F272836

General Info

Members Datasets Scaffolds Average Seq Length
178 107 356 227

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_121737_c1|nmdc:mga08x19_121737_c1_28_891
Length 256
Sequence MAGKPFAIRFPEKNVRLMPKPLEILQSFAGRKLRKLPAMKTCFGLVIAIALVAQSQSSIGWRVLFDGANLDAWRGYKTDKIPDGWHIAGGTLAKEKPVADIVSKEEFGDFELELDWRIGEAGNSGIFYRGTEEYDHIYWSAPEYQLLDDIKAADNKTRLTCAGSLYALVPSPPGHLKPVGDWNTTRIVAKGSHVEHWLNGVKLLEYELGSADWEAKVKASKFKDWPNYGRARRGHFALQGDHEGSLAFRNIRVRPL

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 98.88
Stem 0
Stem Tuber 0
Unclassified 26.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_121737_c1 3300050514 Unclassified 1750
2 Ga0070683_100033372 3300005329 Bacteria 4694
3 Ga0070690_100058716 3300005330 Bacteria 2471
4 Ga0070670_100536823 3300005331 Unclassified 1043
5 Ga0070666_10209602 3300005335 Bacteria 1372
6 Ga0070682_100405620 3300005337 Unclassified 1032
7 Ga0070689_100090674 3300005340 Bacteria 2409
8 Ga0070689_100196804 3300005340 Bacteria 1643
9 Ga0070691_10075103 3300005341 Bacteria 1646
10 Ga0070687_100085958 3300005343 Bacteria 1727
11 Ga0070692_10075204 3300005345 Unclassified 1808
12 Ga0070668_100312974 3300005347 Unclassified 1320
13 Ga0070669_100023528 3300005353 Unclassified 4410
14 Ga0070669_100086404 3300005353 Bacteria 2343
15 Ga0070675_100098070 3300005354 Bacteria 2464
16 Ga0070674_100000463 3300005356 Bacteria 20506
17 Ga0070673_100027318 3300005364 Bacteria 4229
18 Ga0070688_100058679 3300005365 Bacteria 2424
19 Ga0070688_100060261 3300005365 Bacteria 2396
20 Ga0070667_100054181 3300005367 Bacteria 3386
21 Ga0070667_100616581 3300005367 Unclassified 1000
22 Ga0070700_100276070 3300005441 Bacteria 1216
23 Ga0070663_100081248 3300005455 Bacteria 2382
24 Ga0070662_100343870 3300005457 Bacteria 1221
25 Ga0068867_100122851 3300005459 Bacteria 2009
26 Ga0070707_100015212 3300005468 Bacteria 7221
27 Ga0070699_100009391 3300005518 Bacteria 8473
28 Ga0070699_100220463 3300005518 Bacteria 1690
29 Ga0070699_100234270 3300005518 Unclassified 1638
30 Ga0070684_100018330 3300005535 Bacteria 5765
31 Ga0070684_100434482 3300005535 Bacteria 1212
32 Ga0068853_100136768 3300005539 Bacteria 2197
33 Ga0070672_100059070 3300005543 Bacteria 3017
34 Ga0070672_100391586 3300005543 Bacteria 1190
35 Ga0070695_100048504 3300005545 Bacteria 2716
36 Ga0070693_100015399 3300005547 Bacteria 3937
37 Ga0070664_100292098 3300005564 Unclassified 1472
38 Ga0068852_100066250 3300005616 Bacteria 3154
39 Ga0068859_100075570 3300005617 Bacteria 3409
40 Ga0068859_100439726 3300005617 Unclassified 1400
41 Ga0068859_100979072 3300005617 Unclassified 928
42 Ga0068866_10066365 3300005718 Unclassified 1891
43 Ga0068858_100210887 3300005842 Bacteria 1838
44 Ga0068858_100482366 3300005842 Bacteria 1197
45 Ga0068862_100112002 3300005844 Bacteria 2397
46 Ga0075428_101176863 3300006844 Bacteria 808
47 Ga0075431_100370286 3300006847 Bacteria 1438
48 Ga0075433_10032382 3300006852 Bacteria 4478
49 Ga0075433_10064608 3300006852 Bacteria 3208
50 Ga0075433_10075194 3300006852 Bacteria 2972
51 Ga0075434_100001959 3300006871 Bacteria 17846
52 Ga0075434_100029127 3300006871 Bacteria 5430
53 Ga0075434_100054631 3300006871 Bacteria 3967
54 Ga0075434_100081216 3300006871 Bacteria 3239
55 Ga0075434_100309580 3300006871 Bacteria 1600
56 Ga0075429_100057159 3300006880 Bacteria 3397
57 Ga0075429_100191008 3300006880 Bacteria 1794
58 Ga0075429_100298036 3300006880 Bacteria 1412
59 Ga0075436_100007127 3300006914 Bacteria 7651
60 Ga0075436_100018449 3300006914 Unclassified 4777
61 Ga0075436_100025686 3300006914 Unclassified 4054
62 Ga0075436_100050741 3300006914 Unclassified 2863
63 Ga0075436_100108366 3300006914 Bacteria 1938
64 Ga0097620_100075568 3300006931 Bacteria 3409
65 Ga0097620_100439725 3300006931 Unclassified 1400
66 Ga0097620_100979080 3300006931 Unclassified 928
67 Ga0075435_100000448 3300007076 Bacteria 25223
68 Ga0075435_100002468 3300007076 Bacteria 12294
69 Ga0075435_100005928 3300007076 Bacteria 8597
70 Ga0075435_100180491 3300007076 Bacteria 1784
71 Ga0075435_100474164 3300007076 Unclassified 1080
72 Ga0111539_10535626 3300009094 Unclassified 1364
73 Ga0105245_10107410 3300009098 Bacteria 2591
74 Ga0105245_10184093 3300009098 Bacteria 1997
75 Ga0105245_10685161 3300009098 Bacteria 1057
76 Ga0114129_10002077 3300009147 Bacteria 27547
77 Ga0114129_10010076 3300009147 Bacteria 13472
78 Ga0114129_10079530 3300009147 Bacteria 4558
79 Ga0114129_10139756 3300009147 Bacteria 3321
80 Ga0105243_10136503 3300009148 Unclassified 2087
81 Ga0105242_10150130 3300009176 Bacteria 2031
82 Ga0105242_10345287 3300009176 Bacteria 1373
83 Ga0105242_10608221 3300009176 Bacteria 1057
84 Ga0105249_10014464 3300009553 Bacteria 6975
85 Ga0105249_10064150 3300009553 Unclassified 3376
86 Ga0105246_10509026 3300011119 Bacteria 1024
87 Ga0157375_10088018 3300013308 Bacteria 3159
88 Ga0163163_10102268 3300014325 Bacteria 2889
89 Ga0157380_10038487 3300014326 Unclassified 3714
90 Ga0157376_10797266 3300014969 Unclassified 957
91 Ga0207642_10281214 3300025899 Unclassified 957
92 Ga0207680_10381535 3300025903 Unclassified 994
93 Ga0207645_10003654 3300025907 Bacteria 11609
94 Ga0207705_10022095 3300025909 Bacteria 4539
95 Ga0207707_10047252 3300025912 Bacteria 3748
96 Ga0207662_10005391 3300025918 Bacteria 6812
97 Ga0207646_10014828 3300025922 Bacteria 7383
98 Ga0207681_10086574 3300025923 Bacteria 2227
99 Ga0207650_10253149 3300025925 Bacteria 1426
100 Ga0207659_10188823 3300025926 Unclassified 1638
101 Ga0207659_10371263 3300025926 Unclassified 1191
102 Ga0207706_10155235 3300025933 Bacteria 2013
103 Ga0207686_10201425 3300025934 Unclassified 1426
104 Ga0207709_10063146 3300025935 Bacteria 2321
105 Ga0207670_10144973 3300025936 Unclassified 1755
106 Ga0207669_10005115 3300025937 Bacteria 5844
107 Ga0207669_10504149 3300025937 Unclassified 969
108 Ga0207691_10007560 3300025940 Bacteria 10461
109 Ga0207691_10143398 3300025940 Bacteria 2104
110 Ga0207691_10251698 3300025940 Bacteria 1525
111 Ga0207689_10158981 3300025942 Bacteria 1862
112 Ga0207689_10588900 3300025942 Unclassified 935
113 Ga0207661_10171960 3300025944 Bacteria 1886
114 Ga0207679_10750670 3300025945 Unclassified 887
115 Ga0207712_10036821 3300025961 Bacteria 3335
116 Ga0207658_10096539 3300025986 Bacteria 2305
117 Ga0207658_10263499 3300025986 Unclassified 1470
118 Ga0207677_10072283 3300026023 Bacteria 2438
119 Ga0207708_10032326 3300026075 Bacteria 3974
120 Ga0207648_10020308 3300026089 Bacteria 5985
121 Ga0207648_10051344 3300026089 Bacteria 3603
122 Ga0207648_10337160 3300026089 Unclassified 1357
123 Ga0207674_11022428 3300026116 Unclassified 796
124 Ga0207675_100005365 3300026118 Bacteria 12306
125 Ga0207675_100062220 3300026118 Bacteria 3485
126 Ga0207698_10126951 3300026142 Bacteria 2171
127 Ga0268266_10310378 3300028379 Bacteria 1474
128 Ga0268265_10014404 3300028380 Bacteria 5387
129 Ga0268265_10197466 3300028380 Bacteria 1742
130 Ga0268265_10370555 3300028380 Bacteria 1314
131 Ga0268264_10611820 3300028381 Unclassified 1075
132 Ga0265340_10109941 3300031247 Unclassified 1275
133 Ga0436364_0773079 3300037853 Unclassified 1369
134 Ga0439446_0007628 3300042156 Bacteria 2850
135 Ga0439434_0012015 3300042435 Bacteria 2559
136 Ga0495586_0321046 3300046535 Unclassified 888
137 Ga0495669_0140478 3300046684 Unclassified 1140
138 Ga0496102_0291284 3300048905 Unclassified 1539
139 Ga0501034_0058314 3300049571 Bacteria 3880
140 Ga0501036_0112484 3300049572 Bacteria 2301
141 Ga0501038_0279998 3300049574 Unclassified 1313
142 Ga0501043_0020312 3300049579 Bacteria 5211
143 Ga0501046_0597089 3300049580 Bacteria 784
144 Ga0501047_0073330 3300049581 Bacteria 3296
145 Ga0501047_0220739 3300049581 Bacteria 1752
146 Ga0501070_0045675 3300049586 Bacteria 3643
147 Ga0501073_0401897 3300049589 Bacteria 946
148 Ga0501044_0024088 3300049823 Bacteria 6467
149 Ga0501044_0201927 3300049823 Bacteria 1946
150 nmdc:mga05p37_128359_c1 3300050507 Unclassified 3113
151 nmdc:mga05p37_17170_c1 3300050507 Bacteria 8732
152 nmdc:mga05p37_875808_c1 3300050507 Unclassified 972
153 nmdc:mga09592_105745_c1 3300050508 Bacteria 2413
154 nmdc:mga09592_270827_c1 3300050508 Bacteria 1473
155 nmdc:mga06r32_116278_c1 3300050510 Bacteria 2635
156 nmdc:mga06r32_142202_c1 3300050510 Bacteria 2376
157 nmdc:mga06r32_67682_c1 3300050510 Bacteria 3448
158 nmdc:mga0n895_116179_c1 3300050512 Bacteria 2694
159 nmdc:mga0n895_133219_c1 3300050512 Bacteria 2511
160 nmdc:mga0n895_14_c1 3300050512 Bacteria 102430
161 nmdc:mga0n895_182187_c1 3300050512 Bacteria 2132
162 nmdc:mga0n895_315335_c1 3300050512 Bacteria 1585
163 nmdc:mga0n895_466497_c1 3300050512 Bacteria 1274
164 nmdc:mga0rr50_117462_c1 3300050513 Bacteria 2113
165 nmdc:mga0rr50_214_c1 3300050513 Bacteria 31142
166 nmdc:mga0rr50_270555_c1 3300050513 Bacteria 1416
167 nmdc:mga0rr50_6459_c1 3300050513 Bacteria 7140
168 nmdc:mga0rr50_70616_c1 3300050513 Bacteria 2661
169 nmdc:mga08x19_478385_c1 3300050514 Bacteria 878
170 nmdc:mga08x19_51718_c1 3300050514 Bacteria 2640
171 nmdc:mga08x19_757_c1 3300050514 Bacteria 20617
172 nmdc:mga08x19_97800_c1 3300050514 Unclassified 1944
173 nmdc:mga0a205_259489_c1 3300050515 Bacteria 1616
174 nmdc:mga0a205_524884_c1 3300050515 Bacteria 1040
175 nmdc:mga0a205_60674_c1 3300050515 Unclassified 3652
176 nmdc:mga0a205_71347_c1 3300050515 Unclassified 3355
177 Ga0495619_0356247 3300053085 Bacteria 1012
178 Ga0530510_0102073 3300061734 Unclassified 2098
179 nmdc:mga08x19_121737_c1
180 Ga0070683_100033372
181 Ga0070690_100058716
182 Ga0070670_100536823
183 Ga0070666_10209602
184 Ga0070682_100405620
185 Ga0070689_100090674
186 Ga0070689_100196804
187 Ga0070691_10075103
188 Ga0070687_100085958
189 Ga0070692_10075204
190 Ga0070668_100312974
191 Ga0070669_100023528
192 Ga0070669_100086404
193 Ga0070675_100098070
194 Ga0070674_100000463
195 Ga0070673_100027318
196 Ga0070688_100058679
197 Ga0070688_100060261
198 Ga0070667_100054181
199 Ga0070667_100616581
200 Ga0070700_100276070
201 Ga0070663_100081248
202 Ga0070662_100343870
203 Ga0068867_100122851
204 Ga0070707_100015212
205 Ga0070699_100009391
206 Ga0070699_100220463
207 Ga0070699_100234270
208 Ga0070684_100018330
209 Ga0070684_100434482
210 Ga0068853_100136768
211 Ga0070672_100059070
212 Ga0070672_100391586
213 Ga0070695_100048504
214 Ga0070693_100015399
215 Ga0070664_100292098
216 Ga0068852_100066250
217 Ga0068859_100075570
218 Ga0068859_100439726
219 Ga0068859_100979072
220 Ga0068866_10066365
221 Ga0068858_100210887
222 Ga0068858_100482366
223 Ga0068862_100112002
224 Ga0075428_101176863
225 Ga0075431_100370286
226 Ga0075433_10032382
227 Ga0075433_10064608
228 Ga0075433_10075194
229 Ga0075434_100001959
230 Ga0075434_100029127
231 Ga0075434_100054631
232 Ga0075434_100081216
233 Ga0075434_100309580
234 Ga0075429_100057159
235 Ga0075429_100191008
236 Ga0075429_100298036
237 Ga0075436_100007127
238 Ga0075436_100018449
239 Ga0075436_100025686
240 Ga0075436_100050741
241 Ga0075436_100108366
242 Ga0097620_100075568
243 Ga0097620_100439725
244 Ga0097620_100979080
245 Ga0075435_100000448
246 Ga0075435_100002468
247 Ga0075435_100005928
248 Ga0075435_100180491
249 Ga0075435_100474164
250 Ga0111539_10535626
251 Ga0105245_10107410
252 Ga0105245_10184093
253 Ga0105245_10685161
254 Ga0114129_10002077
255 Ga0114129_10010076
256 Ga0114129_10079530
257 Ga0114129_10139756
258 Ga0105243_10136503
259 Ga0105242_10150130
260 Ga0105242_10345287
261 Ga0105242_10608221
262 Ga0105249_10014464
263 Ga0105249_10064150
264 Ga0105246_10509026
265 Ga0157375_10088018
266 Ga0163163_10102268
267 Ga0157380_10038487
268 Ga0157376_10797266
269 Ga0207642_10281214
270 Ga0207680_10381535
271 Ga0207645_10003654
272 Ga0207705_10022095
273 Ga0207707_10047252
274 Ga0207662_10005391
275 Ga0207646_10014828
276 Ga0207681_10086574
277 Ga0207650_10253149
278 Ga0207659_10188823
279 Ga0207659_10371263
280 Ga0207706_10155235
281 Ga0207686_10201425
282 Ga0207709_10063146
283 Ga0207670_10144973
284 Ga0207669_10005115
285 Ga0207669_10504149
286 Ga0207691_10007560
287 Ga0207691_10143398
288 Ga0207691_10251698
289 Ga0207689_10158981
290 Ga0207689_10588900
291 Ga0207661_10171960
292 Ga0207679_10750670
293 Ga0207712_10036821
294 Ga0207658_10096539
295 Ga0207658_10263499
296 Ga0207677_10072283
297 Ga0207708_10032326
298 Ga0207648_10020308
299 Ga0207648_10051344
300 Ga0207648_10337160
301 Ga0207674_11022428
302 Ga0207675_100005365
303 Ga0207675_100062220
304 Ga0207698_10126951
305 Ga0268266_10310378
306 Ga0268265_10014404
307 Ga0268265_10197466
308 Ga0268265_10370555
309 Ga0268264_10611820
310 Ga0265340_10109941
311 Ga0436364_0773079
312 Ga0439446_0007628
313 Ga0439434_0012015
314 Ga0495586_0321046
315 Ga0495669_0140478
316 Ga0496102_0291284
317 Ga0501034_0058314
318 Ga0501036_0112484
319 Ga0501038_0279998
320 Ga0501043_0020312
321 Ga0501046_0597089
322 Ga0501047_0073330
323 Ga0501047_0220739
324 Ga0501070_0045675
325 Ga0501073_0401897
326 Ga0501044_0024088
327 Ga0501044_0201927
328 nmdc:mga05p37_128359_c1
329 nmdc:mga05p37_17170_c1
330 nmdc:mga05p37_875808_c1
331 nmdc:mga09592_105745_c1
332 nmdc:mga09592_270827_c1
333 nmdc:mga06r32_116278_c1
334 nmdc:mga06r32_142202_c1
335 nmdc:mga06r32_67682_c1
336 nmdc:mga0n895_116179_c1
337 nmdc:mga0n895_133219_c1
338 nmdc:mga0n895_14_c1
339 nmdc:mga0n895_182187_c1
340 nmdc:mga0n895_315335_c1
341 nmdc:mga0n895_466497_c1
342 nmdc:mga0rr50_117462_c1
343 nmdc:mga0rr50_214_c1
344 nmdc:mga0rr50_270555_c1
345 nmdc:mga0rr50_6459_c1
346 nmdc:mga0rr50_70616_c1
347 nmdc:mga08x19_478385_c1
348 nmdc:mga08x19_51718_c1
349 nmdc:mga08x19_757_c1
350 nmdc:mga08x19_97800_c1
351 nmdc:mga0a205_259489_c1
352 nmdc:mga0a205_524884_c1
353 nmdc:mga0a205_60674_c1
354 nmdc:mga0a205_71347_c1
355 Ga0495619_0356247
356 Ga0530510_0102073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

60

254

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hxc-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bacuni_00951) from bacteroides uniformis atcc 8492 at 2.15 a resolution 0.9349 39 235
3h3l-assembly1.cif.gz_A-2 crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution 0.927 35 234
3u1x-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.9256 39 235
3nmb-assembly1.cif.gz_A crystal structure of a putative sugar hydrolase (bacova_03189) from bacteroides ovatus at 2.40 a resolution 0.922 39 235
3osd-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bt2157) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.918 39 235
ID Description Score Start End Superfamily
4hxcA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.9149 39 235 2.60.120.560
3u1xA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8989 39 235 2.60.120.560
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8458 20 235 2.60.120.560
3u1xA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8258 39 235 2.60.120.560
3h3lC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.823 35 234 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A2V8DUB4-F1-model_v4 DUF1080 domain-containing protein 0.9966 40 235 GO:0016787
AF-A0A534A2A2-F1-model_v4 DUF1080 domain-containing protein 0.9866 65 235 GO:0016787
AF-A0A2V8DUB4-F1-model_v4 DUF1080 domain-containing protein 0.9865 40 235 GO:0016787
AF-A0A534A2A2-F1-model_v4 DUF1080 domain-containing protein 0.9809 65 235 GO:0016787
AF-A0A2E5FG48-F1-model_v4 DUF1080 domain-containing protein 0.9796 38 234 GO:0016787

Map