
162 Ga0495603_0033957 3300046455 Unclassified 3069
163 Ga0495580_0040319 3300046472 Bacteria 3336
164 Ga0495664_0147870 3300046477 Bacteria 1425
165 Ga0495665_0021545 3300046531 Bacteria 3463
166 Ga0496102_0214972 3300048905 Bacteria 1812
167 Ga0496106_0034342 3300048909 Unclassified 3787
168 Ga0496111_0109905 3300048914 Bacteria 2030
169 Ga0496112_0162289 3300048915 Bacteria 2201
170 Ga0496112_0324051 3300048915 Bacteria 1485
171 Ga0496113_0091882 3300048916 Unclassified 2340
172 Ga0501083_0114773 3300049744 Bacteria 1769
173 nmdc:mga0n895_382384_c1 3300050512 Unclassified 1424
174 nmdc:mga0n895_4579_c1 3300050512 Bacteria 11389
175 nmdc:mga0rr50_9264_c1 3300050513 Bacteria 6181
176 nmdc:mga08x19_48673_c1 3300050514 Unclassified 2716
177 Ga0495619_0042788 3300053085 Bacteria 2968
178 Ga0501084_0080902 3300054114 Bacteria 2724
179 Ga0501082_0129551 3300060353 Bacteria 2189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1122484 Ga0436363_1122484_783_1604 269
2 3300045976 Ga0466967_0002232 Ga0466967_0002232_8581_9399 269
3 3300005445 Ga0070708_100240699 Ga0070708_1002406992 282
4 3300005467 Ga0070706_100002503 Ga0070706_10000250313 284
5 3300005468 Ga0070707_100002130 Ga0070707_10000213013 284
6 3300005536 Ga0070697_100001256 Ga0070697_10000125613 284
7 3300031731 Ga0307405_10013300 Ga0307405_100133003 293
8 3300005345 Ga0070692_10150429 Ga0070692_101504292 294
9 3300005468 Ga0070707_100437724 Ga0070707_1004377242 294
10 3300042156 Ga0439446_0000005 Ga0439446_0000005_12194_13087 295
11 3300025910 Ga0207684_10008000 Ga0207684_100080005 296
12 3300031901 Ga0307406_10083581 Ga0307406_100835813 301
13 3300031995 Ga0307409_100342384 Ga0307409_1003423841 301
14 3300032005 Ga0307411_10165107 Ga0307411_101651072 301
15 3300054114 Ga0501084_0080902 Ga0501084_0080902_1466_2434 301
16 3300060353 Ga0501082_0129551 Ga0501082_0129551_1039_2007 301
17 3300006871 Ga0075434_100001829 Ga0075434_1000018294 304
18 3300006871 Ga0075434_100456294 Ga0075434_1004562942 304
19 3300007076 Ga0075435_100016802 Ga0075435_1000168023 304
20 3300050512 nmdc:mga0n895_382384_c1 nmdc:mga0n895_382384_c1_119_1063 304
21 3300050512 nmdc:mga0n895_4579_c1 nmdc:mga0n895_4579_c1_118_1059 304
22 3300050513 nmdc:mga0rr50_9264_c1 nmdc:mga0rr50_9264_c1_17_958 304
23 3300031731 Ga0307405_10017982 Ga0307405_100179822 306
24 3300003320 rootH2_10094890 rootH2_100948903 307
25 3300005327 Ga0070658_10065122 Ga0070658_100651222 307
26 3300005339 Ga0070660_100209530 Ga0070660_1002095301 307
27 3300005834 Ga0068851_10147101 Ga0068851_101471011 307
28 3300006914 Ga0075436_100000516 Ga0075436_10000051625 307
29 3300006914 Ga0075436_100056304 Ga0075436_1000563042 307
30 3300010375 Ga0105239_10146045 Ga0105239_101460453 307
31 3300013296 Ga0157374_10042725 Ga0157374_100427252 307
32 3300021388 Ga0213875_10009890 Ga0213875_100098903 307
33 3300025909 Ga0207705_10022251 Ga0207705_100222513 307
34 3300025919 Ga0207657_10035967 Ga0207657_100359673 307
35 3300037418 Ga0395900_0042154 Ga0395900_0042154_2691_3638 307
36 3300037466 Ga0395898_0043190 Ga0395898_0043190_2258_3205 307
37 3300037853 Ga0436364_0853142 Ga0436364_0853142_4412_5362 307
38 3300045976 Ga0466967_0085382 Ga0466967_0085382_807_1736 307
39 3300050514 nmdc:mga08x19_48673_c1 nmdc:mga08x19_48673_c1_886_1815 307
40 3300005329 Ga0070683_100429857 Ga0070683_1004298572 309
41 3300005338 Ga0068868_100155671 Ga0068868_1001556711 309
42 3300005338 Ga0068868_100162969 Ga0068868_1001629692 309
43 3300005339 Ga0070660_100160346 Ga0070660_1001603461 309
44 3300005344 Ga0070661_100007203 Ga0070661_1000072034 309
45 3300005563 Ga0068855_100592386 Ga0068855_1005923861 309
46 3300005564 Ga0070664_100008272 Ga0070664_1000082723 309
47 3300005614 Ga0068856_100023013 Ga0068856_1000230135 309
48 3300009093 Ga0105240_10459104 Ga0105240_104591042 309
49 3300009098 Ga0105245_10179724 Ga0105245_101797243 309
50 3300009174 Ga0105241_10100243 Ga0105241_101002431 309
51 3300009551 Ga0105238_10138524 Ga0105238_101385243 309
52 3300009553 Ga0105249_10107235 Ga0105249_101072351 309
53 3300010375 Ga0105239_10070525 Ga0105239_100705253 309
54 3300013100 Ga0157373_10030097 Ga0157373_100300973 309
55 3300013102 Ga0157371_10112893 Ga0157371_101128934 309
56 3300013105 Ga0157369_10070527 Ga0157369_100705274 309
57 3300013296 Ga0157374_10230007 Ga0157374_102300072 309
58 3300013307 Ga0157372_10135410 Ga0157372_101354102 309
59 3300014325 Ga0163163_10507452 Ga0163163_105074521 309
60 3300015262 Ga0182007_10021786 Ga0182007_100217862 309
61 3300021384 Ga0213876_10138036 Ga0213876_101380362 309
62 3300025915 Ga0207693_10023945 Ga0207693_100239452 309
63 3300025919 Ga0207657_10029395 Ga0207657_100293952 309
64 3300025929 Ga0207664_10073009 Ga0207664_100730093 309
65 3300025933 Ga0207706_10022082 Ga0207706_100220827 309
66 3300025981 Ga0207640_10154786 Ga0207640_101547862 309
67 3300026023 Ga0207677_10117715 Ga0207677_101177152 309
68 3300026023 Ga0207677_10136790 Ga0207677_101367903 309
69 3300026142 Ga0207698_10060280 Ga0207698_100602803 309
70 3300031824 Ga0307413_10057751 Ga0307413_100577512 309
71 3300031852 Ga0307410_10001021 Ga0307410_100010217 309
72 3300031852 Ga0307410_10017116 Ga0307410_100171162 309
73 3300031901 Ga0307406_10133745 Ga0307406_101337452 309
74 3300031911 Ga0307412_10086691 Ga0307412_100866911 309
75 3300031995 Ga0307409_100005701 Ga0307409_1000057012 309
76 3300031995 Ga0307409_100085340 Ga0307409_1000853402 309
77 3300032005 Ga0307411_10024843 Ga0307411_100248433 309
78 3300039437 Ga0436365_0675740 Ga0436365_0675740_1315_2250 309
79 3300039450 Ga0436363_1029901 Ga0436363_1029901_989_1924 309
80 3300039450 Ga0436363_1404946 Ga0436363_1404946_743_1672 309
81 3300041496 Ga0451839_0976625 Ga0451839_0976625_576_1508 309
82 3300044706 Ga0466964_0095755 Ga0466964_0095755_49_1011 309
83 3300045976 Ga0466967_0093669 Ga0466967_0093669_685_1647 309
84 3300046477 Ga0495664_0147870 Ga0495664_0147870_45_977 309
85 3300046531 Ga0495665_0021545 Ga0495665_0021545_1417_2349 309
86 3300048905 Ga0496102_0214972 Ga0496102_0214972_209_1147 309
87 3300048909 Ga0496106_0034342 Ga0496106_0034342_2618_3556 309
88 3300048914 Ga0496111_0109905 Ga0496111_0109905_764_1702 309
89 3300048915 Ga0496112_0324051 Ga0496112_0324051_476_1414 309
90 3300048916 Ga0496113_0091882 Ga0496113_0091882_1279_2217 309
91 3300053085 Ga0495619_0042788 Ga0495619_0042788_2002_2934 309
92 3300003322 rootL2_10340256 rootL2_103402561 311
93 3300005334 Ga0068869_100012141 Ga0068869_1000121416 311
94 3300005338 Ga0068868_100125206 Ga0068868_1001252062 311
95 3300005367 Ga0070667_100116848 Ga0070667_1001168482 311
96 3300005436 Ga0070713_100057284 Ga0070713_1000572843 311
97 3300005445 Ga0070708_100097951 Ga0070708_1000979513 311
98 3300005445 Ga0070708_100118093 Ga0070708_1001180932 311
99 3300005616 Ga0068852_100292071 Ga0068852_1002920712 311
100 3300005617 Ga0068859_100014831 Ga0068859_1000148313 311
101 3300005841 Ga0068863_100257387 Ga0068863_1002573872 311
102 3300005842 Ga0068858_100004032 Ga0068858_1000040327 311
103 3300005843 Ga0068860_100012091 Ga0068860_1000120912 311
104 3300005844 Ga0068862_100151271 Ga0068862_1001512712 311
105 3300006173 Ga0070716_100102040 Ga0070716_1001020402 311
106 3300006175 Ga0070712_100027377 Ga0070712_1000273772 311
107 3300006237 Ga0097621_100024654 Ga0097621_1000246543 311
108 3300006358 Ga0068871_100049645 Ga0068871_1000496453 311
109 3300006881 Ga0068865_100044263 Ga0068865_1000442632 311
110 3300006931 Ga0097620_100014831 Ga0097620_1000148313 311
111 3300009098 Ga0105245_10496726 Ga0105245_104967262 311
112 3300009545 Ga0105237_10045567 Ga0105237_100455675 311
113 3300010375 Ga0105239_10087659 Ga0105239_100876593 311
114 3300013296 Ga0157374_10001978 Ga0157374_1000197819 311
115 3300013297 Ga0157378_10072136 Ga0157378_100721363 311
116 3300013307 Ga0157372_10354090 Ga0157372_103540902 311
117 3300013308 Ga0157375_10073401 Ga0157375_100734012 311
118 3300013308 Ga0157375_10190470 Ga0157375_101904702 311
119 3300025904 Ga0207647_10029904 Ga0207647_100299042 311
120 3300025915 Ga0207693_10013230 Ga0207693_100132306 311
121 3300025928 Ga0207700_10406767 Ga0207700_104067671 311
122 3300025938 Ga0207704_10037263 Ga0207704_100372632 311
123 3300025939 Ga0207665_10054248 Ga0207665_100542482 311
124 3300025942 Ga0207689_10000707 Ga0207689_1000070723 311
125 3300026023 Ga0207677_10111614 Ga0207677_101116141 311
126 3300026035 Ga0207703_10014707 Ga0207703_100147072 311
127 3300026088 Ga0207641_10208898 Ga0207641_102088982 311
128 3300026118 Ga0207675_100110358 Ga0207675_1001103582 311
129 3300028380 Ga0268265_10157892 Ga0268265_101578922 311
130 3300028381 Ga0268264_10004223 Ga0268264_1000422312 311
131 3300031090 Ga0265760_10002485 Ga0265760_100024855 311
132 3300031239 Ga0265328_10016817 Ga0265328_100168173 311
133 3300031249 Ga0265339_10027470 Ga0265339_100274702 311
134 3300046455 Ga0495603_0033957 Ga0495603_0033957_317_1273 311
135 3300048915 Ga0496112_0162289 Ga0496112_0162289_136_1077 311
136 3300005336 Ga0070680_100135893 Ga0070680_1001358931 312
137 3300005445 Ga0070708_100018727 Ga0070708_1000187274 312
138 3300005468 Ga0070707_100219162 Ga0070707_1002191622 312
139 3300025922 Ga0207646_10045435 Ga0207646_100454355 312
140 3300045976 Ga0466967_0017316 Ga0466967_0017316_3571_4509 312
141 3300046472 Ga0495580_0040319 Ga0495580_0040319_223_1161 312
142 3300049744 Ga0501083_0114773 Ga0501083_0114773_703_1656 312
143 3300000546 LJNas_1001454 LJNas_10014543 313
144 3300005434 Ga0070709_10065352 Ga0070709_100653522 313
145 3300005436 Ga0070713_100211702 Ga0070713_1002117021 313
146 3300005437 Ga0070710_10031529 Ga0070710_100315292 313
147 3300005445 Ga0070708_100001715 Ga0070708_1000017157 313
148 3300005445 Ga0070708_100003584 Ga0070708_1000035846 313
149 3300005445 Ga0070708_100006436 Ga0070708_1000064364 313
150 3300005445 Ga0070708_100087946 Ga0070708_1000879462 313
151 3300005467 Ga0070706_100001385 Ga0070706_10000138513 313
152 3300005468 Ga0070707_100012306 Ga0070707_1000123066 313
153 3300005471 Ga0070698_100000589 Ga0070698_10000058928 313
154 3300005518 Ga0070699_100000716 Ga0070699_1000007169 313
155 3300005518 Ga0070699_100025935 Ga0070699_1000259353 313
156 3300005518 Ga0070699_100110175 Ga0070699_1001101752 313
157 3300005536 Ga0070697_100000280 Ga0070697_1000002807 313
158 3300005536 Ga0070697_100013559 Ga0070697_1000135595 313
159 3300005841 Ga0068863_100209288 Ga0068863_1002092882 313
160 3300006173 Ga0070716_100147373 Ga0070716_1001473732 313
161 3300007265 Ga0099794_10121381 Ga0099794_101213811 313
162 3300009098 Ga0105245_10093343 Ga0105245_100933433 313
163 3300013296 Ga0157374_10007704 Ga0157374_100077042 313
164 3300013306 Ga0163162_10009643 Ga0163162_100096437 313
165 3300022732 Ga0224569_100063 Ga0224569_1000634 313
166 3300024227 Ga0228598_1000002 Ga0228598_10000026 313
167 3300024227 Ga0228598_1004818 Ga0228598_10048181 313
168 3300025898 Ga0207692_10020271 Ga0207692_100202713 313
169 3300025910 Ga0207684_10003613 Ga0207684_100036136 313
170 3300025910 Ga0207684_10005360 Ga0207684_100053609 313
171 3300025922 Ga0207646_10001267 Ga0207646_1000126720 313
172 3300025922 Ga0207646_10033930 Ga0207646_100339304 313
173 3300025927 Ga0207687_10228948 Ga0207687_102289482 313
174 3300025939 Ga0207665_10317365 Ga0207665_103173652 313
175 3300030760 Ga0265762_1008042 Ga0265762_10080421 313
176 3300030879 Ga0265765_1002751 Ga0265765_10027511 313
177 3300031090 Ga0265760_10002741 Ga0265760_100027414 313
178 3300033545 Ga0316214_1006599 Ga0316214_10065992 313
179 3300039450 Ga0436363_0356673 Ga0436363_0356673_326_1297 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

238

334

0.94

PF00551

Formyl_trans_N

Formyl transferase

37

217

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9424 1 311
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9408 4 312
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9394 5 313
1fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase from escherichia coli 0.9378 3 311
3r8x-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine 0.9365 1 311
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9754 4 210 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9704 4 210 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9629 5 210 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9572 3 210 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9446 5 210 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3B8JDQ4-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9846 5 230 GO:0004479
GO:0005829
AF-A0A382A6D5-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9836 5 210 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.983 5 210 GO:0004479
GO:0005829
AF-A0A3M1ABA1-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9799 5 210 GO:0004479
GO:0005829
AF-A0A382A6D5-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9789 5 210 GO:0004479
GO:0005829

Feature Viewer

pLDDT pTM Quality
94.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map