F272781

General Info

Members Datasets Scaffolds Average Seq Length
178 121 178 142

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0906944|Ga0501073_0906944_55_531
Length 158
Sequence MNTVPAKAAVDPRMVRTLCFEDLHVGMRETLMKSVMETDVVGFADISGDENPIHLCDTYAQGTRFGQRIAHGLYTASLISAVLGTRLPGAGAVYRSQTLNFHAPVKIGDVVTIIVEVIELVREGRRVRLQCEALVDNTVVLDGEAIVSVPGRPKGVTA

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.12
Nodule 0
Rhizoplane 2.25
Rhizosphere 93.26
Stem 0
Stem Tuber 0
Unclassified 3.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1053547 3300002155 Bacteria 583
2 Ga0070658_10003522 3300005327 Bacteria 12849
3 Ga0070683_100003646 3300005329 Bacteria 12544
4 Ga0070683_100358405 3300005329 Bacteria 1389
5 Ga0070670_100000080 3300005331 Bacteria 92128
6 Ga0070670_100050940 3300005331 Bacteria 3557
7 Ga0068869_100020988 3300005334 Bacteria 4489
8 Ga0070680_100459018 3300005336 Unclassified 1088
9 Ga0068868_100000862 3300005338 Bacteria 20527
10 Ga0070687_100166097 3300005343 Unclassified 1309
11 Ga0070687_100998487 3300005343 Unclassified 606
12 Ga0070675_100000006 3300005354 Bacteria 280013
13 Ga0070674_100078115 3300005356 Bacteria 2358
14 Ga0070673_101644929 3300005364 Unclassified 607
15 Ga0070688_100962095 3300005365 Unclassified 676
16 Ga0070709_10106797 3300005434 Bacteria 1875
17 Ga0070709_10258044 3300005434 Bacteria 1258
18 Ga0070713_100004895 3300005436 Bacteria 9087
19 Ga0070708_100001911 3300005445 Bacteria 16032
20 Ga0070708_100014931 3300005445 Bacteria 6403
21 Ga0070708_100057435 3300005445 Bacteria 3465
22 Ga0070708_100192716 3300005445 Bacteria 1907
23 Ga0070662_101252174 3300005457 Unclassified 638
24 Ga0070685_10973933 3300005466 Unclassified 635
25 Ga0070706_100004384 3300005467 Bacteria 13635
26 Ga0070706_100006026 3300005467 Bacteria 11460
27 Ga0070706_100031520 3300005467 Bacteria 4888
28 Ga0070706_100171567 3300005467 Bacteria 2026
29 Ga0070707_100028756 3300005468 Bacteria 5290
30 Ga0070707_100043870 3300005468 Bacteria 4280
31 Ga0070707_100140900 3300005468 Bacteria 2347
32 Ga0070707_100418975 3300005468 Unclassified 1299
33 Ga0070707_100525638 3300005468 Bacteria 1145
34 Ga0070707_101479636 3300005468 Bacteria 646
35 Ga0070698_100000807 3300005471 Bacteria 34196
36 Ga0070698_100241208 3300005471 Bacteria 1741
37 Ga0070698_100643229 3300005471 Bacteria 1001
38 Ga0070698_100731001 3300005471 Bacteria 932
39 Ga0070698_101022162 3300005471 Bacteria 774
40 Ga0070699_100393997 3300005518 Bacteria 1251
41 Ga0070699_101132786 3300005518 Unclassified 718
42 Ga0070684_100003340 3300005535 Bacteria 12013
43 Ga0070697_100007514 3300005536 Bacteria 8483
44 Ga0070697_100096596 3300005536 Bacteria 2451
45 Ga0070697_100516525 3300005536 Bacteria 1045
46 Ga0070697_101461851 3300005536 Unclassified 611
47 Ga0068853_100191698 3300005539 Bacteria 1857
48 Ga0068853_100277222 3300005539 Bacteria 1545
49 Ga0068853_101806743 3300005539 Unclassified 593
50 Ga0070695_100687193 3300005545 Unclassified 811
51 Ga0070696_100254100 3300005546 Bacteria 1330
52 Ga0070704_100545511 3300005549 Unclassified 1012
53 Ga0068854_100326629 3300005578 Unclassified 1249
54 Ga0068852_100732947 3300005616 Bacteria 1000
55 Ga0068852_101048163 3300005616 Bacteria 835
56 Ga0068864_100000048 3300005618 Bacteria 148413
57 Ga0068860_100431126 3300005843 Bacteria 1308
58 Ga0070717_10000036 3300006028 Bacteria 125184
59 Ga0097621_101984437 3300006237 Unclassified 556
60 Ga0068871_100760849 3300006358 Bacteria 891
61 Ga0075433_10443769 3300006852 Bacteria 1144
62 Ga0075434_100686891 3300006871 Bacteria 1041
63 Ga0075434_101054843 3300006871 Unclassified 826
64 Ga0075429_100073811 3300006880 Bacteria 2971
65 Ga0075429_100497361 3300006880 Bacteria 1068
66 Ga0068865_100099514 3300006881 Unclassified 2126
67 Ga0075436_100010375 3300006914 Bacteria 6383
68 Ga0075436_100781648 3300006914 Bacteria 710
69 Ga0075435_100000042 3300007076 Bacteria 65212
70 Ga0075435_100207954 3300007076 Bacteria 1659
71 Ga0075435_100852744 3300007076 Bacteria 794
72 Ga0105244_10212446 3300009036 Unclassified 910
73 Ga0105240_10010373 3300009093 Bacteria 13105
74 Ga0111539_10005654 3300009094 Bacteria 16172
75 Ga0111539_11076819 3300009094 Unclassified 934
76 Ga0105245_10000005 3300009098 Bacteria 335871
77 Ga0105245_10032040 3300009098 Bacteria 4654
78 Ga0114129_10454071 3300009147 Bacteria 1680
79 Ga0114129_11221296 3300009147 Bacteria 935
80 Ga0105243_10452789 3300009148 Bacteria 1205
81 Ga0105242_10085329 3300009176 Bacteria 2648
82 Ga0105238_10000020 3300009551 Bacteria 211643
83 Ga0105246_10095767 3300011119 Unclassified 2149
84 Ga0105246_10355521 3300011119 Bacteria 1202
85 Ga0157369_10000232 3300013105 Bacteria 77009
86 Ga0157374_10000017 3300013296 Bacteria 288512
87 Ga0157378_10002923 3300013297 Bacteria 15199
88 Ga0157378_10002973 3300013297 Bacteria 15069
89 Ga0157378_10010868 3300013297 Bacteria 7961
90 Ga0163162_11768075 3300013306 Unclassified 706
91 Ga0157375_10000148 3300013308 Bacteria 68603
92 Ga0157375_10001833 3300013308 Bacteria 18250
93 Ga0163163_10204447 3300014325 Bacteria 2023
94 Ga0157380_10081456 3300014326 Bacteria 2648
95 Ga0157380_10385582 3300014326 Unclassified 1324
96 Ga0157377_10000005 3300014745 Bacteria 426955
97 Ga0157379_10686440 3300014968 Bacteria 960
98 Ga0157376_10000013 3300014969 Bacteria 304287
99 Ga0213876_10000019 3300021384 Bacteria 279426
100 Ga0213876_10021100 3300021384 Unclassified 3444
101 Ga0207653_10146275 3300025885 Bacteria 867
102 Ga0207699_10682273 3300025906 Bacteria 751
103 Ga0207643_10035308 3300025908 Bacteria 2803
104 Ga0207684_10039430 3300025910 Bacteria 4006
105 Ga0207684_10100130 3300025910 Bacteria 2476
106 Ga0207684_10649859 3300025910 Unclassified 899
107 Ga0207684_10903666 3300025910 Bacteria 742
108 Ga0207695_10038150 3300025913 Bacteria 5176
109 Ga0207660_10146888 3300025917 Unclassified 1808
110 Ga0207662_10133187 3300025918 Bacteria 1569
111 Ga0207662_10662185 3300025918 Unclassified 730
112 Ga0207646_10058959 3300025922 Bacteria 3428
113 Ga0207646_11455492 3300025922 Bacteria 594
114 Ga0207694_10000002 3300025924 Bacteria 1165763
115 Ga0207694_10000003 3300025924 Bacteria 1165533
116 Ga0207650_10000026 3300025925 Bacteria 264152
117 Ga0207650_10011648 3300025925 Bacteria 6059
118 Ga0207659_10000008 3300025926 Bacteria 321286
119 Ga0207687_10000005 3300025927 Bacteria 770649
120 Ga0207700_10147855 3300025928 Bacteria 1939
121 Ga0207706_11110259 3300025933 Bacteria 660
122 Ga0207686_10024014 3300025934 Bacteria 3526
123 Ga0207709_10273414 3300025935 Bacteria 1244
124 Ga0207669_10058027 3300025937 Bacteria 2360
125 Ga0207704_10228530 3300025938 Bacteria 1382
126 Ga0207665_10569414 3300025939 Bacteria 882
127 Ga0207689_10012937 3300025942 Bacteria 7125
128 Ga0207661_10000022 3300025944 Bacteria 198514
129 Ga0207661_10106650 3300025944 Unclassified 2362
130 Ga0207640_10001424 3300025981 Bacteria 12950
131 Ga0207677_10000048 3300026023 Bacteria 101555
132 Ga0207677_11847526 3300026023 Unclassified 561
133 Ga0207639_10000003 3300026041 Bacteria 806887
134 Ga0207676_10000047 3300026095 Bacteria 148537
135 Ga0207698_11062349 3300026142 Bacteria 822
136 Ga0207428_10000031 3300027907 Bacteria 235245
137 Ga0307511_10001139 3300030521 Bacteria 28275
138 Ga0316576_10019265 3300031727 Bacteria 4675
139 Ga0373943_0324907 3300035170 Unclassified 878
140 Ga0373947_0033169 3300035725 Bacteria 3047
141 Ga0436365_0449015 3300039437 Bacteria 112416
142 Ga0436365_0660644 3300039437 Bacteria 990
143 Ga0436365_1005727 3300039437 Bacteria 14867
144 Ga0436362_0234274 3300039453 Bacteria 9791
145 Ga0451577_0661466 3300042876 Bacteria 947
146 Ga0453683_0850178 3300044673 Unclassified 602
147 Ga0466963_0578313 3300044694 Bacteria 793
148 Ga0466960_0079007 3300044901 Bacteria 1653
149 Ga0451576_0543328 3300045051 Bacteria 1221
150 Ga0451576_1346952 3300045051 Bacteria 743
151 Ga0495580_0003906 3300046472 Bacteria 12594
152 Ga0495580_0010781 3300046472 Bacteria 7098
153 Ga0495639_0642401 3300046475 Bacteria 547
154 Ga0495662_0072922 3300046476 Bacteria 1665
155 Ga0495586_0008791 3300046535 Bacteria 5379
156 Ga0495647_0024812 3300046681 Unclassified 2185
157 Ga0495604_0244350 3300047317 Bacteria 1226
158 Ga0495679_008244 3300047446 Bacteria 4253
159 Ga0495686_0488278 3300047472 Bacteria 650
160 Ga0495602_0106876 3300048088 Bacteria 2283
161 Ga0496102_0083895 3300048905 Bacteria 2940
162 Ga0496106_0218908 3300048909 Bacteria 1518
163 Ga0496112_0841205 3300048915 Unclassified 841
164 Ga0496112_0877819 3300048915 Bacteria 820
165 Ga0501073_0906944 3300049589 Unclassified 607
166 nmdc:mga0k408_475372_c1 3300050493 Bacteria 741
167 nmdc:mga05p37_1151986_c1 3300050507 Unclassified 806
168 nmdc:mga09592_197011_c1 3300050508 Unclassified 1744
169 nmdc:mga08y16_2048908_c1 3300050511 Unclassified 521
170 nmdc:mga08y16_22_c1 3300050511 Bacteria 250162
171 nmdc:mga0n895_969042_c1 3300050512 Unclassified 833
172 nmdc:mga0rr50_193328_c1 3300050513 Bacteria 1669
173 nmdc:mga0rr50_41_c1 3300050513 Bacteria 82447
174 nmdc:mga0rr50_442541_c1 3300050513 Bacteria 1101
175 nmdc:mga08x19_2733_c1 3300050514 Bacteria 10652
176 nmdc:mga0a205_883557_c1 3300050515 Bacteria 741
177 Ga0495655_0005432 3300053083 Bacteria 2249
178 Ga0500616_0159981 3300053153 Bacteria 1033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0488278 Ga0495686_0488278_233_631 123
2 3300025885 Ga0207653_10146275 Ga0207653_101462752 131
3 3300049589 Ga0501073_0906944 Ga0501073_0906944_55_531 133
4 3300050493 nmdc:mga0k408_475372_c1 nmdc:mga0k408_475372_c1_28_516 133
5 3300053153 Ga0500616_0159981 Ga0500616_0159981_138_605 133
6 3300046472 Ga0495580_0003906 Ga0495580_0003906_534_941 135
7 3300046475 Ga0495639_0642401 Ga0495639_0642401_51_458 135
8 3300002155 JGI24033J26618_1053547 JGI24033J26618_10535471 136
9 3300005327 Ga0070658_10003522 Ga0070658_100035225 136
10 3300005329 Ga0070683_100003646 Ga0070683_1000036464 136
11 3300005329 Ga0070683_100358405 Ga0070683_1003584052 136
12 3300005331 Ga0070670_100000080 Ga0070670_10000008034 136
13 3300005331 Ga0070670_100050940 Ga0070670_1000509403 136
14 3300005334 Ga0068869_100020988 Ga0068869_1000209884 136
15 3300005336 Ga0070680_100459018 Ga0070680_1004590182 136
16 3300005338 Ga0068868_100000862 Ga0068868_10000086213 136
17 3300005343 Ga0070687_100166097 Ga0070687_1001660972 136
18 3300005343 Ga0070687_100998487 Ga0070687_1009984871 136
19 3300005354 Ga0070675_100000006 Ga0070675_100000006125 136
20 3300005356 Ga0070674_100078115 Ga0070674_1000781153 136
21 3300005364 Ga0070673_101644929 Ga0070673_1016449291 136
22 3300005365 Ga0070688_100962095 Ga0070688_1009620952 136
23 3300005434 Ga0070709_10106797 Ga0070709_101067974 136
24 3300005434 Ga0070709_10258044 Ga0070709_102580441 136
25 3300005436 Ga0070713_100004895 Ga0070713_1000048952 136
26 3300005445 Ga0070708_100001911 Ga0070708_1000019118 136
27 3300005445 Ga0070708_100014931 Ga0070708_1000149316 136
28 3300005445 Ga0070708_100057435 Ga0070708_1000574351 136
29 3300005445 Ga0070708_100192716 Ga0070708_1001927161 136
30 3300005457 Ga0070662_101252174 Ga0070662_1012521741 136
31 3300005466 Ga0070685_10973933 Ga0070685_109739331 136
32 3300005467 Ga0070706_100004384 Ga0070706_1000043844 136
33 3300005467 Ga0070706_100006026 Ga0070706_1000060268 136
34 3300005467 Ga0070706_100031520 Ga0070706_1000315204 136
35 3300005467 Ga0070706_100171567 Ga0070706_1001715672 136
36 3300005468 Ga0070707_100028756 Ga0070707_1000287563 136
37 3300005468 Ga0070707_100043870 Ga0070707_1000438703 136
38 3300005468 Ga0070707_100140900 Ga0070707_1001409002 136
39 3300005468 Ga0070707_100418975 Ga0070707_1004189751 136
40 3300005468 Ga0070707_100525638 Ga0070707_1005256381 136
41 3300005468 Ga0070707_101479636 Ga0070707_1014796362 136
42 3300005471 Ga0070698_100000807 Ga0070698_1000008073 136
43 3300005471 Ga0070698_100241208 Ga0070698_1002412083 136
44 3300005471 Ga0070698_100643229 Ga0070698_1006432292 136
45 3300005471 Ga0070698_100731001 Ga0070698_1007310012 136
46 3300005471 Ga0070698_101022162 Ga0070698_1010221622 136
47 3300005518 Ga0070699_100393997 Ga0070699_1003939972 136
48 3300005518 Ga0070699_101132786 Ga0070699_1011327861 136
49 3300005535 Ga0070684_100003340 Ga0070684_1000033404 136
50 3300005536 Ga0070697_100007514 Ga0070697_1000075149 136
51 3300005536 Ga0070697_100096596 Ga0070697_1000965963 136
52 3300005536 Ga0070697_100516525 Ga0070697_1005165252 136
53 3300005536 Ga0070697_101461851 Ga0070697_1014618511 136
54 3300005539 Ga0068853_100191698 Ga0068853_1001916982 136
55 3300005539 Ga0068853_100277222 Ga0068853_1002772222 136
56 3300005539 Ga0068853_101806743 Ga0068853_1018067431 136
57 3300005545 Ga0070695_100687193 Ga0070695_1006871931 136
58 3300005546 Ga0070696_100254100 Ga0070696_1002541001 136
59 3300005549 Ga0070704_100545511 Ga0070704_1005455112 136
60 3300005578 Ga0068854_100326629 Ga0068854_1003266292 136
61 3300005616 Ga0068852_100732947 Ga0068852_1007329471 136
62 3300005616 Ga0068852_101048163 Ga0068852_1010481632 136
63 3300005618 Ga0068864_100000048 Ga0068864_100000048109 136
64 3300005843 Ga0068860_100431126 Ga0068860_1004311263 136
65 3300006028 Ga0070717_10000036 Ga0070717_1000003613 136
66 3300006237 Ga0097621_101984437 Ga0097621_1019844371 136
67 3300006358 Ga0068871_100760849 Ga0068871_1007608492 136
68 3300006852 Ga0075433_10443769 Ga0075433_104437692 136
69 3300006871 Ga0075434_100686891 Ga0075434_1006868911 136
70 3300006871 Ga0075434_101054843 Ga0075434_1010548431 136
71 3300006880 Ga0075429_100073811 Ga0075429_1000738111 136
72 3300006880 Ga0075429_100497361 Ga0075429_1004973612 136
73 3300006881 Ga0068865_100099514 Ga0068865_1000995142 136
74 3300006914 Ga0075436_100010375 Ga0075436_1000103758 136
75 3300006914 Ga0075436_100781648 Ga0075436_1007816482 136
76 3300007076 Ga0075435_100000042 Ga0075435_10000004210 136
77 3300007076 Ga0075435_100207954 Ga0075435_1002079541 136
78 3300007076 Ga0075435_100852744 Ga0075435_1008527441 136
79 3300009036 Ga0105244_10212446 Ga0105244_102124462 136
80 3300009093 Ga0105240_10010373 Ga0105240_100103737 136
81 3300009094 Ga0111539_10005654 Ga0111539_100056547 136
82 3300009094 Ga0111539_11076819 Ga0111539_110768192 136
83 3300009098 Ga0105245_10000005 Ga0105245_10000005239 136
84 3300009098 Ga0105245_10032040 Ga0105245_100320404 136
85 3300009147 Ga0114129_10454071 Ga0114129_104540713 136
86 3300009147 Ga0114129_11221296 Ga0114129_112212962 136
87 3300009148 Ga0105243_10452789 Ga0105243_104527892 136
88 3300009176 Ga0105242_10085329 Ga0105242_100853293 136
89 3300009551 Ga0105238_10000020 Ga0105238_1000002039 136
90 3300011119 Ga0105246_10095767 Ga0105246_100957672 136
91 3300011119 Ga0105246_10355521 Ga0105246_103555212 136
92 3300013105 Ga0157369_10000232 Ga0157369_1000023252 136
93 3300013296 Ga0157374_10000017 Ga0157374_10000017200 136
94 3300013297 Ga0157378_10002923 Ga0157378_100029238 136
95 3300013297 Ga0157378_10002973 Ga0157378_100029738 136
96 3300013297 Ga0157378_10010868 Ga0157378_100108688 136
97 3300013306 Ga0163162_11768075 Ga0163162_117680752 136
98 3300013308 Ga0157375_10000148 Ga0157375_100001484 136
99 3300013308 Ga0157375_10001833 Ga0157375_1000183314 136
100 3300014325 Ga0163163_10204447 Ga0163163_102044471 136
101 3300014326 Ga0157380_10081456 Ga0157380_100814563 136
102 3300014326 Ga0157380_10385582 Ga0157380_103855823 136
103 3300014745 Ga0157377_10000005 Ga0157377_10000005208 136
104 3300014968 Ga0157379_10686440 Ga0157379_106864402 136
105 3300014969 Ga0157376_10000013 Ga0157376_1000001341 136
106 3300021384 Ga0213876_10000019 Ga0213876_1000001934 136
107 3300021384 Ga0213876_10021100 Ga0213876_100211003 136
108 3300025906 Ga0207699_10682273 Ga0207699_106822732 136
109 3300025908 Ga0207643_10035308 Ga0207643_100353082 136
110 3300025910 Ga0207684_10039430 Ga0207684_100394304 136
111 3300025910 Ga0207684_10100130 Ga0207684_101001303 136
112 3300025910 Ga0207684_10649859 Ga0207684_106498591 136
113 3300025910 Ga0207684_10903666 Ga0207684_109036662 136
114 3300025913 Ga0207695_10038150 Ga0207695_100381502 136
115 3300025917 Ga0207660_10146888 Ga0207660_101468882 136
116 3300025918 Ga0207662_10133187 Ga0207662_101331872 136
117 3300025918 Ga0207662_10662185 Ga0207662_106621852 136
118 3300025922 Ga0207646_10058959 Ga0207646_100589593 136
119 3300025922 Ga0207646_11455492 Ga0207646_114554921 136
120 3300025924 Ga0207694_10000002 Ga0207694_10000002781 136
121 3300025924 Ga0207694_10000003 Ga0207694_10000003319 136
122 3300025925 Ga0207650_10000026 Ga0207650_10000026190 136
123 3300025925 Ga0207650_10011648 Ga0207650_100116485 136
124 3300025926 Ga0207659_10000008 Ga0207659_10000008155 136
125 3300025927 Ga0207687_10000005 Ga0207687_10000005160 136
126 3300025928 Ga0207700_10147855 Ga0207700_101478553 136
127 3300025933 Ga0207706_11110259 Ga0207706_111102591 136
128 3300025934 Ga0207686_10024014 Ga0207686_100240143 136
129 3300025935 Ga0207709_10273414 Ga0207709_102734144 136
130 3300025937 Ga0207669_10058027 Ga0207669_100580273 136
131 3300025938 Ga0207704_10228530 Ga0207704_102285302 136
132 3300025939 Ga0207665_10569414 Ga0207665_105694142 136
133 3300025942 Ga0207689_10012937 Ga0207689_100129372 136
134 3300025944 Ga0207661_10000022 Ga0207661_1000002240 136
135 3300025944 Ga0207661_10106650 Ga0207661_101066503 136
136 3300025981 Ga0207640_10001424 Ga0207640_100014245 136
137 3300026023 Ga0207677_10000048 Ga0207677_1000004880 136
138 3300026023 Ga0207677_11847526 Ga0207677_118475261 136
139 3300026041 Ga0207639_10000003 Ga0207639_10000003491 136
140 3300026095 Ga0207676_10000047 Ga0207676_10000047107 136
141 3300026142 Ga0207698_11062349 Ga0207698_110623491 136
142 3300027907 Ga0207428_10000031 Ga0207428_10000031152 136
143 3300030521 Ga0307511_10001139 Ga0307511_100011398 136
144 3300031727 Ga0316576_10019265 Ga0316576_100192652 136
145 3300035170 Ga0373943_0324907 Ga0373943_0324907_400_819 136
146 3300035725 Ga0373947_0033169 Ga0373947_0033169_1393_1830 136
147 3300039437 Ga0436365_0449015 Ga0436365_0449015_28908_29333 136
148 3300039437 Ga0436365_0660644 Ga0436365_0660644_545_973 136
149 3300039437 Ga0436365_1005727 Ga0436365_1005727_1174_1587 136
150 3300039453 Ga0436362_0234274 Ga0436362_0234274_6000_6425 136
151 3300042876 Ga0451577_0661466 Ga0451577_0661466_187_624 136
152 3300044673 Ga0453683_0850178 Ga0453683_0850178_68_520 136
153 3300044694 Ga0466963_0578313 Ga0466963_0578313_229_651 136
154 3300044901 Ga0466960_0079007 Ga0466960_0079007_1141_1572 136
155 3300045051 Ga0451576_0543328 Ga0451576_0543328_358_804 136
156 3300045051 Ga0451576_1346952 Ga0451576_1346952_220_657 136
157 3300046472 Ga0495580_0010781 Ga0495580_0010781_1838_2284 136
158 3300046476 Ga0495662_0072922 Ga0495662_0072922_1127_1564 136
159 3300046535 Ga0495586_0008791 Ga0495586_0008791_4150_4587 136
160 3300046681 Ga0495647_0024812 Ga0495647_0024812_667_1104 136
161 3300047317 Ga0495604_0244350 Ga0495604_0244350_647_1078 136
162 3300047446 Ga0495679_008244 Ga0495679_008244_2620_3039 136
163 3300048088 Ga0495602_0106876 Ga0495602_0106876_1282_1713 136
164 3300048905 Ga0496102_0083895 Ga0496102_0083895_2298_2726 136
165 3300048909 Ga0496106_0218908 Ga0496106_0218908_715_1128 136
166 3300048915 Ga0496112_0841205 Ga0496112_0841205_150_560 136
167 3300048915 Ga0496112_0877819 Ga0496112_0877819_354_776 136
168 3300050507 nmdc:mga05p37_1151986_c1 nmdc:mga05p37_1151986_c1_18_443 136
169 3300050508 nmdc:mga09592_197011_c1 nmdc:mga09592_197011_c1_1148_1639 136
170 3300050511 nmdc:mga08y16_2048908_c1 nmdc:mga08y16_2048908_c1_26_457 136
171 3300050511 nmdc:mga08y16_22_c1 nmdc:mga08y16_22_c1_195908_196333 136
172 3300050512 nmdc:mga0n895_969042_c1 nmdc:mga0n895_969042_c1_36_467 136
173 3300050513 nmdc:mga0rr50_193328_c1 nmdc:mga0rr50_193328_c1_925_1368 136
174 3300050513 nmdc:mga0rr50_41_c1 nmdc:mga0rr50_41_c1_62971_63387 136
175 3300050513 nmdc:mga0rr50_442541_c1 nmdc:mga0rr50_442541_c1_661_1077 136
176 3300050514 nmdc:mga08x19_2733_c1 nmdc:mga08x19_2733_c1_5803_6219 136
177 3300050515 nmdc:mga0a205_883557_c1 nmdc:mga0a205_883557_c1_72_503 136
178 3300053083 Ga0495655_0005432 Ga0495655_0005432_78_518 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

9

139

0.9

PF03061

4HBT

Thioesterase superfamily

72

138

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9721 7 135
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9562 3 134
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9528 7 135
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9434 7 135
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9156 3 134
ID Description Score Start End Superfamily
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9725 7 136 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9721 7 135 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9562 3 134 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9528 7 135 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9434 7 135 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6I0EH65-F1-model_v4 SDR family oxidoreductase 0.9883 4 136 GO:0006635
GO:0016491
AF-A0A2E0F9E5-F1-model_v4 Bifunctional riboflavin kinase/FMN adenylyltransferase (EC 2.7.1.26) (EC 2.7.7.2) (Riboflavin biosynthesis protein RibF) 0.9866 2 134 GO:0003919
GO:0005524
GO:0006747
GO:0008531
GO:0009231
GO:0009398
AF-A0A7X7PVC1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9861 4 136 GO:0006633
GO:0006635
GO:0019171
AF-B0ULP0-F1-model_v4 deleted 0.9843 3 134
AF-A0A0M9E4W9-F1-model_v4 Enoyl-CoA hydratase 0.9842 4 136 GO:0006633
GO:0019171

Feature Viewer

pLDDT pTM Quality
96.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map