F272781
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 178 | 121 | 178 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0906944|Ga0501073_0906944_55_531 |
| Length | 158 |
| Sequence | MNTVPAKAAVDPRMVRTLCFEDLHVGMRETLMKSVMETDVVGFADISGDENPIHLCDTYAQGTRFGQRIAHGLYTASLISAVLGTRLPGAGAVYRSQTLNFHAPVKIGDVVTIIVEVIELVREGRRVRLQCEALVDNTVVLDGEAIVSVPGRPKGVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 36 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 37 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 90 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 91 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 92 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 93 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 94 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 95 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 96 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 97 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 98 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 99 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 109 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 110 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 111 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 113 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.12 |
| Nodule | 0 |
| Rhizoplane | 2.25 |
| Rhizosphere | 93.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1053547 | 3300002155 | Bacteria | 583 |
| 2 | Ga0070658_10003522 | 3300005327 | Bacteria | 12849 |
| 3 | Ga0070683_100003646 | 3300005329 | Bacteria | 12544 |
| 4 | Ga0070683_100358405 | 3300005329 | Bacteria | 1389 |
| 5 | Ga0070670_100000080 | 3300005331 | Bacteria | 92128 |
| 6 | Ga0070670_100050940 | 3300005331 | Bacteria | 3557 |
| 7 | Ga0068869_100020988 | 3300005334 | Bacteria | 4489 |
| 8 | Ga0070680_100459018 | 3300005336 | Unclassified | 1088 |
| 9 | Ga0068868_100000862 | 3300005338 | Bacteria | 20527 |
| 10 | Ga0070687_100166097 | 3300005343 | Unclassified | 1309 |
| 11 | Ga0070687_100998487 | 3300005343 | Unclassified | 606 |
| 12 | Ga0070675_100000006 | 3300005354 | Bacteria | 280013 |
| 13 | Ga0070674_100078115 | 3300005356 | Bacteria | 2358 |
| 14 | Ga0070673_101644929 | 3300005364 | Unclassified | 607 |
| 15 | Ga0070688_100962095 | 3300005365 | Unclassified | 676 |
| 16 | Ga0070709_10106797 | 3300005434 | Bacteria | 1875 |
| 17 | Ga0070709_10258044 | 3300005434 | Bacteria | 1258 |
| 18 | Ga0070713_100004895 | 3300005436 | Bacteria | 9087 |
| 19 | Ga0070708_100001911 | 3300005445 | Bacteria | 16032 |
| 20 | Ga0070708_100014931 | 3300005445 | Bacteria | 6403 |
| 21 | Ga0070708_100057435 | 3300005445 | Bacteria | 3465 |
| 22 | Ga0070708_100192716 | 3300005445 | Bacteria | 1907 |
| 23 | Ga0070662_101252174 | 3300005457 | Unclassified | 638 |
| 24 | Ga0070685_10973933 | 3300005466 | Unclassified | 635 |
| 25 | Ga0070706_100004384 | 3300005467 | Bacteria | 13635 |
| 26 | Ga0070706_100006026 | 3300005467 | Bacteria | 11460 |
| 27 | Ga0070706_100031520 | 3300005467 | Bacteria | 4888 |
| 28 | Ga0070706_100171567 | 3300005467 | Bacteria | 2026 |
| 29 | Ga0070707_100028756 | 3300005468 | Bacteria | 5290 |
| 30 | Ga0070707_100043870 | 3300005468 | Bacteria | 4280 |
| 31 | Ga0070707_100140900 | 3300005468 | Bacteria | 2347 |
| 32 | Ga0070707_100418975 | 3300005468 | Unclassified | 1299 |
| 33 | Ga0070707_100525638 | 3300005468 | Bacteria | 1145 |
| 34 | Ga0070707_101479636 | 3300005468 | Bacteria | 646 |
| 35 | Ga0070698_100000807 | 3300005471 | Bacteria | 34196 |
| 36 | Ga0070698_100241208 | 3300005471 | Bacteria | 1741 |
| 37 | Ga0070698_100643229 | 3300005471 | Bacteria | 1001 |
| 38 | Ga0070698_100731001 | 3300005471 | Bacteria | 932 |
| 39 | Ga0070698_101022162 | 3300005471 | Bacteria | 774 |
| 40 | Ga0070699_100393997 | 3300005518 | Bacteria | 1251 |
| 41 | Ga0070699_101132786 | 3300005518 | Unclassified | 718 |
| 42 | Ga0070684_100003340 | 3300005535 | Bacteria | 12013 |
| 43 | Ga0070697_100007514 | 3300005536 | Bacteria | 8483 |
| 44 | Ga0070697_100096596 | 3300005536 | Bacteria | 2451 |
| 45 | Ga0070697_100516525 | 3300005536 | Bacteria | 1045 |
| 46 | Ga0070697_101461851 | 3300005536 | Unclassified | 611 |
| 47 | Ga0068853_100191698 | 3300005539 | Bacteria | 1857 |
| 48 | Ga0068853_100277222 | 3300005539 | Bacteria | 1545 |
| 49 | Ga0068853_101806743 | 3300005539 | Unclassified | 593 |
| 50 | Ga0070695_100687193 | 3300005545 | Unclassified | 811 |
| 51 | Ga0070696_100254100 | 3300005546 | Bacteria | 1330 |
| 52 | Ga0070704_100545511 | 3300005549 | Unclassified | 1012 |
| 53 | Ga0068854_100326629 | 3300005578 | Unclassified | 1249 |
| 54 | Ga0068852_100732947 | 3300005616 | Bacteria | 1000 |
| 55 | Ga0068852_101048163 | 3300005616 | Bacteria | 835 |
| 56 | Ga0068864_100000048 | 3300005618 | Bacteria | 148413 |
| 57 | Ga0068860_100431126 | 3300005843 | Bacteria | 1308 |
| 58 | Ga0070717_10000036 | 3300006028 | Bacteria | 125184 |
| 59 | Ga0097621_101984437 | 3300006237 | Unclassified | 556 |
| 60 | Ga0068871_100760849 | 3300006358 | Bacteria | 891 |
| 61 | Ga0075433_10443769 | 3300006852 | Bacteria | 1144 |
| 62 | Ga0075434_100686891 | 3300006871 | Bacteria | 1041 |
| 63 | Ga0075434_101054843 | 3300006871 | Unclassified | 826 |
| 64 | Ga0075429_100073811 | 3300006880 | Bacteria | 2971 |
| 65 | Ga0075429_100497361 | 3300006880 | Bacteria | 1068 |
| 66 | Ga0068865_100099514 | 3300006881 | Unclassified | 2126 |
| 67 | Ga0075436_100010375 | 3300006914 | Bacteria | 6383 |
| 68 | Ga0075436_100781648 | 3300006914 | Bacteria | 710 |
| 69 | Ga0075435_100000042 | 3300007076 | Bacteria | 65212 |
| 70 | Ga0075435_100207954 | 3300007076 | Bacteria | 1659 |
| 71 | Ga0075435_100852744 | 3300007076 | Bacteria | 794 |
| 72 | Ga0105244_10212446 | 3300009036 | Unclassified | 910 |
| 73 | Ga0105240_10010373 | 3300009093 | Bacteria | 13105 |
| 74 | Ga0111539_10005654 | 3300009094 | Bacteria | 16172 |
| 75 | Ga0111539_11076819 | 3300009094 | Unclassified | 934 |
| 76 | Ga0105245_10000005 | 3300009098 | Bacteria | 335871 |
| 77 | Ga0105245_10032040 | 3300009098 | Bacteria | 4654 |
| 78 | Ga0114129_10454071 | 3300009147 | Bacteria | 1680 |
| 79 | Ga0114129_11221296 | 3300009147 | Bacteria | 935 |
| 80 | Ga0105243_10452789 | 3300009148 | Bacteria | 1205 |
| 81 | Ga0105242_10085329 | 3300009176 | Bacteria | 2648 |
| 82 | Ga0105238_10000020 | 3300009551 | Bacteria | 211643 |
| 83 | Ga0105246_10095767 | 3300011119 | Unclassified | 2149 |
| 84 | Ga0105246_10355521 | 3300011119 | Bacteria | 1202 |
| 85 | Ga0157369_10000232 | 3300013105 | Bacteria | 77009 |
| 86 | Ga0157374_10000017 | 3300013296 | Bacteria | 288512 |
| 87 | Ga0157378_10002923 | 3300013297 | Bacteria | 15199 |
| 88 | Ga0157378_10002973 | 3300013297 | Bacteria | 15069 |
| 89 | Ga0157378_10010868 | 3300013297 | Bacteria | 7961 |
| 90 | Ga0163162_11768075 | 3300013306 | Unclassified | 706 |
| 91 | Ga0157375_10000148 | 3300013308 | Bacteria | 68603 |
| 92 | Ga0157375_10001833 | 3300013308 | Bacteria | 18250 |
| 93 | Ga0163163_10204447 | 3300014325 | Bacteria | 2023 |
| 94 | Ga0157380_10081456 | 3300014326 | Bacteria | 2648 |
| 95 | Ga0157380_10385582 | 3300014326 | Unclassified | 1324 |
| 96 | Ga0157377_10000005 | 3300014745 | Bacteria | 426955 |
| 97 | Ga0157379_10686440 | 3300014968 | Bacteria | 960 |
| 98 | Ga0157376_10000013 | 3300014969 | Bacteria | 304287 |
| 99 | Ga0213876_10000019 | 3300021384 | Bacteria | 279426 |
| 100 | Ga0213876_10021100 | 3300021384 | Unclassified | 3444 |
| 101 | Ga0207653_10146275 | 3300025885 | Bacteria | 867 |
| 102 | Ga0207699_10682273 | 3300025906 | Bacteria | 751 |
| 103 | Ga0207643_10035308 | 3300025908 | Bacteria | 2803 |
| 104 | Ga0207684_10039430 | 3300025910 | Bacteria | 4006 |
| 105 | Ga0207684_10100130 | 3300025910 | Bacteria | 2476 |
| 106 | Ga0207684_10649859 | 3300025910 | Unclassified | 899 |
| 107 | Ga0207684_10903666 | 3300025910 | Bacteria | 742 |
| 108 | Ga0207695_10038150 | 3300025913 | Bacteria | 5176 |
| 109 | Ga0207660_10146888 | 3300025917 | Unclassified | 1808 |
| 110 | Ga0207662_10133187 | 3300025918 | Bacteria | 1569 |
| 111 | Ga0207662_10662185 | 3300025918 | Unclassified | 730 |
| 112 | Ga0207646_10058959 | 3300025922 | Bacteria | 3428 |
| 113 | Ga0207646_11455492 | 3300025922 | Bacteria | 594 |
| 114 | Ga0207694_10000002 | 3300025924 | Bacteria | 1165763 |
| 115 | Ga0207694_10000003 | 3300025924 | Bacteria | 1165533 |
| 116 | Ga0207650_10000026 | 3300025925 | Bacteria | 264152 |
| 117 | Ga0207650_10011648 | 3300025925 | Bacteria | 6059 |
| 118 | Ga0207659_10000008 | 3300025926 | Bacteria | 321286 |
| 119 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 120 | Ga0207700_10147855 | 3300025928 | Bacteria | 1939 |
| 121 | Ga0207706_11110259 | 3300025933 | Bacteria | 660 |
| 122 | Ga0207686_10024014 | 3300025934 | Bacteria | 3526 |
| 123 | Ga0207709_10273414 | 3300025935 | Bacteria | 1244 |
| 124 | Ga0207669_10058027 | 3300025937 | Bacteria | 2360 |
| 125 | Ga0207704_10228530 | 3300025938 | Bacteria | 1382 |
| 126 | Ga0207665_10569414 | 3300025939 | Bacteria | 882 |
| 127 | Ga0207689_10012937 | 3300025942 | Bacteria | 7125 |
| 128 | Ga0207661_10000022 | 3300025944 | Bacteria | 198514 |
| 129 | Ga0207661_10106650 | 3300025944 | Unclassified | 2362 |
| 130 | Ga0207640_10001424 | 3300025981 | Bacteria | 12950 |
| 131 | Ga0207677_10000048 | 3300026023 | Bacteria | 101555 |
| 132 | Ga0207677_11847526 | 3300026023 | Unclassified | 561 |
| 133 | Ga0207639_10000003 | 3300026041 | Bacteria | 806887 |
| 134 | Ga0207676_10000047 | 3300026095 | Bacteria | 148537 |
| 135 | Ga0207698_11062349 | 3300026142 | Bacteria | 822 |
| 136 | Ga0207428_10000031 | 3300027907 | Bacteria | 235245 |
| 137 | Ga0307511_10001139 | 3300030521 | Bacteria | 28275 |
| 138 | Ga0316576_10019265 | 3300031727 | Bacteria | 4675 |
| 139 | Ga0373943_0324907 | 3300035170 | Unclassified | 878 |
| 140 | Ga0373947_0033169 | 3300035725 | Bacteria | 3047 |
| 141 | Ga0436365_0449015 | 3300039437 | Bacteria | 112416 |
| 142 | Ga0436365_0660644 | 3300039437 | Bacteria | 990 |
| 143 | Ga0436365_1005727 | 3300039437 | Bacteria | 14867 |
| 144 | Ga0436362_0234274 | 3300039453 | Bacteria | 9791 |
| 145 | Ga0451577_0661466 | 3300042876 | Bacteria | 947 |
| 146 | Ga0453683_0850178 | 3300044673 | Unclassified | 602 |
| 147 | Ga0466963_0578313 | 3300044694 | Bacteria | 793 |
| 148 | Ga0466960_0079007 | 3300044901 | Bacteria | 1653 |
| 149 | Ga0451576_0543328 | 3300045051 | Bacteria | 1221 |
| 150 | Ga0451576_1346952 | 3300045051 | Bacteria | 743 |
| 151 | Ga0495580_0003906 | 3300046472 | Bacteria | 12594 |
| 152 | Ga0495580_0010781 | 3300046472 | Bacteria | 7098 |
| 153 | Ga0495639_0642401 | 3300046475 | Bacteria | 547 |
| 154 | Ga0495662_0072922 | 3300046476 | Bacteria | 1665 |
| 155 | Ga0495586_0008791 | 3300046535 | Bacteria | 5379 |
| 156 | Ga0495647_0024812 | 3300046681 | Unclassified | 2185 |
| 157 | Ga0495604_0244350 | 3300047317 | Bacteria | 1226 |
| 158 | Ga0495679_008244 | 3300047446 | Bacteria | 4253 |
| 159 | Ga0495686_0488278 | 3300047472 | Bacteria | 650 |
| 160 | Ga0495602_0106876 | 3300048088 | Bacteria | 2283 |
| 161 | Ga0496102_0083895 | 3300048905 | Bacteria | 2940 |
| 162 | Ga0496106_0218908 | 3300048909 | Bacteria | 1518 |
| 163 | Ga0496112_0841205 | 3300048915 | Unclassified | 841 |
| 164 | Ga0496112_0877819 | 3300048915 | Bacteria | 820 |
| 165 | Ga0501073_0906944 | 3300049589 | Unclassified | 607 |
| 166 | nmdc:mga0k408_475372_c1 | 3300050493 | Bacteria | 741 |
| 167 | nmdc:mga05p37_1151986_c1 | 3300050507 | Unclassified | 806 |
| 168 | nmdc:mga09592_197011_c1 | 3300050508 | Unclassified | 1744 |
| 169 | nmdc:mga08y16_2048908_c1 | 3300050511 | Unclassified | 521 |
| 170 | nmdc:mga08y16_22_c1 | 3300050511 | Bacteria | 250162 |
| 171 | nmdc:mga0n895_969042_c1 | 3300050512 | Unclassified | 833 |
| 172 | nmdc:mga0rr50_193328_c1 | 3300050513 | Bacteria | 1669 |
| 173 | nmdc:mga0rr50_41_c1 | 3300050513 | Bacteria | 82447 |
| 174 | nmdc:mga0rr50_442541_c1 | 3300050513 | Bacteria | 1101 |
| 175 | nmdc:mga08x19_2733_c1 | 3300050514 | Bacteria | 10652 |
| 176 | nmdc:mga0a205_883557_c1 | 3300050515 | Bacteria | 741 |
| 177 | Ga0495655_0005432 | 3300053083 | Bacteria | 2249 |
| 178 | Ga0500616_0159981 | 3300053153 | Bacteria | 1033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0488278 | Ga0495686_0488278_233_631 | 123 |
| 2 | 3300025885 | Ga0207653_10146275 | Ga0207653_101462752 | 131 |
| 3 | 3300049589 | Ga0501073_0906944 | Ga0501073_0906944_55_531 | 133 |
| 4 | 3300050493 | nmdc:mga0k408_475372_c1 | nmdc:mga0k408_475372_c1_28_516 | 133 |
| 5 | 3300053153 | Ga0500616_0159981 | Ga0500616_0159981_138_605 | 133 |
| 6 | 3300046472 | Ga0495580_0003906 | Ga0495580_0003906_534_941 | 135 |
| 7 | 3300046475 | Ga0495639_0642401 | Ga0495639_0642401_51_458 | 135 |
| 8 | 3300002155 | JGI24033J26618_1053547 | JGI24033J26618_10535471 | 136 |
| 9 | 3300005327 | Ga0070658_10003522 | Ga0070658_100035225 | 136 |
| 10 | 3300005329 | Ga0070683_100003646 | Ga0070683_1000036464 | 136 |
| 11 | 3300005329 | Ga0070683_100358405 | Ga0070683_1003584052 | 136 |
| 12 | 3300005331 | Ga0070670_100000080 | Ga0070670_10000008034 | 136 |
| 13 | 3300005331 | Ga0070670_100050940 | Ga0070670_1000509403 | 136 |
| 14 | 3300005334 | Ga0068869_100020988 | Ga0068869_1000209884 | 136 |
| 15 | 3300005336 | Ga0070680_100459018 | Ga0070680_1004590182 | 136 |
| 16 | 3300005338 | Ga0068868_100000862 | Ga0068868_10000086213 | 136 |
| 17 | 3300005343 | Ga0070687_100166097 | Ga0070687_1001660972 | 136 |
| 18 | 3300005343 | Ga0070687_100998487 | Ga0070687_1009984871 | 136 |
| 19 | 3300005354 | Ga0070675_100000006 | Ga0070675_100000006125 | 136 |
| 20 | 3300005356 | Ga0070674_100078115 | Ga0070674_1000781153 | 136 |
| 21 | 3300005364 | Ga0070673_101644929 | Ga0070673_1016449291 | 136 |
| 22 | 3300005365 | Ga0070688_100962095 | Ga0070688_1009620952 | 136 |
| 23 | 3300005434 | Ga0070709_10106797 | Ga0070709_101067974 | 136 |
| 24 | 3300005434 | Ga0070709_10258044 | Ga0070709_102580441 | 136 |
| 25 | 3300005436 | Ga0070713_100004895 | Ga0070713_1000048952 | 136 |
| 26 | 3300005445 | Ga0070708_100001911 | Ga0070708_1000019118 | 136 |
| 27 | 3300005445 | Ga0070708_100014931 | Ga0070708_1000149316 | 136 |
| 28 | 3300005445 | Ga0070708_100057435 | Ga0070708_1000574351 | 136 |
| 29 | 3300005445 | Ga0070708_100192716 | Ga0070708_1001927161 | 136 |
| 30 | 3300005457 | Ga0070662_101252174 | Ga0070662_1012521741 | 136 |
| 31 | 3300005466 | Ga0070685_10973933 | Ga0070685_109739331 | 136 |
| 32 | 3300005467 | Ga0070706_100004384 | Ga0070706_1000043844 | 136 |
| 33 | 3300005467 | Ga0070706_100006026 | Ga0070706_1000060268 | 136 |
| 34 | 3300005467 | Ga0070706_100031520 | Ga0070706_1000315204 | 136 |
| 35 | 3300005467 | Ga0070706_100171567 | Ga0070706_1001715672 | 136 |
| 36 | 3300005468 | Ga0070707_100028756 | Ga0070707_1000287563 | 136 |
| 37 | 3300005468 | Ga0070707_100043870 | Ga0070707_1000438703 | 136 |
| 38 | 3300005468 | Ga0070707_100140900 | Ga0070707_1001409002 | 136 |
| 39 | 3300005468 | Ga0070707_100418975 | Ga0070707_1004189751 | 136 |
| 40 | 3300005468 | Ga0070707_100525638 | Ga0070707_1005256381 | 136 |
| 41 | 3300005468 | Ga0070707_101479636 | Ga0070707_1014796362 | 136 |
| 42 | 3300005471 | Ga0070698_100000807 | Ga0070698_1000008073 | 136 |
| 43 | 3300005471 | Ga0070698_100241208 | Ga0070698_1002412083 | 136 |
| 44 | 3300005471 | Ga0070698_100643229 | Ga0070698_1006432292 | 136 |
| 45 | 3300005471 | Ga0070698_100731001 | Ga0070698_1007310012 | 136 |
| 46 | 3300005471 | Ga0070698_101022162 | Ga0070698_1010221622 | 136 |
| 47 | 3300005518 | Ga0070699_100393997 | Ga0070699_1003939972 | 136 |
| 48 | 3300005518 | Ga0070699_101132786 | Ga0070699_1011327861 | 136 |
| 49 | 3300005535 | Ga0070684_100003340 | Ga0070684_1000033404 | 136 |
| 50 | 3300005536 | Ga0070697_100007514 | Ga0070697_1000075149 | 136 |
| 51 | 3300005536 | Ga0070697_100096596 | Ga0070697_1000965963 | 136 |
| 52 | 3300005536 | Ga0070697_100516525 | Ga0070697_1005165252 | 136 |
| 53 | 3300005536 | Ga0070697_101461851 | Ga0070697_1014618511 | 136 |
| 54 | 3300005539 | Ga0068853_100191698 | Ga0068853_1001916982 | 136 |
| 55 | 3300005539 | Ga0068853_100277222 | Ga0068853_1002772222 | 136 |
| 56 | 3300005539 | Ga0068853_101806743 | Ga0068853_1018067431 | 136 |
| 57 | 3300005545 | Ga0070695_100687193 | Ga0070695_1006871931 | 136 |
| 58 | 3300005546 | Ga0070696_100254100 | Ga0070696_1002541001 | 136 |
| 59 | 3300005549 | Ga0070704_100545511 | Ga0070704_1005455112 | 136 |
| 60 | 3300005578 | Ga0068854_100326629 | Ga0068854_1003266292 | 136 |
| 61 | 3300005616 | Ga0068852_100732947 | Ga0068852_1007329471 | 136 |
| 62 | 3300005616 | Ga0068852_101048163 | Ga0068852_1010481632 | 136 |
| 63 | 3300005618 | Ga0068864_100000048 | Ga0068864_100000048109 | 136 |
| 64 | 3300005843 | Ga0068860_100431126 | Ga0068860_1004311263 | 136 |
| 65 | 3300006028 | Ga0070717_10000036 | Ga0070717_1000003613 | 136 |
| 66 | 3300006237 | Ga0097621_101984437 | Ga0097621_1019844371 | 136 |
| 67 | 3300006358 | Ga0068871_100760849 | Ga0068871_1007608492 | 136 |
| 68 | 3300006852 | Ga0075433_10443769 | Ga0075433_104437692 | 136 |
| 69 | 3300006871 | Ga0075434_100686891 | Ga0075434_1006868911 | 136 |
| 70 | 3300006871 | Ga0075434_101054843 | Ga0075434_1010548431 | 136 |
| 71 | 3300006880 | Ga0075429_100073811 | Ga0075429_1000738111 | 136 |
| 72 | 3300006880 | Ga0075429_100497361 | Ga0075429_1004973612 | 136 |
| 73 | 3300006881 | Ga0068865_100099514 | Ga0068865_1000995142 | 136 |
| 74 | 3300006914 | Ga0075436_100010375 | Ga0075436_1000103758 | 136 |
| 75 | 3300006914 | Ga0075436_100781648 | Ga0075436_1007816482 | 136 |
| 76 | 3300007076 | Ga0075435_100000042 | Ga0075435_10000004210 | 136 |
| 77 | 3300007076 | Ga0075435_100207954 | Ga0075435_1002079541 | 136 |
| 78 | 3300007076 | Ga0075435_100852744 | Ga0075435_1008527441 | 136 |
| 79 | 3300009036 | Ga0105244_10212446 | Ga0105244_102124462 | 136 |
| 80 | 3300009093 | Ga0105240_10010373 | Ga0105240_100103737 | 136 |
| 81 | 3300009094 | Ga0111539_10005654 | Ga0111539_100056547 | 136 |
| 82 | 3300009094 | Ga0111539_11076819 | Ga0111539_110768192 | 136 |
| 83 | 3300009098 | Ga0105245_10000005 | Ga0105245_10000005239 | 136 |
| 84 | 3300009098 | Ga0105245_10032040 | Ga0105245_100320404 | 136 |
| 85 | 3300009147 | Ga0114129_10454071 | Ga0114129_104540713 | 136 |
| 86 | 3300009147 | Ga0114129_11221296 | Ga0114129_112212962 | 136 |
| 87 | 3300009148 | Ga0105243_10452789 | Ga0105243_104527892 | 136 |
| 88 | 3300009176 | Ga0105242_10085329 | Ga0105242_100853293 | 136 |
| 89 | 3300009551 | Ga0105238_10000020 | Ga0105238_1000002039 | 136 |
| 90 | 3300011119 | Ga0105246_10095767 | Ga0105246_100957672 | 136 |
| 91 | 3300011119 | Ga0105246_10355521 | Ga0105246_103555212 | 136 |
| 92 | 3300013105 | Ga0157369_10000232 | Ga0157369_1000023252 | 136 |
| 93 | 3300013296 | Ga0157374_10000017 | Ga0157374_10000017200 | 136 |
| 94 | 3300013297 | Ga0157378_10002923 | Ga0157378_100029238 | 136 |
| 95 | 3300013297 | Ga0157378_10002973 | Ga0157378_100029738 | 136 |
| 96 | 3300013297 | Ga0157378_10010868 | Ga0157378_100108688 | 136 |
| 97 | 3300013306 | Ga0163162_11768075 | Ga0163162_117680752 | 136 |
| 98 | 3300013308 | Ga0157375_10000148 | Ga0157375_100001484 | 136 |
| 99 | 3300013308 | Ga0157375_10001833 | Ga0157375_1000183314 | 136 |
| 100 | 3300014325 | Ga0163163_10204447 | Ga0163163_102044471 | 136 |
| 101 | 3300014326 | Ga0157380_10081456 | Ga0157380_100814563 | 136 |
| 102 | 3300014326 | Ga0157380_10385582 | Ga0157380_103855823 | 136 |
| 103 | 3300014745 | Ga0157377_10000005 | Ga0157377_10000005208 | 136 |
| 104 | 3300014968 | Ga0157379_10686440 | Ga0157379_106864402 | 136 |
| 105 | 3300014969 | Ga0157376_10000013 | Ga0157376_1000001341 | 136 |
| 106 | 3300021384 | Ga0213876_10000019 | Ga0213876_1000001934 | 136 |
| 107 | 3300021384 | Ga0213876_10021100 | Ga0213876_100211003 | 136 |
| 108 | 3300025906 | Ga0207699_10682273 | Ga0207699_106822732 | 136 |
| 109 | 3300025908 | Ga0207643_10035308 | Ga0207643_100353082 | 136 |
| 110 | 3300025910 | Ga0207684_10039430 | Ga0207684_100394304 | 136 |
| 111 | 3300025910 | Ga0207684_10100130 | Ga0207684_101001303 | 136 |
| 112 | 3300025910 | Ga0207684_10649859 | Ga0207684_106498591 | 136 |
| 113 | 3300025910 | Ga0207684_10903666 | Ga0207684_109036662 | 136 |
| 114 | 3300025913 | Ga0207695_10038150 | Ga0207695_100381502 | 136 |
| 115 | 3300025917 | Ga0207660_10146888 | Ga0207660_101468882 | 136 |
| 116 | 3300025918 | Ga0207662_10133187 | Ga0207662_101331872 | 136 |
| 117 | 3300025918 | Ga0207662_10662185 | Ga0207662_106621852 | 136 |
| 118 | 3300025922 | Ga0207646_10058959 | Ga0207646_100589593 | 136 |
| 119 | 3300025922 | Ga0207646_11455492 | Ga0207646_114554921 | 136 |
| 120 | 3300025924 | Ga0207694_10000002 | Ga0207694_10000002781 | 136 |
| 121 | 3300025924 | Ga0207694_10000003 | Ga0207694_10000003319 | 136 |
| 122 | 3300025925 | Ga0207650_10000026 | Ga0207650_10000026190 | 136 |
| 123 | 3300025925 | Ga0207650_10011648 | Ga0207650_100116485 | 136 |
| 124 | 3300025926 | Ga0207659_10000008 | Ga0207659_10000008155 | 136 |
| 125 | 3300025927 | Ga0207687_10000005 | Ga0207687_10000005160 | 136 |
| 126 | 3300025928 | Ga0207700_10147855 | Ga0207700_101478553 | 136 |
| 127 | 3300025933 | Ga0207706_11110259 | Ga0207706_111102591 | 136 |
| 128 | 3300025934 | Ga0207686_10024014 | Ga0207686_100240143 | 136 |
| 129 | 3300025935 | Ga0207709_10273414 | Ga0207709_102734144 | 136 |
| 130 | 3300025937 | Ga0207669_10058027 | Ga0207669_100580273 | 136 |
| 131 | 3300025938 | Ga0207704_10228530 | Ga0207704_102285302 | 136 |
| 132 | 3300025939 | Ga0207665_10569414 | Ga0207665_105694142 | 136 |
| 133 | 3300025942 | Ga0207689_10012937 | Ga0207689_100129372 | 136 |
| 134 | 3300025944 | Ga0207661_10000022 | Ga0207661_1000002240 | 136 |
| 135 | 3300025944 | Ga0207661_10106650 | Ga0207661_101066503 | 136 |
| 136 | 3300025981 | Ga0207640_10001424 | Ga0207640_100014245 | 136 |
| 137 | 3300026023 | Ga0207677_10000048 | Ga0207677_1000004880 | 136 |
| 138 | 3300026023 | Ga0207677_11847526 | Ga0207677_118475261 | 136 |
| 139 | 3300026041 | Ga0207639_10000003 | Ga0207639_10000003491 | 136 |
| 140 | 3300026095 | Ga0207676_10000047 | Ga0207676_10000047107 | 136 |
| 141 | 3300026142 | Ga0207698_11062349 | Ga0207698_110623491 | 136 |
| 142 | 3300027907 | Ga0207428_10000031 | Ga0207428_10000031152 | 136 |
| 143 | 3300030521 | Ga0307511_10001139 | Ga0307511_100011398 | 136 |
| 144 | 3300031727 | Ga0316576_10019265 | Ga0316576_100192652 | 136 |
| 145 | 3300035170 | Ga0373943_0324907 | Ga0373943_0324907_400_819 | 136 |
| 146 | 3300035725 | Ga0373947_0033169 | Ga0373947_0033169_1393_1830 | 136 |
| 147 | 3300039437 | Ga0436365_0449015 | Ga0436365_0449015_28908_29333 | 136 |
| 148 | 3300039437 | Ga0436365_0660644 | Ga0436365_0660644_545_973 | 136 |
| 149 | 3300039437 | Ga0436365_1005727 | Ga0436365_1005727_1174_1587 | 136 |
| 150 | 3300039453 | Ga0436362_0234274 | Ga0436362_0234274_6000_6425 | 136 |
| 151 | 3300042876 | Ga0451577_0661466 | Ga0451577_0661466_187_624 | 136 |
| 152 | 3300044673 | Ga0453683_0850178 | Ga0453683_0850178_68_520 | 136 |
| 153 | 3300044694 | Ga0466963_0578313 | Ga0466963_0578313_229_651 | 136 |
| 154 | 3300044901 | Ga0466960_0079007 | Ga0466960_0079007_1141_1572 | 136 |
| 155 | 3300045051 | Ga0451576_0543328 | Ga0451576_0543328_358_804 | 136 |
| 156 | 3300045051 | Ga0451576_1346952 | Ga0451576_1346952_220_657 | 136 |
| 157 | 3300046472 | Ga0495580_0010781 | Ga0495580_0010781_1838_2284 | 136 |
| 158 | 3300046476 | Ga0495662_0072922 | Ga0495662_0072922_1127_1564 | 136 |
| 159 | 3300046535 | Ga0495586_0008791 | Ga0495586_0008791_4150_4587 | 136 |
| 160 | 3300046681 | Ga0495647_0024812 | Ga0495647_0024812_667_1104 | 136 |
| 161 | 3300047317 | Ga0495604_0244350 | Ga0495604_0244350_647_1078 | 136 |
| 162 | 3300047446 | Ga0495679_008244 | Ga0495679_008244_2620_3039 | 136 |
| 163 | 3300048088 | Ga0495602_0106876 | Ga0495602_0106876_1282_1713 | 136 |
| 164 | 3300048905 | Ga0496102_0083895 | Ga0496102_0083895_2298_2726 | 136 |
| 165 | 3300048909 | Ga0496106_0218908 | Ga0496106_0218908_715_1128 | 136 |
| 166 | 3300048915 | Ga0496112_0841205 | Ga0496112_0841205_150_560 | 136 |
| 167 | 3300048915 | Ga0496112_0877819 | Ga0496112_0877819_354_776 | 136 |
| 168 | 3300050507 | nmdc:mga05p37_1151986_c1 | nmdc:mga05p37_1151986_c1_18_443 | 136 |
| 169 | 3300050508 | nmdc:mga09592_197011_c1 | nmdc:mga09592_197011_c1_1148_1639 | 136 |
| 170 | 3300050511 | nmdc:mga08y16_2048908_c1 | nmdc:mga08y16_2048908_c1_26_457 | 136 |
| 171 | 3300050511 | nmdc:mga08y16_22_c1 | nmdc:mga08y16_22_c1_195908_196333 | 136 |
| 172 | 3300050512 | nmdc:mga0n895_969042_c1 | nmdc:mga0n895_969042_c1_36_467 | 136 |
| 173 | 3300050513 | nmdc:mga0rr50_193328_c1 | nmdc:mga0rr50_193328_c1_925_1368 | 136 |
| 174 | 3300050513 | nmdc:mga0rr50_41_c1 | nmdc:mga0rr50_41_c1_62971_63387 | 136 |
| 175 | 3300050513 | nmdc:mga0rr50_442541_c1 | nmdc:mga0rr50_442541_c1_661_1077 | 136 |
| 176 | 3300050514 | nmdc:mga08x19_2733_c1 | nmdc:mga08x19_2733_c1_5803_6219 | 136 |
| 177 | 3300050515 | nmdc:mga0a205_883557_c1 | nmdc:mga0a205_883557_c1_72_503 | 136 |
| 178 | 3300053083 | Ga0495655_0005432 | Ga0495655_0005432_78_518 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.9721 | 7 | 135 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.9562 | 3 | 134 |
| 3k67-assembly1.cif.gz_A | crystal structure of protein af1124 from archaeoglobus fulgidus | 0.9528 | 7 | 135 |
| 1iq6-assembly1.cif.gz_A | (r)-hydratase from a. caviae involved in pha biosynthesis | 0.9434 | 7 | 135 |
| 5cpg-assembly1.cif.gz_B | r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form | 0.9156 | 3 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QPM6_23_166_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9725 | 7 | 136 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9721 | 7 | 135 | 3.10.129.10 |
| 5cpgB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9562 | 3 | 134 | 3.10.129.10 |
| 3k67A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9528 | 7 | 135 | 3.10.129.10 |
| 1iq6A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9434 | 7 | 135 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I0EH65-F1-model_v4 | SDR family oxidoreductase | 0.9883 | 4 | 136 |
GO:0006635
GO:0016491 |
| AF-A0A2E0F9E5-F1-model_v4 | Bifunctional riboflavin kinase/FMN adenylyltransferase (EC 2.7.1.26) (EC 2.7.7.2) (Riboflavin biosynthesis protein RibF) | 0.9866 | 2 | 134 |
GO:0003919
GO:0005524 GO:0006747 GO:0008531 GO:0009231 GO:0009398 |
| AF-A0A7X7PVC1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9861 | 4 | 136 |
GO:0006633
GO:0006635 GO:0019171 |
| AF-B0ULP0-F1-model_v4 | deleted | 0.9843 | 3 | 134 |
|
| AF-A0A0M9E4W9-F1-model_v4 | Enoyl-CoA hydratase | 0.9842 | 4 | 136 |
GO:0006633
GO:0019171 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar