F273406

General Info

Members Datasets Scaffolds Average Seq Length
179 145 169 200

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10219383|Ga0070685_102193832
Length 199
Sequence VSHRKSKILVVVVDDDRLVLATLVHGLLQAGFEVIDADNGDDAILLARQHRPDLVLLDIRMEGKSGFDVAAYLREHGRTPFMFLSAFSDEATVAQVEALGAVAYLVKPLDLGPIVPAVEAALADTQKRRSAVPAAPEAAAPPSLAAAMAVGVLMHRHSLDRSAALERLRVLSHGVGQPIDVQAEHVLEAVELLACYGSA

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221656 Pelomonas sp. Root405 Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
140 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
141 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 0
Rhizoplane 7.82
Rhizosphere 68.16
Stem 0
Stem Tuber 0
Unclassified 10.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014413 3300001979 Bacteria 2917
2 rootL2_10009273 3300003322 Bacteria 31971
3 rootH1_10063881 3300003323 Bacteria 5763
4 Ga0055535_1000229 3300003761 Bacteria 58945
5 Ga0055529_1000064 3300003763 Bacteria 178831
6 Ga0055530_10018311 3300003791 Bacteria 2164
7 Ga0055531_10000043 3300003794 Bacteria 133906
8 Ga0068868_100186722 3300005338 Bacteria 1723
9 Ga0070689_100030848 3300005340 Bacteria 4071
10 Ga0070661_100153121 3300005344 Bacteria 1744
11 Ga0070669_100162899 3300005353 Bacteria 1734
12 Ga0070671_100018378 3300005355 Bacteria 5678
13 Ga0070671_100055211 3300005355 Bacteria 3304
14 Ga0070673_100213013 3300005364 Bacteria 1669
15 Ga0070700_100029720 3300005441 Bacteria 3260
16 Ga0070700_100970202 3300005441 Bacteria 697
17 Ga0070663_100037512 3300005455 Bacteria 3374
18 Ga0070662_100177520 3300005457 Bacteria 1677
19 Ga0068867_100000790 3300005459 Bacteria 21397
20 Ga0068867_100114352 3300005459 Bacteria 2077
21 Ga0068867_100192999 3300005459 Bacteria 1626
22 Ga0070685_10219383 3300005466 Bacteria 1245
23 Ga0068853_100388290 3300005539 Bacteria 1305
24 Ga0070672_100292913 3300005543 Bacteria 1378
25 Ga0070696_101135884 3300005546 Bacteria 658
26 Ga0070664_100303340 3300005564 Bacteria 1444
27 Ga0068852_100343048 3300005616 Bacteria 1456
28 Ga0068852_100617525 3300005616 Bacteria 1089
29 Ga0068859_101277286 3300005617 Bacteria 809
30 Ga0068861_100052343 3300005719 Bacteria 3102
31 Ga0068861_100487339 3300005719 Bacteria 1112
32 Ga0068851_10009404 3300005834 Bacteria 4544
33 Ga0068863_100454809 3300005841 Bacteria 1257
34 Ga0068860_100203141 3300005843 Bacteria 1921
35 Ga0070715_10373763 3300006163 Bacteria 785
36 Ga0070716_100093950 3300006173 Bacteria 1822
37 Ga0075362_10190069 3300006177 Bacteria 997
38 Ga0075366_10006600 3300006195 Bacteria 6366
39 Ga0075366_10107231 3300006195 Bacteria 1680
40 Ga0097621_100358961 3300006237 Bacteria 1298
41 Ga0075370_10002631 3300006353 Bacteria 8381
42 Ga0068871_100298023 3300006358 Bacteria 1414
43 Ga0068865_100084065 3300006881 Bacteria 2292
44 Ga0097620_101277249 3300006931 Bacteria 809
45 Ga0114129_10083555 3300009147 Bacteria 4435
46 Ga0105243_10193984 3300009148 Bacteria 1776
47 Ga0105243_10267838 3300009148 Bacteria 1532
48 Ga0105248_10023381 3300009177 Bacteria 6865
49 Ga0157378_10224187 3300013297 Bacteria 1788
50 Ga0157375_10444887 3300013308 Bacteria 1461
51 Ga0163163_10531929 3300014325 Bacteria 1238
52 Ga0157377_10000091 3300014745 Bacteria 66087
53 Ga0157379_10015173 3300014968 Bacteria 6758
54 Ga0157376_10987463 3300014969 Bacteria 864
55 Ga0209050_1000198 3300025298 Bacteria 134820
56 Ga0209050_1004146 3300025298 Bacteria 10039
57 Ga0209051_1005199 3300025303 Bacteria 7700
58 Ga0209051_1033681 3300025303 Bacteria 1933
59 Ga0207697_10127579 3300025315 Bacteria 1098
60 Ga0207656_10055148 3300025321 Bacteria 1729
61 Ga0207682_10035832 3300025893 Bacteria 2006
62 Ga0207685_10082686 3300025905 Bacteria 1333
63 Ga0207685_10302671 3300025905 Bacteria 792
64 Ga0207644_10029076 3300025931 Bacteria 3831
65 Ga0207644_10091845 3300025931 Bacteria 2264
66 Ga0207706_10000544 3300025933 Bacteria 39990
67 Ga0207709_10022805 3300025935 Bacteria 3555
68 Ga0207709_10115752 3300025935 Bacteria 1801
69 Ga0207669_10092951 3300025937 Bacteria 1969
70 Ga0207704_10297423 3300025938 Bacteria 1235
71 Ga0207691_10328698 3300025940 Bacteria 1310
72 Ga0207711_10098427 3300025941 Bacteria 2584
73 Ga0207711_10112084 3300025941 Bacteria 2427
74 Ga0207679_10018306 3300025945 Bacteria 4690
75 Ga0207679_10441133 3300025945 Bacteria 1153
76 Ga0207677_10163564 3300026023 Bacteria 1732
77 Ga0207708_10043740 3300026075 Bacteria 3413
78 Ga0207641_10171780 3300026088 Bacteria 1979
79 Ga0207648_10002162 3300026089 Bacteria 21355
80 Ga0207648_10100219 3300026089 Bacteria 2537
81 Ga0207648_10270735 3300026089 Bacteria 1517
82 Ga0207683_10045404 3300026121 Bacteria 3842
83 Ga0268264_10239720 3300028381 Bacteria 1679
84 Ga0307517_10168392 3300028786 Bacteria 1448
85 Ga0307515_10000165 3300028794 Bacteria 162589
86 Ga0307515_10202629 3300028794 Bacteria 1855
87 Ga0265328_10017412 3300031239 Bacteria 2783
88 Ga0265331_10001142 3300031250 Bacteria 20259
89 Ga0265327_10000028 3300031251 Bacteria 361066
90 Ga0265316_10006420 3300031344 Bacteria 11234
91 Ga0307509_10010057 3300031507 Bacteria 11671
92 Ga0307509_10027123 3300031507 Bacteria 6377
93 Ga0307516_10260974 3300031730 Bacteria 1423
94 Ga0307510_10169509 3300033180 Bacteria 1764
95 Ga0373949_0067500 3300035090 Bacteria 931
96 Ga0373931_0102008 3300035691 Bacteria 1615
97 Ga0373935_0027435 3300035692 Bacteria 3519
98 Ga0373927_0234091 3300035695 Bacteria 1207
99 Ga0373925_0035879 3300037068 Bacteria 3660
100 Ga0373925_0073961 3300037068 Bacteria 2580
101 Ga0395900_0000025 3300037418 Bacteria 321217
102 Ga0395898_0001478 3300037466 Bacteria 32803
103 Ga0395905_0003941 3300037471 Bacteria 15610
104 Ga0395905_0006983 3300037471 Bacteria 11291
105 Ga0439433_0051784 3300041999 Bacteria 969
106 Ga0439448_0115226 3300042005 Bacteria 920
107 Ga0450888_001058 3300042126 Bacteria 2600
108 Ga0439434_0047401 3300042435 Bacteria 1327
109 Ga0451577_0148551 3300042876 Bacteria 2108
110 Ga0466969_0000097 3300044656 Bacteria 45819
111 Ga0466969_0140382 3300044656 Bacteria 1116
112 Ga0466972_0000265 3300044658 Bacteria 33659
113 Ga0466965_0006970 3300044683 Bacteria 5170
114 Ga0466966_0008359 3300044684 Bacteria 6854
115 Ga0466966_0033241 3300044684 Bacteria 3339
116 Ga0466961_0001117 3300044693 Bacteria 16493
117 Ga0466961_0171197 3300044693 Bacteria 1350
118 Ga0466963_0003216 3300044694 Bacteria 9294
119 Ga0466964_0001370 3300044706 Bacteria 8317
120 Ga0466964_0008166 3300044706 Bacteria 3930
121 Ga0466971_0001747 3300044719 Bacteria 9207
122 Ga0466968_0003408 3300044735 Bacteria 5877
123 Ga0466970_0004434 3300044765 Bacteria 6919
124 Ga0466970_0012383 3300044765 Bacteria 4361
125 Ga0466957_0069942 3300044842 Bacteria 2168
126 Ga0466959_0001732 3300045049 Bacteria 13559
127 Ga0466959_0011978 3300045049 Bacteria 6254
128 Ga0451576_0114772 3300045051 Bacteria 2804
129 Ga0466958_0013745 3300045836 Bacteria 4613
130 Ga0466967_0002439 3300045976 Bacteria 11574
131 Ga0495632_0009457 3300046519 Bacteria 5883
132 Ga0495645_0049560 3300046543 Bacteria 3058
133 Ga0495633_0071011 3300046558 Bacteria 1625
134 Ga0495668_0229042 3300046616 Bacteria 1018
135 Ga0495668_0298025 3300046616 Bacteria 884
136 Ga0495658_0052778 3300046683 Bacteria 2307
137 Ga0495600_0220905 3300046809 Bacteria 1212
138 Ga0496100_0439279 3300048903 Bacteria 999
139 Ga0496102_0186770 3300048905 Bacteria 1953
140 Ga0496104_0048536 3300048907 Bacteria 4002
141 Ga0496104_0083141 3300048907 Bacteria 3053
142 Ga0496105_0111442 3300048908 Bacteria 2258
143 Ga0496106_0258985 3300048909 Bacteria 1392
144 Ga0496108_0083848 3300048911 Bacteria 2704
145 Ga0496108_0226644 3300048911 Bacteria 1624
146 Ga0496108_0832667 3300048911 Bacteria 795
147 Ga0496110_0280558 3300048913 Bacteria 1517
148 Ga0496110_0476149 3300048913 Bacteria 1137
149 Ga0496112_0008219 3300048915 Bacteria 9332
150 Ga0496113_0002254 3300048916 Bacteria 11121
151 Ga0496114_0095882 3300048917 Bacteria 2525
152 Ga0496124_0037638 3300048927 Bacteria 4206
153 Ga0496125_0032460 3300048928 Bacteria 4638
154 Ga0501263_022636 3300049760 Bacteria 853
155 Ga0501035_0223224 3300049822 Bacteria 1608
156 nmdc:mga0k408_347241_c1 3300050493 Bacteria 885
157 nmdc:mga0k408_6123_c1 3300050493 Bacteria 6413
158 nmdc:mga05p37_747109_c1 3300050507 Bacteria 1079
159 Ga0500635_0031055 3300053080 Bacteria 1727
160 Ga0500578_0000006 3300053086 Bacteria 234598
161 Ga0500578_0031594 3300053086 Bacteria 3403
162 Ga0500644_0094193 3300053088 Bacteria 1127
163 Ga0500651_0017840 3300053093 Bacteria 4386
164 Ga0500557_170012 3300053105 Bacteria 712
165 Ga0500593_000146 3300053117 Bacteria 28072
166 Ga0500559_0000092 3300053136 Bacteria 71917
167 Ga0500604_0013413 3300053151 Bacteria 2221
168 Ga0500622_0010150 3300053156 Bacteria 5180
169 Ga0466962_0064439 3300061719 Bacteria 1749

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031507 Ga0307509_10027123 Ga0307509_100271232 182
2 3300003761 Ga0055535_1000229 Ga0055535_100022931 183
3 3300003763 Ga0055529_1000064 Ga0055529_1000064151 183
4 3300006195 Ga0075366_10107231 Ga0075366_101072312 184
5 iso_pu_bacteria 2643221544 2643746414 185
6 iso_pu_bacteria 2643221585 2643933107 185
7 iso_pu_bacteria 2643221656 2644314356 185
8 3300003323 rootH1_10063881 rootH1_100638815 186
9 3300031507 Ga0307509_10010057 Ga0307509_100100578 187
10 3300048905 Ga0496102_0186770 Ga0496102_0186770_1269_1847 187
11 3300048909 Ga0496106_0258985 Ga0496106_0258985_678_1256 187
12 iso_pu_bacteria 2588253510 2588295187 187
13 iso_pu_bacteria 2643221592 2643967013 187
14 iso_pu_bacteria 2643221625 2644142618 187
15 iso_pu_bacteria 2643221648 2644273707 187
16 3300005843 Ga0068860_100203141 Ga0068860_1002031412 188
17 3300014968 Ga0157379_10015173 Ga0157379_100151731 188
18 3300028381 Ga0268264_10239720 Ga0268264_102397202 188
19 3300035692 Ga0373935_0027435 Ga0373935_0027435_2055_2696 188
20 3300035695 Ga0373927_0234091 Ga0373927_0234091_99_740 188
21 3300037068 Ga0373925_0035879 Ga0373925_0035879_2235_2876 188
22 3300046683 Ga0495658_0052778 Ga0495658_0052778_973_1614 188
23 3300046809 Ga0495600_0220905 Ga0495600_0220905_190_831 188
24 3300005338 Ga0068868_100186722 Ga0068868_1001867222 189
25 3300005564 Ga0070664_100303340 Ga0070664_1003033402 189
26 3300005616 Ga0068852_100617525 Ga0068852_1006175251 189
27 3300006237 Ga0097621_100358961 Ga0097621_1003589612 189
28 3300006358 Ga0068871_100298023 Ga0068871_1002980231 189
29 3300025931 Ga0207644_10029076 Ga0207644_100290762 189
30 3300025941 Ga0207711_10098427 Ga0207711_100984271 189
31 3300025945 Ga0207679_10018306 Ga0207679_100183062 189
32 3300025945 Ga0207679_10441133 Ga0207679_104411332 189
33 3300026023 Ga0207677_10163564 Ga0207677_101635642 189
34 iso_pu_bacteria 2643221639 2644217252 189
35 iso_pu_bacteria 2643221646 2644258980 189
36 3300005459 Ga0068867_100192999 Ga0068867_1001929992 190
37 3300026089 Ga0207648_10270735 Ga0207648_102707352 190
38 3300046616 Ga0495668_0229042 Ga0495668_0229042_68_670 190
39 iso_pu_bacteria 2585428062 2587756228 190
40 3300003322 rootL2_10009273 rootL2_100092732 191
41 3300005344 Ga0070661_100153121 Ga0070661_1001531212 191
42 3300005353 Ga0070669_100162899 Ga0070669_1001628992 191
43 3300005441 Ga0070700_100029720 Ga0070700_1000297202 191
44 3300005459 Ga0068867_100114352 Ga0068867_1001143522 191
45 3300005543 Ga0070672_100292913 Ga0070672_1002929131 191
46 3300005719 Ga0068861_100052343 Ga0068861_1000523432 191
47 3300006881 Ga0068865_100084065 Ga0068865_1000840652 191
48 3300009148 Ga0105243_10193984 Ga0105243_101939842 191
49 3300025315 Ga0207697_10127579 Ga0207697_101275792 191
50 3300025905 Ga0207685_10082686 Ga0207685_100826862 191
51 3300025935 Ga0207709_10115752 Ga0207709_101157522 191
52 3300025937 Ga0207669_10092951 Ga0207669_100929512 191
53 3300025940 Ga0207691_10328698 Ga0207691_103286982 191
54 3300026075 Ga0207708_10043740 Ga0207708_100437402 191
55 3300026089 Ga0207648_10100219 Ga0207648_101002193 191
56 3300026121 Ga0207683_10045404 Ga0207683_100454042 191
57 3300028794 Ga0307515_10202629 Ga0307515_102026292 191
58 3300044735 Ga0466968_0003408 Ga0466968_0003408_1187_1792 191
59 3300046519 Ga0495632_0009457 Ga0495632_0009457_1743_2330 191
60 3300048907 Ga0496104_0048536 Ga0496104_0048536_2295_2900 191
61 3300048908 Ga0496105_0111442 Ga0496105_0111442_1465_2070 191
62 3300053151 Ga0500604_0013413 Ga0500604_0013413_1004_1591 191
63 3300005355 Ga0070671_100018378 Ga0070671_1000183782 192
64 3300005546 Ga0070696_101135884 Ga0070696_1011358841 192
65 3300005719 Ga0068861_100487339 Ga0068861_1004873392 192
66 3300005841 Ga0068863_100454809 Ga0068863_1004548092 192
67 3300009177 Ga0105248_10023381 Ga0105248_100233813 192
68 3300025931 Ga0207644_10091845 Ga0207644_100918452 192
69 3300025941 Ga0207711_10112084 Ga0207711_101120842 192
70 3300026088 Ga0207641_10171780 Ga0207641_101717802 192
71 3300031239 Ga0265328_10017412 Ga0265328_100174122 192
72 3300031250 Ga0265331_10001142 Ga0265331_1000114213 192
73 3300031251 Ga0265327_10000028 Ga0265327_10000028122 192
74 3300044656 Ga0466969_0140382 Ga0466969_0140382_98_736 192
75 3300044683 Ga0466965_0006970 Ga0466965_0006970_2500_3138 192
76 3300044684 Ga0466966_0008359 Ga0466966_0008359_5256_5894 192
77 3300044693 Ga0466961_0001117 Ga0466961_0001117_3749_4387 192
78 3300044694 Ga0466963_0003216 Ga0466963_0003216_733_1371 192
79 3300044706 Ga0466964_0001370 Ga0466964_0001370_117_755 192
80 3300044719 Ga0466971_0001747 Ga0466971_0001747_4150_4788 192
81 3300044765 Ga0466970_0004434 Ga0466970_0004434_606_1244 192
82 3300044842 Ga0466957_0069942 Ga0466957_0069942_279_917 192
83 3300045049 Ga0466959_0001732 Ga0466959_0001732_1094_1732 192
84 3300045836 Ga0466958_0013745 Ga0466958_0013745_1105_1743 192
85 3300045976 Ga0466967_0002439 Ga0466967_0002439_6142_6780 192
86 3300048907 Ga0496104_0083141 Ga0496104_0083141_1525_2115 192
87 3300048911 Ga0496108_0226644 Ga0496108_0226644_975_1565 192
88 3300048911 Ga0496108_0832667 Ga0496108_0832667_89_679 192
89 3300048913 Ga0496110_0476149 Ga0496110_0476149_279_869 192
90 3300048915 Ga0496112_0008219 Ga0496112_0008219_4875_5465 192
91 3300048916 Ga0496113_0002254 Ga0496113_0002254_8363_8953 192
92 3300050493 nmdc:mga0k408_347241_c1 nmdc:mga0k408_347241_c1_176_793 192
93 3300061719 Ga0466962_0064439 Ga0466962_0064439_961_1599 192
94 3300003794 Ga0055531_10000043 Ga0055531_1000004310 193
95 3300005539 Ga0068853_100388290 Ga0068853_1003882901 193
96 3300025298 Ga0209050_1004146 Ga0209050_10041466 193
97 3300025303 Ga0209051_1005199 Ga0209051_10051994 193
98 3300046543 Ga0495645_0049560 Ga0495645_0049560_1012_1638 193
99 3300048927 Ga0496124_0037638 Ga0496124_0037638_1403_2008 193
100 3300049760 Ga0501263_022636 Ga0501263_022636_80_691 193
101 3300053105 Ga0500557_170012 Ga0500557_170012_94_687 193
102 3300003791 Ga0055530_10018311 Ga0055530_100183112 194
103 3300005459 Ga0068867_100000790 Ga0068867_1000007901 194
104 3300009147 Ga0114129_10083555 Ga0114129_100835552 194
105 3300009148 Ga0105243_10267838 Ga0105243_102678382 194
106 3300014745 Ga0157377_10000091 Ga0157377_1000009163 194
107 3300025298 Ga0209050_1000198 Ga0209050_100019811 194
108 3300025303 Ga0209051_1033681 Ga0209051_10336812 194
109 3300025935 Ga0207709_10022805 Ga0207709_100228051 194
110 3300026089 Ga0207648_10002162 Ga0207648_100021621 194
111 3300028786 Ga0307517_10168392 Ga0307517_101683922 194
112 3300031344 Ga0265316_10006420 Ga0265316_100064205 194
113 3300042126 Ga0450888_001058 Ga0450888_001058_909_1526 194
114 3300042435 Ga0439434_0047401 Ga0439434_0047401_78_695 194
115 3300042876 Ga0451577_0148551 Ga0451577_0148551_727_1338 194
116 3300045051 Ga0451576_0114772 Ga0451576_0114772_1434_2045 194
117 3300046616 Ga0495668_0298025 Ga0495668_0298025_236_832 194
118 3300050507 nmdc:mga05p37_747109_c1 nmdc:mga05p37_747109_c1_318_926 194
119 3300053086 Ga0500578_0000006 Ga0500578_0000006_134326_134922 194
120 3300053117 Ga0500593_000146 Ga0500593_000146_16377_16976 194
121 3300005466 Ga0070685_10219383 Ga0070685_102193832 195
122 3300035090 Ga0373949_0067500 Ga0373949_0067500_305_904 195
123 3300035691 Ga0373931_0102008 Ga0373931_0102008_457_1056 195
124 3300005340 Ga0070689_100030848 Ga0070689_1000308482 196
125 3300025893 Ga0207682_10035832 Ga0207682_100358323 196
126 3300033180 Ga0307510_10169509 Ga0307510_101695092 196
127 3300037471 Ga0395905_0003941 Ga0395905_0003941_10735_11349 196
128 3300048913 Ga0496110_0280558 Ga0496110_0280558_805_1437 196
129 3300048917 Ga0496114_0095882 Ga0496114_0095882_1269_1895 196
130 3300053093 Ga0500651_0017840 Ga0500651_0017840_3381_3983 196
131 3300053136 Ga0500559_0000092 Ga0500559_0000092_25766_26368 196
132 3300053156 Ga0500622_0010150 Ga0500622_0010150_3614_4216 196
133 3300041999 Ga0439433_0051784 Ga0439433_0051784_18_647 197
134 3300042005 Ga0439448_0115226 Ga0439448_0115226_223_840 197
135 3300005457 Ga0070662_100177520 Ga0070662_1001775202 198
136 3300025933 Ga0207706_10000544 Ga0207706_100005449 198
137 3300037068 Ga0373925_0073961 Ga0373925_0073961_725_1363 198
138 3300044656 Ga0466969_0000097 Ga0466969_0000097_41287_41907 198
139 3300044684 Ga0466966_0033241 Ga0466966_0033241_1685_2305 198
140 3300044693 Ga0466961_0171197 Ga0466961_0171197_354_974 198
141 3300044765 Ga0466970_0012383 Ga0466970_0012383_3511_4131 198
142 3300045049 Ga0466959_0011978 Ga0466959_0011978_440_1060 198
143 3300005355 Ga0070671_100055211 Ga0070671_1000552112 199
144 3300005364 Ga0070673_100213013 Ga0070673_1002130132 199
145 3300005441 Ga0070700_100970202 Ga0070700_1009702021 199
146 3300005455 Ga0070663_100037512 Ga0070663_1000375122 199
147 3300005616 Ga0068852_100343048 Ga0068852_1003430482 199
148 3300005617 Ga0068859_101277286 Ga0068859_1012772862 199
149 3300005834 Ga0068851_10009404 Ga0068851_100094042 199
150 3300006163 Ga0070715_10373763 Ga0070715_103737631 199
151 3300006173 Ga0070716_100093950 Ga0070716_1000939502 199
152 3300006931 Ga0097620_101277249 Ga0097620_1012772492 199
153 3300013297 Ga0157378_10224187 Ga0157378_102241872 199
154 3300013308 Ga0157375_10444887 Ga0157375_104448872 199
155 3300014325 Ga0163163_10531929 Ga0163163_105319291 199
156 3300025321 Ga0207656_10055148 Ga0207656_100551482 199
157 3300025905 Ga0207685_10302671 Ga0207685_103026711 199
158 3300025938 Ga0207704_10297423 Ga0207704_102974232 199
159 3300046558 Ga0495633_0071011 Ga0495633_0071011_39_665 199
160 3300048903 Ga0496100_0439279 Ga0496100_0439279_31_657 199
161 3300048911 Ga0496108_0083848 Ga0496108_0083848_160_786 199
162 3300014969 Ga0157376_10987463 Ga0157376_109874631 201
163 3300028794 Ga0307515_10000165 Ga0307515_1000016522 201
164 3300049822 Ga0501035_0223224 Ga0501035_0223224_67_702 201
165 3300006353 Ga0075370_10002631 Ga0075370_100026314 202
166 3300037418 Ga0395900_0000025 Ga0395900_0000025_42937_43590 202
167 3300037466 Ga0395898_0001478 Ga0395898_0001478_12426_13079 202
168 3300037471 Ga0395905_0006983 Ga0395905_0006983_2440_3066 202
169 3300044658 Ga0466972_0000265 Ga0466972_0000265_31537_32172 202
170 3300044706 Ga0466964_0008166 Ga0466964_0008166_1259_1894 202
171 3300053088 Ga0500644_0094193 Ga0500644_0094193_176_826 209
172 3300031730 Ga0307516_10260974 Ga0307516_102609742 210
173 3300048928 Ga0496125_0032460 Ga0496125_0032460_2800_3459 212
174 3300006177 Ga0075362_10190069 Ga0075362_101900692 215
175 3300006195 Ga0075366_10006600 Ga0075366_100066002 215
176 3300050493 nmdc:mga0k408_6123_c1 nmdc:mga0k408_6123_c1_2010_2672 215
177 3300053080 Ga0500635_0031055 Ga0500635_0031055_1026_1694 217
178 3300053086 Ga0500578_0031594 Ga0500578_0031594_959_1627 217
179 3300001979 JGI24740J21852_10014413 JGI24740J21852_100144133 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

10

119

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9733 45 160
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9725 45 160
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9714 45 160
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9659 45 161
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9643 43 162
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9703 45 122 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.969 45 122 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 45 122 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9633 45 122 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9627 45 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-L1Q4D4-F1-model_v4 Heme response regulator HssR (Stage 0 sporulation protein A homolog) 0.973 45 165 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1M5AKB7-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9716 45 162 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0016301
GO:0032993
AF-A0A1H0NM22-F1-model_v4 Two component transcriptional regulator, winged helix family 0.971 43 161 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3C1LW34-F1-model_v4 Stage 0 sporulation protein A homolog 0.9695 44 160 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3L7XQ34-F1-model_v4 Response regulator 0.9672 45 159 GO:0000160

Feature Viewer

pLDDT pTM Quality
76.94 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map