F273314

General Info

Members Datasets Scaffolds Average Seq Length
179 129 358 135

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100451646|Ga0070674_1004516462
Length 153
Sequence MRRTDQRRAAIFALYQHEVTGAPLEAVMERSSRPESQDTEQEIPLPAGRLTDFSRDLVQGVDEHTPELDALLEQAAQDWSVDRIAPLERSILRTALYEILHRPDVPDEVAIDEAVEAAKTFCGTDAPGFVNGVLGGVVRELERQRVGDGGNRG

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
86 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
127 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 12.85
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100451646 3300005356 Bacteria 1061
2 JGI25406J46586_10040406 3300003203 Bacteria 1654
3 Ga0070658_10400408 3300005327 Bacteria 1179
4 Ga0070676_10236947 3300005328 Bacteria 1212
5 Ga0070683_100058893 3300005329 Bacteria 3568
6 Ga0070683_100198266 3300005329 Bacteria 1906
7 Ga0070683_100313043 3300005329 Bacteria 1494
8 Ga0070682_100362031 3300005337 Bacteria 1085
9 Ga0070709_10569219 3300005434 Bacteria 869
10 Ga0070681_10703636 3300005458 Bacteria 926
11 Ga0068867_100661882 3300005459 Bacteria 917
12 Ga0070679_101634423 3300005530 Bacteria 592
13 Ga0070679_101754292 3300005530 Bacteria 569
14 Ga0070684_100121411 3300005535 Bacteria 2350
15 Ga0070684_101079941 3300005535 Bacteria 754
16 Ga0070697_100560549 3300005536 Bacteria 1002
17 Ga0070665_100003377 3300005548 Bacteria 17082
18 Ga0070665_100497785 3300005548 Bacteria 1230
19 Ga0070664_100271596 3300005564 Bacteria 1527
20 Ga0070664_101189525 3300005564 Bacteria 719
21 Ga0068854_100486523 3300005578 Bacteria 1037
22 Ga0068856_100834417 3300005614 Bacteria 941
23 Ga0068852_100296770 3300005616 Bacteria 1563
24 Ga0068864_100458046 3300005618 Bacteria 1221
25 Ga0068858_100586151 3300005842 Bacteria 1081
26 Ga0068862_101493325 3300005844 Bacteria 681
27 Ga0081455_10150795 3300005937 Bacteria 1793
28 Ga0081538_10130161 3300005981 Bacteria 1185
29 Ga0081540_1120337 3300005983 Bacteria 1091
30 Ga0081539_10001664 3300005985 Bacteria 36008
31 Ga0081539_10134951 3300005985 Bacteria 1207
32 Ga0075365_10539966 3300006038 Unclassified 824
33 Ga0075363_100487499 3300006048 Bacteria 731
34 Ga0075364_10282159 3300006051 Bacteria 1130
35 Ga0075430_100007658 3300006846 Bacteria 9123
36 Ga0075431_100430887 3300006847 Bacteria 1317
37 Ga0075435_100858925 3300007076 Bacteria 791
38 Ga0105240_11626022 3300009093 Bacteria 675
39 Ga0111539_10407088 3300009094 Bacteria 1584
40 Ga0111539_12933982 3300009094 Unclassified 552
41 Ga0105245_10135423 3300009098 Bacteria 2315
42 Ga0105245_10729156 3300009098 Bacteria 1026
43 Ga0105247_11776174 3300009101 Bacteria 512
44 Ga0114129_11427027 3300009147 Bacteria 853
45 Ga0114129_12749100 3300009147 Bacteria 586
46 Ga0105243_10213570 3300009148 Bacteria 1700
47 Ga0105243_11578607 3300009148 Unclassified 682
48 Ga0105243_12515325 3300009148 Bacteria 554
49 Ga0105242_12348317 3300009176 Bacteria 580
50 Ga0105248_10717742 3300009177 Bacteria 1128
51 Ga0105248_12273240 3300009177 Bacteria 617
52 Ga0105249_11572921 3300009553 Bacteria 730
53 Ga0105239_10755150 3300010375 Bacteria 1113
54 Ga0105246_10240109 3300011119 Bacteria 1432
55 Ga0157369_10854064 3300013105 Unclassified 934
56 Ga0163162_10233749 3300013306 Bacteria 1969
57 Ga0163162_12826926 3300013306 Unclassified 559
58 Ga0157372_10845993 3300013307 Bacteria 1062
59 Ga0157372_12380163 3300013307 Bacteria 608
60 Ga0163163_13212773 3300014325 Bacteria 510
61 Ga0157379_10000652 3300014968 Bacteria 28069
62 Ga0163161_10522794 3300017792 Bacteria 969
63 Ga0206353_11133068 3300020082 Bacteria 1020
64 Ga0213876_10383249 3300021384 Unclassified 748
65 Ga0207426_1022318 3300025302 Bacteria 2174
66 Ga0207688_10070531 3300025901 Bacteria 1982
67 Ga0207654_10517730 3300025911 Bacteria 844
68 Ga0207707_10415419 3300025912 Bacteria 1154
69 Ga0207657_10528089 3300025919 Bacteria 923
70 Ga0207649_10473277 3300025920 Bacteria 949
71 Ga0207652_10605993 3300025921 Bacteria 982
72 Ga0207652_11061144 3300025921 Bacteria 710
73 Ga0207652_11224867 3300025921 Bacteria 653
74 Ga0207687_10180300 3300025927 Bacteria 1636
75 Ga0207704_10274336 3300025938 Bacteria 1278
76 Ga0207711_10618891 3300025941 Bacteria 1010
77 Ga0207661_10172053 3300025944 Bacteria 1886
78 Ga0207679_10370537 3300025945 Bacteria 1253
79 Ga0207678_10549782 3300026067 Bacteria 1010
80 Ga0207708_10621829 3300026075 Bacteria 917
81 Ga0207708_10802706 3300026075 Bacteria 810
82 Ga0207676_10790455 3300026095 Bacteria 925
83 Ga0207676_11322632 3300026095 Bacteria 716
84 Ga0207675_101146143 3300026118 Bacteria 798
85 Ga0207683_10430983 3300026121 Bacteria 1215
86 Ga0268266_10043106 3300028379 Bacteria 3855
87 Ga0268266_10413121 3300028379 Bacteria 1278
88 Ga0307408_100261696 3300031548 Bacteria 1432
89 Ga0307405_10305453 3300031731 Bacteria 1209
90 Ga0307405_11008580 3300031731 Bacteria 711
91 Ga0307413_10309848 3300031824 Bacteria 1201
92 Ga0307410_11271366 3300031852 Bacteria 643
93 Ga0307410_11336980 3300031852 Bacteria 628
94 Ga0307406_11685703 3300031901 Bacteria 561
95 Ga0307407_10060163 3300031903 Bacteria 2216
96 Ga0307412_11321426 3300031911 Bacteria 650
97 Ga0307409_100468495 3300031995 Bacteria 1219
98 Ga0307409_101098233 3300031995 Bacteria 816
99 Ga0307409_101758794 3300031995 Bacteria 649
100 Ga0307416_103334436 3300032002 Bacteria 537
101 Ga0307415_101080682 3300032126 Bacteria 750
102 Ga0395900_0165906 3300037418 Bacteria 2251
103 Ga0395901_0267658 3300038443 Bacteria 1778
104 Ga0436365_0021431 3300039437 Unclassified 799
105 Ga0436365_1182823 3300039437 Bacteria 4307
106 Ga0436363_0638507 3300039450 Unclassified 597
107 Ga0436362_1224523 3300039453 Bacteria 626
108 Ga0451789_0366174 3300041443 Unclassified 566
109 Ga0451791_1416594 3300041451 Bacteria 1194
110 Ga0451807_1252879 3300041486 Bacteria 519
111 Ga0451845_0383962 3300041501 Bacteria 500
112 Ga0451845_0600502 3300041501 Unclassified 779
113 Ga0466972_0086606 3300044658 Bacteria 1489
114 Ga0466966_0023969 3300044684 Bacteria 3994
115 Ga0466963_0810902 3300044694 Bacteria 660
116 Ga0466963_1205648 3300044694 Bacteria 532
117 Ga0466971_0041844 3300044719 Bacteria 2058
118 Ga0466960_0185035 3300044901 Bacteria 1131
119 Ga0466960_0376761 3300044901 Bacteria 814
120 Ga0466960_0780949 3300044901 Bacteria 577
121 Ga0466958_0214595 3300045836 Bacteria 1227
122 Ga0466958_0932694 3300045836 Bacteria 566
123 Ga0466967_0264024 3300045976 Bacteria 1648
124 Ga0466967_0294021 3300045976 Bacteria 1561
125 Ga0466967_0674962 3300045976 Bacteria 1023
126 Ga0466967_1202429 3300045976 Bacteria 755
127 Ga0466967_1559633 3300045976 Bacteria 658
128 Ga0466967_2108789 3300045976 Bacteria 560
129 Ga0495650_0000054 3300046471 Bacteria 313631
130 Ga0495608_0295387 3300046511 Bacteria 1004
131 Ga0495645_0042243 3300046543 Bacteria 3324
132 Ga0495676_0156270 3300047321 Unclassified 1618
133 Ga0495684_0002244 3300047471 Bacteria 15475
134 Ga0496101_0210210 3300048904 Bacteria 1507
135 Ga0496102_0347361 3300048905 Bacteria 1397
136 Ga0496104_0099175 3300048907 Bacteria 2789
137 Ga0496104_0962995 3300048907 Bacteria 758
138 Ga0496105_1034000 3300048908 Bacteria 613
139 Ga0496107_0012320 3300048910 Bacteria 5970
140 Ga0496108_0225642 3300048911 Bacteria 1628
141 Ga0496109_0006033 3300048912 Bacteria 10179
142 Ga0496109_0043110 3300048912 Bacteria 4090
143 Ga0496109_0609883 3300048912 Bacteria 1028
144 Ga0496109_1661690 3300048912 Bacteria 573
145 Ga0496109_1843970 3300048912 Bacteria 538
146 Ga0496110_0307458 3300048913 Bacteria 1444
147 Ga0496110_0575885 3300048913 Bacteria 1022
148 Ga0496111_0036938 3300048914 Bacteria 3494
149 Ga0496111_0105190 3300048914 Bacteria 2077
150 Ga0496112_0004334 3300048915 Bacteria 11998
151 Ga0496112_0089003 3300048915 Bacteria 3055
152 Ga0496113_0128109 3300048916 Bacteria 1989
153 Ga0496113_0380038 3300048916 Bacteria 1134
154 Ga0496121_0002162 3300048924 Bacteria 30763
155 Ga0501039_1387802 3300049575 Bacteria 541
156 Ga0501042_0842096 3300049578 Bacteria 668
157 Ga0501068_0481777 3300049584 Bacteria 804
158 Ga0501068_1125597 3300049584 Bacteria 519
159 Ga0501070_0038412 3300049586 Bacteria 3994
160 Ga0501070_0063535 3300049586 Bacteria 3058
161 Ga0501070_0107827 3300049586 Bacteria 2302
162 Ga0501070_0515579 3300049586 Bacteria 959
163 Ga0501071_0128340 3300049587 Bacteria 1883
164 Ga0501071_0211933 3300049587 Bacteria 1457
165 Ga0501072_0109419 3300049588 Bacteria 2199
166 Ga0501072_0508176 3300049588 Bacteria 953
167 Ga0501073_0140432 3300049589 Bacteria 1674
168 Ga0501074_0230467 3300049590 Bacteria 1318
169 Ga0501080_0543344 3300049742 Bacteria 1035
170 Ga0501083_0237041 3300049744 Bacteria 1188
171 nmdc:mga00v17_223471_c1 3300050491 Bacteria 1219
172 nmdc:mga05p37_1503513_c1 3300050507 Bacteria 670
173 nmdc:mga0qj67_68388_c1 3300050509 Bacteria 2831
174 nmdc:mga08y16_172107_c1 3300050511 Bacteria 2249
175 nmdc:mga08x19_542556_c1 3300050514 Bacteria 822
176 Ga0495612_0477678 3300053078 Bacteria 571
177 Ga0495655_0089940 3300053083 Bacteria 893
178 Ga0495619_0138080 3300053085 Bacteria 1677
179 Ga0500614_195264 3300053123 Bacteria 622
180 Ga0070674_100451646
181 JGI25406J46586_10040406
182 Ga0070658_10400408
183 Ga0070676_10236947
184 Ga0070683_100058893
185 Ga0070683_100198266
186 Ga0070683_100313043
187 Ga0070682_100362031
188 Ga0070709_10569219
189 Ga0070681_10703636
190 Ga0068867_100661882
191 Ga0070679_101634423
192 Ga0070679_101754292
193 Ga0070684_100121411
194 Ga0070684_101079941
195 Ga0070697_100560549
196 Ga0070665_100003377
197 Ga0070665_100497785
198 Ga0070664_100271596
199 Ga0070664_101189525
200 Ga0068854_100486523
201 Ga0068856_100834417
202 Ga0068852_100296770
203 Ga0068864_100458046
204 Ga0068858_100586151
205 Ga0068862_101493325
206 Ga0081455_10150795
207 Ga0081538_10130161
208 Ga0081540_1120337
209 Ga0081539_10001664
210 Ga0081539_10134951
211 Ga0075365_10539966
212 Ga0075363_100487499
213 Ga0075364_10282159
214 Ga0075430_100007658
215 Ga0075431_100430887
216 Ga0075435_100858925
217 Ga0105240_11626022
218 Ga0111539_10407088
219 Ga0111539_12933982
220 Ga0105245_10135423
221 Ga0105245_10729156
222 Ga0105247_11776174
223 Ga0114129_11427027
224 Ga0114129_12749100
225 Ga0105243_10213570
226 Ga0105243_11578607
227 Ga0105243_12515325
228 Ga0105242_12348317
229 Ga0105248_10717742
230 Ga0105248_12273240
231 Ga0105249_11572921
232 Ga0105239_10755150
233 Ga0105246_10240109
234 Ga0157369_10854064
235 Ga0163162_10233749
236 Ga0163162_12826926
237 Ga0157372_10845993
238 Ga0157372_12380163
239 Ga0163163_13212773
240 Ga0157379_10000652
241 Ga0163161_10522794
242 Ga0206353_11133068
243 Ga0213876_10383249
244 Ga0207426_1022318
245 Ga0207688_10070531
246 Ga0207654_10517730
247 Ga0207707_10415419
248 Ga0207657_10528089
249 Ga0207649_10473277
250 Ga0207652_10605993
251 Ga0207652_11061144
252 Ga0207652_11224867
253 Ga0207687_10180300
254 Ga0207704_10274336
255 Ga0207711_10618891
256 Ga0207661_10172053
257 Ga0207679_10370537
258 Ga0207678_10549782
259 Ga0207708_10621829
260 Ga0207708_10802706
261 Ga0207676_10790455
262 Ga0207676_11322632
263 Ga0207675_101146143
264 Ga0207683_10430983
265 Ga0268266_10043106
266 Ga0268266_10413121
267 Ga0307408_100261696
268 Ga0307405_10305453
269 Ga0307405_11008580
270 Ga0307413_10309848
271 Ga0307410_11271366
272 Ga0307410_11336980
273 Ga0307406_11685703
274 Ga0307407_10060163
275 Ga0307412_11321426
276 Ga0307409_100468495
277 Ga0307409_101098233
278 Ga0307409_101758794
279 Ga0307416_103334436
280 Ga0307415_101080682
281 Ga0395900_0165906
282 Ga0395901_0267658
283 Ga0436365_0021431
284 Ga0436365_1182823
285 Ga0436363_0638507
286 Ga0436362_1224523
287 Ga0451789_0366174
288 Ga0451791_1416594
289 Ga0451807_1252879
290 Ga0451845_0383962
291 Ga0451845_0600502
292 Ga0466972_0086606
293 Ga0466966_0023969
294 Ga0466963_0810902
295 Ga0466963_1205648
296 Ga0466971_0041844
297 Ga0466960_0185035
298 Ga0466960_0376761
299 Ga0466960_0780949
300 Ga0466958_0214595
301 Ga0466958_0932694
302 Ga0466967_0264024
303 Ga0466967_0294021
304 Ga0466967_0674962
305 Ga0466967_1202429
306 Ga0466967_1559633
307 Ga0466967_2108789
308 Ga0495650_0000054
309 Ga0495608_0295387
310 Ga0495645_0042243
311 Ga0495676_0156270
312 Ga0495684_0002244
313 Ga0496101_0210210
314 Ga0496102_0347361
315 Ga0496104_0099175
316 Ga0496104_0962995
317 Ga0496105_1034000
318 Ga0496107_0012320
319 Ga0496108_0225642
320 Ga0496109_0006033
321 Ga0496109_0043110
322 Ga0496109_0609883
323 Ga0496109_1661690
324 Ga0496109_1843970
325 Ga0496110_0307458
326 Ga0496110_0575885
327 Ga0496111_0036938
328 Ga0496111_0105190
329 Ga0496112_0004334
330 Ga0496112_0089003
331 Ga0496113_0128109
332 Ga0496113_0380038
333 Ga0496121_0002162
334 Ga0501039_1387802
335 Ga0501042_0842096
336 Ga0501068_0481777
337 Ga0501068_1125597
338 Ga0501070_0038412
339 Ga0501070_0063535
340 Ga0501070_0107827
341 Ga0501070_0515579
342 Ga0501071_0128340
343 Ga0501071_0211933
344 Ga0501072_0109419
345 Ga0501072_0508176
346 Ga0501073_0140432
347 Ga0501074_0230467
348 Ga0501080_0543344
349 Ga0501083_0237041
350 nmdc:mga00v17_223471_c1
351 nmdc:mga05p37_1503513_c1
352 nmdc:mga0qj67_68388_c1
353 nmdc:mga08y16_172107_c1
354 nmdc:mga08x19_542556_c1
355 Ga0495612_0477678
356 Ga0495655_0089940
357 Ga0495619_0138080
358 Ga0500614_195264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

4

139

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eyv-assembly1.cif.gz_A the crystal structure of nusb from mycobacterium tuberculosis 0.8621 4 126
4eya-assembly1.cif.gz_A crystal structure of a plectonemic rna supercoil 0.8402 1 133
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.8372 4 129
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8191 1 129
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.8131 5 130
ID Description Score Start End Superfamily
1eyvA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8621 4 126 1.10.940.10
af_P9WIV1_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8509 1 126 1.10.940.10
3r2cB00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8442 1 133 1.10.940.10
4eyaA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8402 1 133 1.10.940.10
1tztA00 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8354 4 129 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A2W6CEG2-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9916 3 132 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A6J7CN02-F1-model_v4 Unannotated protein 0.9718 4 133 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A538LNI8-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9692 4 131 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A538KIU9-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9687 1 135 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A840ILF9-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9666 1 135 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Map