F273406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 179 | 145 | 169 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_10219383|Ga0070685_102193832 |
| Length | 199 |
| Sequence | VSHRKSKILVVVVDDDRLVLATLVHGLLQAGFEVIDADNGDDAILLARQHRPDLVLLDIRMEGKSGFDVAAYLREHGRTPFMFLSAFSDEATVAQVEALGAVAYLVKPLDLGPIVPAVEAALADTQKRRSAVPAAPEAAAPPSLAAAMAVGVLMHRHSLDRSAALERLRVLSHGVGQPIDVQAEHVLEAVELLACYGSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 3 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 4 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 8 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 9 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 10 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 82 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 84 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 85 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 86 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 87 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 88 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 89 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 90 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 94 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 95 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 96 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 97 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 98 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 99 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 100 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 101 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 102 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 105 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 106 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 107 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 111 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 129 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 130 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 131 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 132 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 133 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 135 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 137 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 138 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 139 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 140 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 141 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 142 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 143 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 144 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 145 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 0 |
| Isolates | 5.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.41 |
| Nodule | 0 |
| Rhizoplane | 7.82 |
| Rhizosphere | 68.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014413 | 3300001979 | Bacteria | 2917 |
| 2 | rootL2_10009273 | 3300003322 | Bacteria | 31971 |
| 3 | rootH1_10063881 | 3300003323 | Bacteria | 5763 |
| 4 | Ga0055535_1000229 | 3300003761 | Bacteria | 58945 |
| 5 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 6 | Ga0055530_10018311 | 3300003791 | Bacteria | 2164 |
| 7 | Ga0055531_10000043 | 3300003794 | Bacteria | 133906 |
| 8 | Ga0068868_100186722 | 3300005338 | Bacteria | 1723 |
| 9 | Ga0070689_100030848 | 3300005340 | Bacteria | 4071 |
| 10 | Ga0070661_100153121 | 3300005344 | Bacteria | 1744 |
| 11 | Ga0070669_100162899 | 3300005353 | Bacteria | 1734 |
| 12 | Ga0070671_100018378 | 3300005355 | Bacteria | 5678 |
| 13 | Ga0070671_100055211 | 3300005355 | Bacteria | 3304 |
| 14 | Ga0070673_100213013 | 3300005364 | Bacteria | 1669 |
| 15 | Ga0070700_100029720 | 3300005441 | Bacteria | 3260 |
| 16 | Ga0070700_100970202 | 3300005441 | Bacteria | 697 |
| 17 | Ga0070663_100037512 | 3300005455 | Bacteria | 3374 |
| 18 | Ga0070662_100177520 | 3300005457 | Bacteria | 1677 |
| 19 | Ga0068867_100000790 | 3300005459 | Bacteria | 21397 |
| 20 | Ga0068867_100114352 | 3300005459 | Bacteria | 2077 |
| 21 | Ga0068867_100192999 | 3300005459 | Bacteria | 1626 |
| 22 | Ga0070685_10219383 | 3300005466 | Bacteria | 1245 |
| 23 | Ga0068853_100388290 | 3300005539 | Bacteria | 1305 |
| 24 | Ga0070672_100292913 | 3300005543 | Bacteria | 1378 |
| 25 | Ga0070696_101135884 | 3300005546 | Bacteria | 658 |
| 26 | Ga0070664_100303340 | 3300005564 | Bacteria | 1444 |
| 27 | Ga0068852_100343048 | 3300005616 | Bacteria | 1456 |
| 28 | Ga0068852_100617525 | 3300005616 | Bacteria | 1089 |
| 29 | Ga0068859_101277286 | 3300005617 | Bacteria | 809 |
| 30 | Ga0068861_100052343 | 3300005719 | Bacteria | 3102 |
| 31 | Ga0068861_100487339 | 3300005719 | Bacteria | 1112 |
| 32 | Ga0068851_10009404 | 3300005834 | Bacteria | 4544 |
| 33 | Ga0068863_100454809 | 3300005841 | Bacteria | 1257 |
| 34 | Ga0068860_100203141 | 3300005843 | Bacteria | 1921 |
| 35 | Ga0070715_10373763 | 3300006163 | Bacteria | 785 |
| 36 | Ga0070716_100093950 | 3300006173 | Bacteria | 1822 |
| 37 | Ga0075362_10190069 | 3300006177 | Bacteria | 997 |
| 38 | Ga0075366_10006600 | 3300006195 | Bacteria | 6366 |
| 39 | Ga0075366_10107231 | 3300006195 | Bacteria | 1680 |
| 40 | Ga0097621_100358961 | 3300006237 | Bacteria | 1298 |
| 41 | Ga0075370_10002631 | 3300006353 | Bacteria | 8381 |
| 42 | Ga0068871_100298023 | 3300006358 | Bacteria | 1414 |
| 43 | Ga0068865_100084065 | 3300006881 | Bacteria | 2292 |
| 44 | Ga0097620_101277249 | 3300006931 | Bacteria | 809 |
| 45 | Ga0114129_10083555 | 3300009147 | Bacteria | 4435 |
| 46 | Ga0105243_10193984 | 3300009148 | Bacteria | 1776 |
| 47 | Ga0105243_10267838 | 3300009148 | Bacteria | 1532 |
| 48 | Ga0105248_10023381 | 3300009177 | Bacteria | 6865 |
| 49 | Ga0157378_10224187 | 3300013297 | Bacteria | 1788 |
| 50 | Ga0157375_10444887 | 3300013308 | Bacteria | 1461 |
| 51 | Ga0163163_10531929 | 3300014325 | Bacteria | 1238 |
| 52 | Ga0157377_10000091 | 3300014745 | Bacteria | 66087 |
| 53 | Ga0157379_10015173 | 3300014968 | Bacteria | 6758 |
| 54 | Ga0157376_10987463 | 3300014969 | Bacteria | 864 |
| 55 | Ga0209050_1000198 | 3300025298 | Bacteria | 134820 |
| 56 | Ga0209050_1004146 | 3300025298 | Bacteria | 10039 |
| 57 | Ga0209051_1005199 | 3300025303 | Bacteria | 7700 |
| 58 | Ga0209051_1033681 | 3300025303 | Bacteria | 1933 |
| 59 | Ga0207697_10127579 | 3300025315 | Bacteria | 1098 |
| 60 | Ga0207656_10055148 | 3300025321 | Bacteria | 1729 |
| 61 | Ga0207682_10035832 | 3300025893 | Bacteria | 2006 |
| 62 | Ga0207685_10082686 | 3300025905 | Bacteria | 1333 |
| 63 | Ga0207685_10302671 | 3300025905 | Bacteria | 792 |
| 64 | Ga0207644_10029076 | 3300025931 | Bacteria | 3831 |
| 65 | Ga0207644_10091845 | 3300025931 | Bacteria | 2264 |
| 66 | Ga0207706_10000544 | 3300025933 | Bacteria | 39990 |
| 67 | Ga0207709_10022805 | 3300025935 | Bacteria | 3555 |
| 68 | Ga0207709_10115752 | 3300025935 | Bacteria | 1801 |
| 69 | Ga0207669_10092951 | 3300025937 | Bacteria | 1969 |
| 70 | Ga0207704_10297423 | 3300025938 | Bacteria | 1235 |
| 71 | Ga0207691_10328698 | 3300025940 | Bacteria | 1310 |
| 72 | Ga0207711_10098427 | 3300025941 | Bacteria | 2584 |
| 73 | Ga0207711_10112084 | 3300025941 | Bacteria | 2427 |
| 74 | Ga0207679_10018306 | 3300025945 | Bacteria | 4690 |
| 75 | Ga0207679_10441133 | 3300025945 | Bacteria | 1153 |
| 76 | Ga0207677_10163564 | 3300026023 | Bacteria | 1732 |
| 77 | Ga0207708_10043740 | 3300026075 | Bacteria | 3413 |
| 78 | Ga0207641_10171780 | 3300026088 | Bacteria | 1979 |
| 79 | Ga0207648_10002162 | 3300026089 | Bacteria | 21355 |
| 80 | Ga0207648_10100219 | 3300026089 | Bacteria | 2537 |
| 81 | Ga0207648_10270735 | 3300026089 | Bacteria | 1517 |
| 82 | Ga0207683_10045404 | 3300026121 | Bacteria | 3842 |
| 83 | Ga0268264_10239720 | 3300028381 | Bacteria | 1679 |
| 84 | Ga0307517_10168392 | 3300028786 | Bacteria | 1448 |
| 85 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 86 | Ga0307515_10202629 | 3300028794 | Bacteria | 1855 |
| 87 | Ga0265328_10017412 | 3300031239 | Bacteria | 2783 |
| 88 | Ga0265331_10001142 | 3300031250 | Bacteria | 20259 |
| 89 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 90 | Ga0265316_10006420 | 3300031344 | Bacteria | 11234 |
| 91 | Ga0307509_10010057 | 3300031507 | Bacteria | 11671 |
| 92 | Ga0307509_10027123 | 3300031507 | Bacteria | 6377 |
| 93 | Ga0307516_10260974 | 3300031730 | Bacteria | 1423 |
| 94 | Ga0307510_10169509 | 3300033180 | Bacteria | 1764 |
| 95 | Ga0373949_0067500 | 3300035090 | Bacteria | 931 |
| 96 | Ga0373931_0102008 | 3300035691 | Bacteria | 1615 |
| 97 | Ga0373935_0027435 | 3300035692 | Bacteria | 3519 |
| 98 | Ga0373927_0234091 | 3300035695 | Bacteria | 1207 |
| 99 | Ga0373925_0035879 | 3300037068 | Bacteria | 3660 |
| 100 | Ga0373925_0073961 | 3300037068 | Bacteria | 2580 |
| 101 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 102 | Ga0395898_0001478 | 3300037466 | Bacteria | 32803 |
| 103 | Ga0395905_0003941 | 3300037471 | Bacteria | 15610 |
| 104 | Ga0395905_0006983 | 3300037471 | Bacteria | 11291 |
| 105 | Ga0439433_0051784 | 3300041999 | Bacteria | 969 |
| 106 | Ga0439448_0115226 | 3300042005 | Bacteria | 920 |
| 107 | Ga0450888_001058 | 3300042126 | Bacteria | 2600 |
| 108 | Ga0439434_0047401 | 3300042435 | Bacteria | 1327 |
| 109 | Ga0451577_0148551 | 3300042876 | Bacteria | 2108 |
| 110 | Ga0466969_0000097 | 3300044656 | Bacteria | 45819 |
| 111 | Ga0466969_0140382 | 3300044656 | Bacteria | 1116 |
| 112 | Ga0466972_0000265 | 3300044658 | Bacteria | 33659 |
| 113 | Ga0466965_0006970 | 3300044683 | Bacteria | 5170 |
| 114 | Ga0466966_0008359 | 3300044684 | Bacteria | 6854 |
| 115 | Ga0466966_0033241 | 3300044684 | Bacteria | 3339 |
| 116 | Ga0466961_0001117 | 3300044693 | Bacteria | 16493 |
| 117 | Ga0466961_0171197 | 3300044693 | Bacteria | 1350 |
| 118 | Ga0466963_0003216 | 3300044694 | Bacteria | 9294 |
| 119 | Ga0466964_0001370 | 3300044706 | Bacteria | 8317 |
| 120 | Ga0466964_0008166 | 3300044706 | Bacteria | 3930 |
| 121 | Ga0466971_0001747 | 3300044719 | Bacteria | 9207 |
| 122 | Ga0466968_0003408 | 3300044735 | Bacteria | 5877 |
| 123 | Ga0466970_0004434 | 3300044765 | Bacteria | 6919 |
| 124 | Ga0466970_0012383 | 3300044765 | Bacteria | 4361 |
| 125 | Ga0466957_0069942 | 3300044842 | Bacteria | 2168 |
| 126 | Ga0466959_0001732 | 3300045049 | Bacteria | 13559 |
| 127 | Ga0466959_0011978 | 3300045049 | Bacteria | 6254 |
| 128 | Ga0451576_0114772 | 3300045051 | Bacteria | 2804 |
| 129 | Ga0466958_0013745 | 3300045836 | Bacteria | 4613 |
| 130 | Ga0466967_0002439 | 3300045976 | Bacteria | 11574 |
| 131 | Ga0495632_0009457 | 3300046519 | Bacteria | 5883 |
| 132 | Ga0495645_0049560 | 3300046543 | Bacteria | 3058 |
| 133 | Ga0495633_0071011 | 3300046558 | Bacteria | 1625 |
| 134 | Ga0495668_0229042 | 3300046616 | Bacteria | 1018 |
| 135 | Ga0495668_0298025 | 3300046616 | Bacteria | 884 |
| 136 | Ga0495658_0052778 | 3300046683 | Bacteria | 2307 |
| 137 | Ga0495600_0220905 | 3300046809 | Bacteria | 1212 |
| 138 | Ga0496100_0439279 | 3300048903 | Bacteria | 999 |
| 139 | Ga0496102_0186770 | 3300048905 | Bacteria | 1953 |
| 140 | Ga0496104_0048536 | 3300048907 | Bacteria | 4002 |
| 141 | Ga0496104_0083141 | 3300048907 | Bacteria | 3053 |
| 142 | Ga0496105_0111442 | 3300048908 | Bacteria | 2258 |
| 143 | Ga0496106_0258985 | 3300048909 | Bacteria | 1392 |
| 144 | Ga0496108_0083848 | 3300048911 | Bacteria | 2704 |
| 145 | Ga0496108_0226644 | 3300048911 | Bacteria | 1624 |
| 146 | Ga0496108_0832667 | 3300048911 | Bacteria | 795 |
| 147 | Ga0496110_0280558 | 3300048913 | Bacteria | 1517 |
| 148 | Ga0496110_0476149 | 3300048913 | Bacteria | 1137 |
| 149 | Ga0496112_0008219 | 3300048915 | Bacteria | 9332 |
| 150 | Ga0496113_0002254 | 3300048916 | Bacteria | 11121 |
| 151 | Ga0496114_0095882 | 3300048917 | Bacteria | 2525 |
| 152 | Ga0496124_0037638 | 3300048927 | Bacteria | 4206 |
| 153 | Ga0496125_0032460 | 3300048928 | Bacteria | 4638 |
| 154 | Ga0501263_022636 | 3300049760 | Bacteria | 853 |
| 155 | Ga0501035_0223224 | 3300049822 | Bacteria | 1608 |
| 156 | nmdc:mga0k408_347241_c1 | 3300050493 | Bacteria | 885 |
| 157 | nmdc:mga0k408_6123_c1 | 3300050493 | Bacteria | 6413 |
| 158 | nmdc:mga05p37_747109_c1 | 3300050507 | Bacteria | 1079 |
| 159 | Ga0500635_0031055 | 3300053080 | Bacteria | 1727 |
| 160 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 161 | Ga0500578_0031594 | 3300053086 | Bacteria | 3403 |
| 162 | Ga0500644_0094193 | 3300053088 | Bacteria | 1127 |
| 163 | Ga0500651_0017840 | 3300053093 | Bacteria | 4386 |
| 164 | Ga0500557_170012 | 3300053105 | Bacteria | 712 |
| 165 | Ga0500593_000146 | 3300053117 | Bacteria | 28072 |
| 166 | Ga0500559_0000092 | 3300053136 | Bacteria | 71917 |
| 167 | Ga0500604_0013413 | 3300053151 | Bacteria | 2221 |
| 168 | Ga0500622_0010150 | 3300053156 | Bacteria | 5180 |
| 169 | Ga0466962_0064439 | 3300061719 | Bacteria | 1749 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031507 | Ga0307509_10027123 | Ga0307509_100271232 | 182 |
| 2 | 3300003761 | Ga0055535_1000229 | Ga0055535_100022931 | 183 |
| 3 | 3300003763 | Ga0055529_1000064 | Ga0055529_1000064151 | 183 |
| 4 | 3300006195 | Ga0075366_10107231 | Ga0075366_101072312 | 184 |
| 5 | iso_pu_bacteria | 2643221544 | 2643746414 | 185 |
| 6 | iso_pu_bacteria | 2643221585 | 2643933107 | 185 |
| 7 | iso_pu_bacteria | 2643221656 | 2644314356 | 185 |
| 8 | 3300003323 | rootH1_10063881 | rootH1_100638815 | 186 |
| 9 | 3300031507 | Ga0307509_10010057 | Ga0307509_100100578 | 187 |
| 10 | 3300048905 | Ga0496102_0186770 | Ga0496102_0186770_1269_1847 | 187 |
| 11 | 3300048909 | Ga0496106_0258985 | Ga0496106_0258985_678_1256 | 187 |
| 12 | iso_pu_bacteria | 2588253510 | 2588295187 | 187 |
| 13 | iso_pu_bacteria | 2643221592 | 2643967013 | 187 |
| 14 | iso_pu_bacteria | 2643221625 | 2644142618 | 187 |
| 15 | iso_pu_bacteria | 2643221648 | 2644273707 | 187 |
| 16 | 3300005843 | Ga0068860_100203141 | Ga0068860_1002031412 | 188 |
| 17 | 3300014968 | Ga0157379_10015173 | Ga0157379_100151731 | 188 |
| 18 | 3300028381 | Ga0268264_10239720 | Ga0268264_102397202 | 188 |
| 19 | 3300035692 | Ga0373935_0027435 | Ga0373935_0027435_2055_2696 | 188 |
| 20 | 3300035695 | Ga0373927_0234091 | Ga0373927_0234091_99_740 | 188 |
| 21 | 3300037068 | Ga0373925_0035879 | Ga0373925_0035879_2235_2876 | 188 |
| 22 | 3300046683 | Ga0495658_0052778 | Ga0495658_0052778_973_1614 | 188 |
| 23 | 3300046809 | Ga0495600_0220905 | Ga0495600_0220905_190_831 | 188 |
| 24 | 3300005338 | Ga0068868_100186722 | Ga0068868_1001867222 | 189 |
| 25 | 3300005564 | Ga0070664_100303340 | Ga0070664_1003033402 | 189 |
| 26 | 3300005616 | Ga0068852_100617525 | Ga0068852_1006175251 | 189 |
| 27 | 3300006237 | Ga0097621_100358961 | Ga0097621_1003589612 | 189 |
| 28 | 3300006358 | Ga0068871_100298023 | Ga0068871_1002980231 | 189 |
| 29 | 3300025931 | Ga0207644_10029076 | Ga0207644_100290762 | 189 |
| 30 | 3300025941 | Ga0207711_10098427 | Ga0207711_100984271 | 189 |
| 31 | 3300025945 | Ga0207679_10018306 | Ga0207679_100183062 | 189 |
| 32 | 3300025945 | Ga0207679_10441133 | Ga0207679_104411332 | 189 |
| 33 | 3300026023 | Ga0207677_10163564 | Ga0207677_101635642 | 189 |
| 34 | iso_pu_bacteria | 2643221639 | 2644217252 | 189 |
| 35 | iso_pu_bacteria | 2643221646 | 2644258980 | 189 |
| 36 | 3300005459 | Ga0068867_100192999 | Ga0068867_1001929992 | 190 |
| 37 | 3300026089 | Ga0207648_10270735 | Ga0207648_102707352 | 190 |
| 38 | 3300046616 | Ga0495668_0229042 | Ga0495668_0229042_68_670 | 190 |
| 39 | iso_pu_bacteria | 2585428062 | 2587756228 | 190 |
| 40 | 3300003322 | rootL2_10009273 | rootL2_100092732 | 191 |
| 41 | 3300005344 | Ga0070661_100153121 | Ga0070661_1001531212 | 191 |
| 42 | 3300005353 | Ga0070669_100162899 | Ga0070669_1001628992 | 191 |
| 43 | 3300005441 | Ga0070700_100029720 | Ga0070700_1000297202 | 191 |
| 44 | 3300005459 | Ga0068867_100114352 | Ga0068867_1001143522 | 191 |
| 45 | 3300005543 | Ga0070672_100292913 | Ga0070672_1002929131 | 191 |
| 46 | 3300005719 | Ga0068861_100052343 | Ga0068861_1000523432 | 191 |
| 47 | 3300006881 | Ga0068865_100084065 | Ga0068865_1000840652 | 191 |
| 48 | 3300009148 | Ga0105243_10193984 | Ga0105243_101939842 | 191 |
| 49 | 3300025315 | Ga0207697_10127579 | Ga0207697_101275792 | 191 |
| 50 | 3300025905 | Ga0207685_10082686 | Ga0207685_100826862 | 191 |
| 51 | 3300025935 | Ga0207709_10115752 | Ga0207709_101157522 | 191 |
| 52 | 3300025937 | Ga0207669_10092951 | Ga0207669_100929512 | 191 |
| 53 | 3300025940 | Ga0207691_10328698 | Ga0207691_103286982 | 191 |
| 54 | 3300026075 | Ga0207708_10043740 | Ga0207708_100437402 | 191 |
| 55 | 3300026089 | Ga0207648_10100219 | Ga0207648_101002193 | 191 |
| 56 | 3300026121 | Ga0207683_10045404 | Ga0207683_100454042 | 191 |
| 57 | 3300028794 | Ga0307515_10202629 | Ga0307515_102026292 | 191 |
| 58 | 3300044735 | Ga0466968_0003408 | Ga0466968_0003408_1187_1792 | 191 |
| 59 | 3300046519 | Ga0495632_0009457 | Ga0495632_0009457_1743_2330 | 191 |
| 60 | 3300048907 | Ga0496104_0048536 | Ga0496104_0048536_2295_2900 | 191 |
| 61 | 3300048908 | Ga0496105_0111442 | Ga0496105_0111442_1465_2070 | 191 |
| 62 | 3300053151 | Ga0500604_0013413 | Ga0500604_0013413_1004_1591 | 191 |
| 63 | 3300005355 | Ga0070671_100018378 | Ga0070671_1000183782 | 192 |
| 64 | 3300005546 | Ga0070696_101135884 | Ga0070696_1011358841 | 192 |
| 65 | 3300005719 | Ga0068861_100487339 | Ga0068861_1004873392 | 192 |
| 66 | 3300005841 | Ga0068863_100454809 | Ga0068863_1004548092 | 192 |
| 67 | 3300009177 | Ga0105248_10023381 | Ga0105248_100233813 | 192 |
| 68 | 3300025931 | Ga0207644_10091845 | Ga0207644_100918452 | 192 |
| 69 | 3300025941 | Ga0207711_10112084 | Ga0207711_101120842 | 192 |
| 70 | 3300026088 | Ga0207641_10171780 | Ga0207641_101717802 | 192 |
| 71 | 3300031239 | Ga0265328_10017412 | Ga0265328_100174122 | 192 |
| 72 | 3300031250 | Ga0265331_10001142 | Ga0265331_1000114213 | 192 |
| 73 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028122 | 192 |
| 74 | 3300044656 | Ga0466969_0140382 | Ga0466969_0140382_98_736 | 192 |
| 75 | 3300044683 | Ga0466965_0006970 | Ga0466965_0006970_2500_3138 | 192 |
| 76 | 3300044684 | Ga0466966_0008359 | Ga0466966_0008359_5256_5894 | 192 |
| 77 | 3300044693 | Ga0466961_0001117 | Ga0466961_0001117_3749_4387 | 192 |
| 78 | 3300044694 | Ga0466963_0003216 | Ga0466963_0003216_733_1371 | 192 |
| 79 | 3300044706 | Ga0466964_0001370 | Ga0466964_0001370_117_755 | 192 |
| 80 | 3300044719 | Ga0466971_0001747 | Ga0466971_0001747_4150_4788 | 192 |
| 81 | 3300044765 | Ga0466970_0004434 | Ga0466970_0004434_606_1244 | 192 |
| 82 | 3300044842 | Ga0466957_0069942 | Ga0466957_0069942_279_917 | 192 |
| 83 | 3300045049 | Ga0466959_0001732 | Ga0466959_0001732_1094_1732 | 192 |
| 84 | 3300045836 | Ga0466958_0013745 | Ga0466958_0013745_1105_1743 | 192 |
| 85 | 3300045976 | Ga0466967_0002439 | Ga0466967_0002439_6142_6780 | 192 |
| 86 | 3300048907 | Ga0496104_0083141 | Ga0496104_0083141_1525_2115 | 192 |
| 87 | 3300048911 | Ga0496108_0226644 | Ga0496108_0226644_975_1565 | 192 |
| 88 | 3300048911 | Ga0496108_0832667 | Ga0496108_0832667_89_679 | 192 |
| 89 | 3300048913 | Ga0496110_0476149 | Ga0496110_0476149_279_869 | 192 |
| 90 | 3300048915 | Ga0496112_0008219 | Ga0496112_0008219_4875_5465 | 192 |
| 91 | 3300048916 | Ga0496113_0002254 | Ga0496113_0002254_8363_8953 | 192 |
| 92 | 3300050493 | nmdc:mga0k408_347241_c1 | nmdc:mga0k408_347241_c1_176_793 | 192 |
| 93 | 3300061719 | Ga0466962_0064439 | Ga0466962_0064439_961_1599 | 192 |
| 94 | 3300003794 | Ga0055531_10000043 | Ga0055531_1000004310 | 193 |
| 95 | 3300005539 | Ga0068853_100388290 | Ga0068853_1003882901 | 193 |
| 96 | 3300025298 | Ga0209050_1004146 | Ga0209050_10041466 | 193 |
| 97 | 3300025303 | Ga0209051_1005199 | Ga0209051_10051994 | 193 |
| 98 | 3300046543 | Ga0495645_0049560 | Ga0495645_0049560_1012_1638 | 193 |
| 99 | 3300048927 | Ga0496124_0037638 | Ga0496124_0037638_1403_2008 | 193 |
| 100 | 3300049760 | Ga0501263_022636 | Ga0501263_022636_80_691 | 193 |
| 101 | 3300053105 | Ga0500557_170012 | Ga0500557_170012_94_687 | 193 |
| 102 | 3300003791 | Ga0055530_10018311 | Ga0055530_100183112 | 194 |
| 103 | 3300005459 | Ga0068867_100000790 | Ga0068867_1000007901 | 194 |
| 104 | 3300009147 | Ga0114129_10083555 | Ga0114129_100835552 | 194 |
| 105 | 3300009148 | Ga0105243_10267838 | Ga0105243_102678382 | 194 |
| 106 | 3300014745 | Ga0157377_10000091 | Ga0157377_1000009163 | 194 |
| 107 | 3300025298 | Ga0209050_1000198 | Ga0209050_100019811 | 194 |
| 108 | 3300025303 | Ga0209051_1033681 | Ga0209051_10336812 | 194 |
| 109 | 3300025935 | Ga0207709_10022805 | Ga0207709_100228051 | 194 |
| 110 | 3300026089 | Ga0207648_10002162 | Ga0207648_100021621 | 194 |
| 111 | 3300028786 | Ga0307517_10168392 | Ga0307517_101683922 | 194 |
| 112 | 3300031344 | Ga0265316_10006420 | Ga0265316_100064205 | 194 |
| 113 | 3300042126 | Ga0450888_001058 | Ga0450888_001058_909_1526 | 194 |
| 114 | 3300042435 | Ga0439434_0047401 | Ga0439434_0047401_78_695 | 194 |
| 115 | 3300042876 | Ga0451577_0148551 | Ga0451577_0148551_727_1338 | 194 |
| 116 | 3300045051 | Ga0451576_0114772 | Ga0451576_0114772_1434_2045 | 194 |
| 117 | 3300046616 | Ga0495668_0298025 | Ga0495668_0298025_236_832 | 194 |
| 118 | 3300050507 | nmdc:mga05p37_747109_c1 | nmdc:mga05p37_747109_c1_318_926 | 194 |
| 119 | 3300053086 | Ga0500578_0000006 | Ga0500578_0000006_134326_134922 | 194 |
| 120 | 3300053117 | Ga0500593_000146 | Ga0500593_000146_16377_16976 | 194 |
| 121 | 3300005466 | Ga0070685_10219383 | Ga0070685_102193832 | 195 |
| 122 | 3300035090 | Ga0373949_0067500 | Ga0373949_0067500_305_904 | 195 |
| 123 | 3300035691 | Ga0373931_0102008 | Ga0373931_0102008_457_1056 | 195 |
| 124 | 3300005340 | Ga0070689_100030848 | Ga0070689_1000308482 | 196 |
| 125 | 3300025893 | Ga0207682_10035832 | Ga0207682_100358323 | 196 |
| 126 | 3300033180 | Ga0307510_10169509 | Ga0307510_101695092 | 196 |
| 127 | 3300037471 | Ga0395905_0003941 | Ga0395905_0003941_10735_11349 | 196 |
| 128 | 3300048913 | Ga0496110_0280558 | Ga0496110_0280558_805_1437 | 196 |
| 129 | 3300048917 | Ga0496114_0095882 | Ga0496114_0095882_1269_1895 | 196 |
| 130 | 3300053093 | Ga0500651_0017840 | Ga0500651_0017840_3381_3983 | 196 |
| 131 | 3300053136 | Ga0500559_0000092 | Ga0500559_0000092_25766_26368 | 196 |
| 132 | 3300053156 | Ga0500622_0010150 | Ga0500622_0010150_3614_4216 | 196 |
| 133 | 3300041999 | Ga0439433_0051784 | Ga0439433_0051784_18_647 | 197 |
| 134 | 3300042005 | Ga0439448_0115226 | Ga0439448_0115226_223_840 | 197 |
| 135 | 3300005457 | Ga0070662_100177520 | Ga0070662_1001775202 | 198 |
| 136 | 3300025933 | Ga0207706_10000544 | Ga0207706_100005449 | 198 |
| 137 | 3300037068 | Ga0373925_0073961 | Ga0373925_0073961_725_1363 | 198 |
| 138 | 3300044656 | Ga0466969_0000097 | Ga0466969_0000097_41287_41907 | 198 |
| 139 | 3300044684 | Ga0466966_0033241 | Ga0466966_0033241_1685_2305 | 198 |
| 140 | 3300044693 | Ga0466961_0171197 | Ga0466961_0171197_354_974 | 198 |
| 141 | 3300044765 | Ga0466970_0012383 | Ga0466970_0012383_3511_4131 | 198 |
| 142 | 3300045049 | Ga0466959_0011978 | Ga0466959_0011978_440_1060 | 198 |
| 143 | 3300005355 | Ga0070671_100055211 | Ga0070671_1000552112 | 199 |
| 144 | 3300005364 | Ga0070673_100213013 | Ga0070673_1002130132 | 199 |
| 145 | 3300005441 | Ga0070700_100970202 | Ga0070700_1009702021 | 199 |
| 146 | 3300005455 | Ga0070663_100037512 | Ga0070663_1000375122 | 199 |
| 147 | 3300005616 | Ga0068852_100343048 | Ga0068852_1003430482 | 199 |
| 148 | 3300005617 | Ga0068859_101277286 | Ga0068859_1012772862 | 199 |
| 149 | 3300005834 | Ga0068851_10009404 | Ga0068851_100094042 | 199 |
| 150 | 3300006163 | Ga0070715_10373763 | Ga0070715_103737631 | 199 |
| 151 | 3300006173 | Ga0070716_100093950 | Ga0070716_1000939502 | 199 |
| 152 | 3300006931 | Ga0097620_101277249 | Ga0097620_1012772492 | 199 |
| 153 | 3300013297 | Ga0157378_10224187 | Ga0157378_102241872 | 199 |
| 154 | 3300013308 | Ga0157375_10444887 | Ga0157375_104448872 | 199 |
| 155 | 3300014325 | Ga0163163_10531929 | Ga0163163_105319291 | 199 |
| 156 | 3300025321 | Ga0207656_10055148 | Ga0207656_100551482 | 199 |
| 157 | 3300025905 | Ga0207685_10302671 | Ga0207685_103026711 | 199 |
| 158 | 3300025938 | Ga0207704_10297423 | Ga0207704_102974232 | 199 |
| 159 | 3300046558 | Ga0495633_0071011 | Ga0495633_0071011_39_665 | 199 |
| 160 | 3300048903 | Ga0496100_0439279 | Ga0496100_0439279_31_657 | 199 |
| 161 | 3300048911 | Ga0496108_0083848 | Ga0496108_0083848_160_786 | 199 |
| 162 | 3300014969 | Ga0157376_10987463 | Ga0157376_109874631 | 201 |
| 163 | 3300028794 | Ga0307515_10000165 | Ga0307515_1000016522 | 201 |
| 164 | 3300049822 | Ga0501035_0223224 | Ga0501035_0223224_67_702 | 201 |
| 165 | 3300006353 | Ga0075370_10002631 | Ga0075370_100026314 | 202 |
| 166 | 3300037418 | Ga0395900_0000025 | Ga0395900_0000025_42937_43590 | 202 |
| 167 | 3300037466 | Ga0395898_0001478 | Ga0395898_0001478_12426_13079 | 202 |
| 168 | 3300037471 | Ga0395905_0006983 | Ga0395905_0006983_2440_3066 | 202 |
| 169 | 3300044658 | Ga0466972_0000265 | Ga0466972_0000265_31537_32172 | 202 |
| 170 | 3300044706 | Ga0466964_0008166 | Ga0466964_0008166_1259_1894 | 202 |
| 171 | 3300053088 | Ga0500644_0094193 | Ga0500644_0094193_176_826 | 209 |
| 172 | 3300031730 | Ga0307516_10260974 | Ga0307516_102609742 | 210 |
| 173 | 3300048928 | Ga0496125_0032460 | Ga0496125_0032460_2800_3459 | 212 |
| 174 | 3300006177 | Ga0075362_10190069 | Ga0075362_101900692 | 215 |
| 175 | 3300006195 | Ga0075366_10006600 | Ga0075366_100066002 | 215 |
| 176 | 3300050493 | nmdc:mga0k408_6123_c1 | nmdc:mga0k408_6123_c1_2010_2672 | 215 |
| 177 | 3300053080 | Ga0500635_0031055 | Ga0500635_0031055_1026_1694 | 217 |
| 178 | 3300053086 | Ga0500578_0031594 | Ga0500578_0031594_959_1627 | 217 |
| 179 | 3300001979 | JGI24740J21852_10014413 | JGI24740J21852_100144133 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9733 | 45 | 160 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9725 | 45 | 160 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9714 | 45 | 160 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9659 | 45 | 161 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9643 | 43 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9703 | 45 | 122 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.969 | 45 | 122 | 3.40.50.2300 |
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9666 | 45 | 122 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9633 | 45 | 122 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9627 | 45 | 122 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L1Q4D4-F1-model_v4 | Heme response regulator HssR (Stage 0 sporulation protein A homolog) | 0.973 | 45 | 165 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1M5AKB7-F1-model_v4 | cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases | 0.9716 | 45 | 162 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0016301 GO:0032993 |
| AF-A0A1H0NM22-F1-model_v4 | Two component transcriptional regulator, winged helix family | 0.971 | 43 | 161 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3C1LW34-F1-model_v4 | Stage 0 sporulation protein A homolog | 0.9695 | 44 | 160 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A3L7XQ34-F1-model_v4 | Response regulator | 0.9672 | 45 | 159 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar