F273475

General Info

Members Datasets Scaffolds Average Seq Length
179 117 358 107

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100112025|Ga0070695_1001120253
Length 124
Sequence MRLWKVSLPQDLRLKPTGVKAPHGASVLEISWADGHRCSYPHRILRGYCPCASCQGHSGAIRFVSPGNLEMREIEQVGNYALSFVWGDGHSSGIYTYRYLRALCELLEQHGAERLEELGELPRT

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
78 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
83 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
86 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
87 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.23
Nodule 0
Rhizoplane 0.56
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 31.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100112025 3300005545 Bacteria 1853
2 CNXas_1003719 3300000545 Unclassified 1076
3 rootH2_10010609 3300003320 Bacteria 36978
4 rootH2_10095213 3300003320 Bacteria 3958
5 Ga0065704_10865050 3300005289 Bacteria 505
6 Ga0070658_11260444 3300005327 Unclassified 642
7 Ga0070690_100000824 3300005330 Bacteria 15735
8 Ga0070682_101962508 3300005337 Unclassified 514
9 Ga0070689_100727208 3300005340 Unclassified 868
10 Ga0070689_100741491 3300005340 Bacteria 860
11 Ga0070687_100145147 3300005343 Bacteria 1386
12 Ga0070687_100648960 3300005343 Bacteria 731
13 Ga0070692_10566549 3300005345 Bacteria 746
14 Ga0070701_10032425 3300005438 Unclassified 2601
15 Ga0070701_10531495 3300005438 Unclassified 768
16 Ga0070694_100010238 3300005444 Bacteria 5776
17 Ga0070694_101078065 3300005444 Bacteria 669
18 Ga0070672_100625687 3300005543 Bacteria 939
19 Ga0070696_100111533 3300005546 Bacteria 1970
20 Ga0070693_100474112 3300005547 Bacteria 883
21 Ga0070704_100001026 3300005549 Bacteria 14372
22 Ga0070704_100794900 3300005549 Unclassified 845
23 Ga0068855_100987793 3300005563 Unclassified 885
24 Ga0068857_100974365 3300005577 Bacteria 815
25 Ga0068857_101044032 3300005577 Unclassified 788
26 Ga0068856_100988094 3300005614 Unclassified 860
27 Ga0068859_100148392 3300005617 Bacteria 2420
28 Ga0068859_100345110 3300005617 Unclassified 1583
29 Ga0068859_100851159 3300005617 Bacteria 998
30 Ga0068864_101437483 3300005618 Bacteria 692
31 Ga0068861_101854021 3300005719 Unclassified 599
32 Ga0068863_100095448 3300005841 Bacteria 2822
33 Ga0081455_10209640 3300005937 Unclassified 1453
34 Ga0075366_10044746 3300006195 Bacteria 2624
35 Ga0075366_10652192 3300006195 Unclassified 653
36 Ga0068871_100281002 3300006358 Bacteria 1456
37 Ga0075428_100040945 3300006844 Bacteria 5095
38 Ga0075428_101284526 3300006844 Bacteria 770
39 Ga0075428_101743699 3300006844 Bacteria 649
40 Ga0075430_100620615 3300006846 Unclassified 892
41 Ga0075430_100812810 3300006846 Bacteria 770
42 Ga0097620_100008253 3300006931 Bacteria 10560
43 Ga0097620_100148383 3300006931 Bacteria 2420
44 Ga0097620_100261559 3300006931 Bacteria 1822
45 Ga0097620_100345112 3300006931 Unclassified 1583
46 Ga0097620_100851186 3300006931 Bacteria 998
47 Ga0105240_10066119 3300009093 Bacteria 4486
48 Ga0105240_11961500 3300009093 Unclassified 609
49 Ga0111539_10028935 3300009094 Bacteria 6757
50 Ga0111539_10215926 3300009094 Bacteria 2234
51 Ga0105245_10053257 3300009098 Bacteria 3632
52 Ga0105242_10459550 3300009176 Bacteria 1202
53 Ga0105248_10143917 3300009177 Bacteria 2690
54 Ga0105248_11411744 3300009177 Bacteria 788
55 Ga0105248_11684219 3300009177 Unclassified 719
56 Ga0105238_10004536 3300009551 Bacteria 13754
57 Ga0105249_10293577 3300009553 Bacteria 1628
58 Ga0105249_11205296 3300009553 Unclassified 828
59 Ga0099796_10227666 3300010159 Bacteria 766
60 Ga0105246_10332255 3300011119 Bacteria 1239
61 Ga0157370_11751357 3300013104 Bacteria 558
62 Ga0157374_10369369 3300013296 Unclassified 1428
63 Ga0157375_12084440 3300013308 Unclassified 675
64 Ga0163163_10003302 3300014325 Bacteria 13678
65 Ga0157379_10412525 3300014968 Unclassified 1243
66 Ga0157376_11183838 3300014969 Unclassified 792
67 Ga0163161_10837432 3300017792 Bacteria 775
68 Ga0207695_10279717 3300025913 Bacteria 1562
69 Ga0207695_10571456 3300025913 Bacteria 1012
70 Ga0207694_10042982 3300025924 Unclassified 3487
71 Ga0207687_10027486 3300025927 Bacteria 3818
72 Ga0207670_10665377 3300025936 Unclassified 860
73 Ga0207669_11150637 3300025937 Unclassified 656
74 Ga0207691_10582362 3300025940 Bacteria 948
75 Ga0207703_11897279 3300026035 Bacteria 572
76 Ga0207702_10165998 3300026078 Bacteria 2020
77 Ga0207641_10091510 3300026088 Bacteria 2662
78 Ga0207674_10012719 3300026116 Bacteria 9405
79 Ga0207674_10412273 3300026116 Bacteria 1305
80 Ga0207675_100279397 3300026118 Bacteria 1622
81 Ga0268265_12043241 3300028380 Unclassified 580
82 Ga0265337_1053869 3300028556 Bacteria 1126
83 Ga0265326_10084128 3300028558 Unclassified 900
84 Ga0265319_1000372 3300028563 Bacteria 32397
85 Ga0265319_1154021 3300028563 Unclassified 711
86 Ga0265334_10020296 3300028573 Unclassified 2722
87 Ga0265334_10024299 3300028573 Bacteria 2459
88 Ga0265334_10198522 3300028573 Bacteria 698
89 Ga0265318_10023728 3300028577 Bacteria 2441
90 Ga0265318_10154988 3300028577 Bacteria 840
91 Ga0265323_10228523 3300028653 Bacteria 581
92 Ga0265338_10000032 3300028800 Bacteria 257580
93 Ga0265338_10000440 3300028800 Bacteria 74544
94 Ga0265338_10004220 3300028800 Bacteria 19557
95 Ga0265338_10041682 3300028800 Bacteria 4290
96 Ga0265338_10100278 3300028800 Bacteria 2362
97 Ga0265338_10152902 3300028800 Bacteria 1791
98 Ga0265324_10000892 3300029957 Bacteria 18980
99 Ga0265324_10055052 3300029957 Unclassified 1364
100 Ga0265320_10007059 3300031240 Bacteria 7004
101 Ga0265320_10053199 3300031240 Bacteria 1957
102 Ga0265320_10212549 3300031240 Unclassified 862
103 Ga0265320_10216258 3300031240 Bacteria 854
104 Ga0265320_10462593 3300031240 Bacteria 560
105 Ga0265325_10001557 3300031241 Bacteria 15984
106 Ga0265325_10151948 3300031241 Bacteria 1094
107 Ga0265340_10084190 3300031247 Bacteria 1494
108 Ga0265340_10197277 3300031247 Bacteria 906
109 Ga0265339_10009160 3300031249 Bacteria 6246
110 Ga0265339_10052576 3300031249 Bacteria 2218
111 Ga0265316_10028996 3300031344 Bacteria 4557
112 Ga0265316_10103686 3300031344 Bacteria 2159
113 Ga0265316_10516760 3300031344 Unclassified 852
114 Ga0265313_10006345 3300031595 Bacteria 8411
115 Ga0265313_10013437 3300031595 Bacteria 4914
116 Ga0265314_10013632 3300031711 Bacteria 6555
117 Ga0265314_10090836 3300031711 Unclassified 1988
118 Ga0265314_10135485 3300031711 Bacteria 1530
119 Ga0265342_10034664 3300031712 Unclassified 3095
120 Ga0265342_10290086 3300031712 Bacteria 864
121 Ga0265342_10489031 3300031712 Unclassified 629
122 Ga0316576_10870306 3300031727 Unclassified 646
123 Ga0316578_10402374 3300031728 Unclassified 811
124 Ga0316577_10679372 3300031733 Unclassified 585
125 Ga0316580_10144461 3300032139 Bacteria 730
126 Ga0373950_0074331 3300034818 Unclassified 701
127 Ga0316574_0722971 3300035398 Unclassified 610
128 Ga0373937_0028843 3300036401 Bacteria 5025
129 Ga0373937_0072159 3300036401 Bacteria 3184
130 Ga0316582_0674466 3300036647 Unclassified 710
131 Ga0316584_0949322 3300036712 Unclassified 577
132 Ga0400489_07920 3300039093 Bacteria 1221
133 Ga0451807_0574090 3300041486 Unclassified 3032
134 Ga0451841_0638123 3300041498 Bacteria 967
135 Ga0451849_0707945 3300041505 Bacteria 4557
136 Ga0451851_0296267 3300041507 Bacteria 5548
137 Ga0451853_2028458 3300041512 Bacteria 29388
138 Ga0451577_0004624 3300042876 Bacteria 14457
139 Ga0453683_0012514 3300044673 Bacteria 5560
140 Ga0453683_0928238 3300044673 Bacteria 576
141 Ga0453684_1848219 3300044712 Unclassified 613
142 Ga0451576_0045822 3300045051 Unclassified 4604
143 Ga0451576_0081156 3300045051 Bacteria 3373
144 Ga0451576_0112255 3300045051 Bacteria 2837
145 Ga0451576_0144331 3300045051 Bacteria 2482
146 Ga0451576_0481112 3300045051 Bacteria 1304
147 Ga0451576_0819231 3300045051 Bacteria 977
148 Ga0495586_0573893 3300046535 Unclassified 651
149 Ga0495645_0817798 3300046543 Unclassified 558
150 Ga0495622_0028598 3300046557 Bacteria 2603
151 Ga0495599_0265861 3300046678 Bacteria 1041
152 Ga0495600_0647455 3300046809 Unclassified 639
153 Ga0495680_0642963 3300047322 Unclassified 706
154 Ga0495675_0200513 3300047444 Bacteria 1215
155 Ga0501067_0008939 3300049583 Bacteria 5551
156 Ga0501068_0046731 3300049584 Bacteria 2610
157 Ga0501072_0214049 3300049588 Bacteria 1536
158 Ga0501072_0729410 3300049588 Bacteria 778
159 Ga0501073_0009969 3300049589 Bacteria 6989
160 Ga0501074_0025728 3300049590 Unclassified 4270
161 Ga0501075_1127139 3300049591 Unclassified 595
162 Ga0501076_0454651 3300049592 Bacteria 1054
163 Ga0501077_0114910 3300049593 Bacteria 1706
164 Ga0501079_0755741 3300049741 Unclassified 765
165 Ga0501080_0053567 3300049742 Bacteria 3757
166 Ga0501080_0251268 3300049742 Bacteria 1612
167 Ga0501083_0004498 3300049744 Bacteria 9847
168 Ga0501083_0020721 3300049744 Unclassified 4571
169 Ga0501083_0660390 3300049744 Unclassified 680
170 nmdc:mga0k408_45038_c1 3300050493 Bacteria 2545
171 nmdc:mga0k408_596326_c1 3300050493 Unclassified 652
172 nmdc:mga08y16_10295_c1 3300050511 Bacteria 9815
173 nmdc:mga08y16_446844_c1 3300050511 Bacteria 1319
174 nmdc:mga08x19_862582_c1 3300050514 Unclassified 643
175 Ga0495601_0712015 3300053077 Bacteria 640
176 Ga0501084_0001709 3300054114 Bacteria 17419
177 Ga0501084_0154129 3300054114 Bacteria 1937
178 Ga0501082_0343418 3300060353 Bacteria 1301
179 Ga0530510_0997777 3300061734 Bacteria 641
180 Ga0070695_100112025
181 CNXas_1003719
182 rootH2_10010609
183 rootH2_10095213
184 Ga0065704_10865050
185 Ga0070658_11260444
186 Ga0070690_100000824
187 Ga0070682_101962508
188 Ga0070689_100727208
189 Ga0070689_100741491
190 Ga0070687_100145147
191 Ga0070687_100648960
192 Ga0070692_10566549
193 Ga0070701_10032425
194 Ga0070701_10531495
195 Ga0070694_100010238
196 Ga0070694_101078065
197 Ga0070672_100625687
198 Ga0070696_100111533
199 Ga0070693_100474112
200 Ga0070704_100001026
201 Ga0070704_100794900
202 Ga0068855_100987793
203 Ga0068857_100974365
204 Ga0068857_101044032
205 Ga0068856_100988094
206 Ga0068859_100148392
207 Ga0068859_100345110
208 Ga0068859_100851159
209 Ga0068864_101437483
210 Ga0068861_101854021
211 Ga0068863_100095448
212 Ga0081455_10209640
213 Ga0075366_10044746
214 Ga0075366_10652192
215 Ga0068871_100281002
216 Ga0075428_100040945
217 Ga0075428_101284526
218 Ga0075428_101743699
219 Ga0075430_100620615
220 Ga0075430_100812810
221 Ga0097620_100008253
222 Ga0097620_100148383
223 Ga0097620_100261559
224 Ga0097620_100345112
225 Ga0097620_100851186
226 Ga0105240_10066119
227 Ga0105240_11961500
228 Ga0111539_10028935
229 Ga0111539_10215926
230 Ga0105245_10053257
231 Ga0105242_10459550
232 Ga0105248_10143917
233 Ga0105248_11411744
234 Ga0105248_11684219
235 Ga0105238_10004536
236 Ga0105249_10293577
237 Ga0105249_11205296
238 Ga0099796_10227666
239 Ga0105246_10332255
240 Ga0157370_11751357
241 Ga0157374_10369369
242 Ga0157375_12084440
243 Ga0163163_10003302
244 Ga0157379_10412525
245 Ga0157376_11183838
246 Ga0163161_10837432
247 Ga0207695_10279717
248 Ga0207695_10571456
249 Ga0207694_10042982
250 Ga0207687_10027486
251 Ga0207670_10665377
252 Ga0207669_11150637
253 Ga0207691_10582362
254 Ga0207703_11897279
255 Ga0207702_10165998
256 Ga0207641_10091510
257 Ga0207674_10012719
258 Ga0207674_10412273
259 Ga0207675_100279397
260 Ga0268265_12043241
261 Ga0265337_1053869
262 Ga0265326_10084128
263 Ga0265319_1000372
264 Ga0265319_1154021
265 Ga0265334_10020296
266 Ga0265334_10024299
267 Ga0265334_10198522
268 Ga0265318_10023728
269 Ga0265318_10154988
270 Ga0265323_10228523
271 Ga0265338_10000032
272 Ga0265338_10000440
273 Ga0265338_10004220
274 Ga0265338_10041682
275 Ga0265338_10100278
276 Ga0265338_10152902
277 Ga0265324_10000892
278 Ga0265324_10055052
279 Ga0265320_10007059
280 Ga0265320_10053199
281 Ga0265320_10212549
282 Ga0265320_10216258
283 Ga0265320_10462593
284 Ga0265325_10001557
285 Ga0265325_10151948
286 Ga0265340_10084190
287 Ga0265340_10197277
288 Ga0265339_10009160
289 Ga0265339_10052576
290 Ga0265316_10028996
291 Ga0265316_10103686
292 Ga0265316_10516760
293 Ga0265313_10006345
294 Ga0265313_10013437
295 Ga0265314_10013632
296 Ga0265314_10090836
297 Ga0265314_10135485
298 Ga0265342_10034664
299 Ga0265342_10290086
300 Ga0265342_10489031
301 Ga0316576_10870306
302 Ga0316578_10402374
303 Ga0316577_10679372
304 Ga0316580_10144461
305 Ga0373950_0074331
306 Ga0316574_0722971
307 Ga0373937_0028843
308 Ga0373937_0072159
309 Ga0316582_0674466
310 Ga0316584_0949322
311 Ga0400489_07920
312 Ga0451807_0574090
313 Ga0451841_0638123
314 Ga0451849_0707945
315 Ga0451851_0296267
316 Ga0451853_2028458
317 Ga0451577_0004624
318 Ga0453683_0012514
319 Ga0453683_0928238
320 Ga0453684_1848219
321 Ga0451576_0045822
322 Ga0451576_0081156
323 Ga0451576_0112255
324 Ga0451576_0144331
325 Ga0451576_0481112
326 Ga0451576_0819231
327 Ga0495586_0573893
328 Ga0495645_0817798
329 Ga0495622_0028598
330 Ga0495599_0265861
331 Ga0495600_0647455
332 Ga0495680_0642963
333 Ga0495675_0200513
334 Ga0501067_0008939
335 Ga0501068_0046731
336 Ga0501072_0214049
337 Ga0501072_0729410
338 Ga0501073_0009969
339 Ga0501074_0025728
340 Ga0501075_1127139
341 Ga0501076_0454651
342 Ga0501077_0114910
343 Ga0501079_0755741
344 Ga0501080_0053567
345 Ga0501080_0251268
346 Ga0501083_0004498
347 Ga0501083_0020721
348 Ga0501083_0660390
349 nmdc:mga0k408_45038_c1
350 nmdc:mga0k408_596326_c1
351 nmdc:mga08y16_10295_c1
352 nmdc:mga08y16_446844_c1
353 nmdc:mga08x19_862582_c1
354 Ga0495601_0712015
355 Ga0501084_0001709
356 Ga0501084_0154129
357 Ga0501082_0343418
358 Ga0530510_0997777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

19

101

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bz5-assembly2.cif.gz_B structure and mechanism of salicylate hydroxylase from pseudomonas putida g7 0.8868 2 24
4bjz-assembly1.cif.gz_A crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: native data 0.8859 3 26
3due-assembly1.cif.gz_A crystal structure of a putative periplasmic protein from duf2874 family (bvu_2987) from bacteroides vulgatus atcc 8482 at 1.85 a resolution 0.8837 3 28
4bk1-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: h213s mutant in complex with 3-hydroxybenzoate 0.8793 3 24
5dqr-assembly2.cif.gz_D the crystal structure of arabidopsis 7-hydroxymethyl chlorophyll a reductase (hcar) 0.8764 2 26
ID Description Score Start End Superfamily
af_Q54GQ0_68_145_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9968 64 97 3.30.2020.30
af_Q80U35_1727_1949_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9609 2 26 2.130.10.10
af_E9Q743_408_712_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9385 3 26 2.130.10.10
af_Q67XN8_89_261_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.932 2 26 2.120.10.80
af_F1Q8Y1_90_381_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9143 3 26 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A354QAQ7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9593 63 100 GO:0046872
AF-A0A4Y8PEY6-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9517 2 100 GO:0046872
AF-A0A838DCV9-F1-model_v4 DUF971 domain-containing protein 0.9494 1 100 GO:0046872
AF-A0A1G3ZU09-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9474 1 97 GO:0046872
AF-A0A2E1QKF7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9464 1 99 GO:0046872

Map