F272184

General Info

Members Datasets Scaffolds Average Seq Length
178 153 356 108

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_11168758|Ga0207648_111687581
Length 128
Sequence MQYLFSVIADSTELADPDEAAAIDVFNERLQSEGHWVFAGGLGMPSTATVIDNRGGEALFTDGPFVESKEFLAGFWIIEAADLDVAFAIAVARWPVDGVPANPGAWLTITANRKAIDRIRREHKRDDK

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
73 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 2508501039 Frankia saprophytica CN3 Isolate Nodule
147 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
148 2558860280 Kutzneria sp. 744 Isolate Unclassified
149 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
150 2808606372 Agromyces sp. 23-23 Isolate Unclassified
151 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
152 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
153 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.69
Nodule 1.12
Rhizoplane 6.74
Rhizosphere 85.39
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_11168758 3300026089 Bacteria 722
2 rootH1_10084870 3300003323 Bacteria 4389
3 JGI25407J50210_10027097 3300003373 Bacteria 1486
4 Ga0070677_10330310 3300005333 Bacteria 784
5 Ga0068868_101330554 3300005338 Unclassified 668
6 Ga0070659_100549367 3300005366 Bacteria 989
7 Ga0070709_10359860 3300005434 Bacteria 1077
8 Ga0070714_100873709 3300005435 Bacteria 872
9 Ga0070714_101392439 3300005435 Bacteria 685
10 Ga0070713_100273232 3300005436 Bacteria 1548
11 Ga0070678_101192967 3300005456 Bacteria 705
12 Ga0070678_102232249 3300005456 Bacteria 519
13 Ga0070706_100155288 3300005467 Bacteria 2136
14 Ga0070707_100000512 3300005468 Bacteria 38630
15 Ga0070698_100000855 3300005471 Bacteria 33419
16 Ga0070698_101085891 3300005471 Bacteria 748
17 Ga0070684_101138641 3300005535 Bacteria 733
18 Ga0068853_100079735 3300005539 Bacteria 2863
19 Ga0068854_101874905 3300005578 Bacteria 551
20 Ga0068852_100125405 3300005616 Bacteria 2357
21 Ga0068852_101106231 3300005616 Bacteria 813
22 Ga0068864_101551932 3300005618 Bacteria 666
23 Ga0070717_10498366 3300006028 Bacteria 1100
24 Ga0070716_100778936 3300006173 Bacteria 738
25 Ga0068865_101506833 3300006881 Bacteria 603
26 Ga0075435_100004504 3300007076 Bacteria 9578
27 Ga0105242_11066678 3300009176 Bacteria 820
28 Ga0105248_11680635 3300009177 Bacteria 720
29 Ga0105237_10119618 3300009545 Bacteria 2628
30 Ga0105237_11411848 3300009545 Bacteria 703
31 Ga0105237_11920924 3300009545 Bacteria 600
32 Ga0105238_10014180 3300009551 Bacteria 8060
33 Ga0105249_10652111 3300009553 Bacteria 1110
34 Ga0105239_11378193 3300010375 Bacteria 814
35 Ga0105246_10686070 3300011119 Bacteria 896
36 Ga0157370_10808009 3300013104 Bacteria 853
37 Ga0157369_10442293 3300013105 Bacteria 1346
38 Ga0163162_10670181 3300013306 Bacteria 1160
39 Ga0157372_10107793 3300013307 Bacteria 3188
40 Ga0157372_10692901 3300013307 Bacteria 1186
41 Ga0157375_10998608 3300013308 Bacteria 977
42 Ga0157380_11548280 3300014326 Bacteria 717
43 Ga0157380_11743214 3300014326 Bacteria 681
44 Ga0157379_11324150 3300014968 Bacteria 696
45 Ga0157376_11732154 3300014969 Bacteria 660
46 Ga0224572_1081478 3300024225 Bacteria 597
47 Ga0207682_10279438 3300025893 Bacteria 781
48 Ga0207642_10684905 3300025899 Bacteria 645
49 Ga0207699_10258706 3300025906 Bacteria 1202
50 Ga0207695_10976773 3300025913 Bacteria 727
51 Ga0207671_10290088 3300025914 Bacteria 1292
52 Ga0207646_10000765 3300025922 Bacteria 41623
53 Ga0207664_10959663 3300025929 Bacteria 767
54 Ga0207690_10120530 3300025932 Bacteria 1904
55 Ga0207686_11350261 3300025934 Bacteria 586
56 Ga0207665_10401268 3300025939 Bacteria 1044
57 Ga0207689_11068909 3300025942 Bacteria 680
58 Ga0207712_10753858 3300025961 Bacteria 853
59 Ga0207702_10920423 3300026078 Bacteria 867
60 Ga0207676_11185050 3300026095 Bacteria 757
61 Ga0207683_11356674 3300026121 Bacteria 658
62 Ga0265338_10002786 3300028800 Bacteria 25552
63 Ga0307509_10198908 3300031507 Bacteria 1844
64 Ga0307516_10014647 3300031730 Bacteria 8284
65 Ga0373936_0269004 3300035113 Bacteria 764
66 Ga0373943_0090235 3300035170 Bacteria 1586
67 Ga0373935_0911184 3300035692 Bacteria 651
68 Ga0373927_0329913 3300035695 Bacteria 1005
69 Ga0373947_0170936 3300035725 Bacteria 1410
70 Ga0395898_0148690 3300037466 Bacteria 2242
71 Ga0395898_0237154 3300037466 Bacteria 1740
72 Ga0395905_1362143 3300037471 Bacteria 613
73 Ga0395905_1700541 3300037471 Bacteria 536
74 Ga0395901_0661746 3300038443 Bacteria 1046
75 Ga0436363_1398858 3300039450 Bacteria 842
76 Ga0451789_0114934 3300041443 Bacteria 525
77 Ga0451797_0853914 3300041453 Bacteria 1171
78 Ga0451802_2189498 3300041460 Bacteria 514
79 Ga0451853_3031332 3300041512 Bacteria 1417
80 Ga0439463_005303 3300042016 Bacteria 3201
81 Ga0439458_0078214 3300042157 Bacteria 841
82 Ga0439464_0022404 3300042439 Bacteria 1740
83 Ga0439440_0007088 3300042993 Bacteria 2270
84 Ga0466966_0976077 3300044684 Bacteria 511
85 Ga0466963_0608985 3300044694 Bacteria 771
86 Ga0466963_1082027 3300044694 Bacteria 564
87 Ga0466957_0099876 3300044842 Bacteria 1828
88 Ga0466960_0094922 3300044901 Bacteria 1526
89 Ga0466958_0515009 3300045836 Bacteria 776
90 Ga0466967_0145649 3300045976 Bacteria 2210
91 Ga0466967_0229200 3300045976 Bacteria 1768
92 Ga0466967_1551081 3300045976 Bacteria 660
93 Ga0495592_0458550 3300046454 Bacteria 797
94 Ga0495603_0122803 3300046455 Bacteria 1513
95 Ga0495629_0125805 3300046459 Bacteria 1785
96 Ga0495641_0008097 3300046461 Bacteria 6457
97 Ga0495651_0258996 3300046462 Bacteria 1184
98 Ga0495653_0023681 3300046463 Bacteria 4956
99 Ga0495580_0008818 3300046472 Bacteria 7983
100 Ga0495582_0190057 3300046473 Bacteria 1171
101 Ga0495664_0182439 3300046477 Bacteria 1272
102 Ga0495594_0690411 3300046499 Bacteria 577
103 Ga0495630_1103229 3300046517 Bacteria 601
104 Ga0495652_0599991 3300046529 Bacteria 751
105 Ga0495652_0972366 3300046529 Bacteria 557
106 Ga0495665_0007574 3300046531 Bacteria 5879
107 Ga0495640_0308737 3300046533 Bacteria 981
108 Ga0495586_0273396 3300046535 Bacteria 966
109 Ga0495587_0527505 3300046536 Bacteria 652
110 Ga0495645_0547866 3300046543 Bacteria 717
111 Ga0495634_0003008 3300046642 Bacteria 13721
112 Ga0495635_0007276 3300046663 Bacteria 7734
113 Ga0495635_0057657 3300046663 Bacteria 2672
114 Ga0495657_0822984 3300046675 Bacteria 530
115 Ga0495599_0235817 3300046678 Bacteria 1116
116 Ga0495599_0490321 3300046678 Bacteria 724
117 Ga0495646_0478278 3300046680 Bacteria 641
118 Ga0495658_0032548 3300046683 Bacteria 2848
119 Ga0495613_0023821 3300046689 Bacteria 4561
120 Ga0495624_0043790 3300046690 Bacteria 2854
121 Ga0495624_0212256 3300046690 Bacteria 1174
122 Ga0495670_0456162 3300046691 Bacteria 693
123 Ga0495600_0047272 3300046809 Bacteria 2807
124 Ga0495581_0007625 3300047315 Bacteria 6260
125 Ga0495674_0026919 3300047319 Bacteria 5259
126 Ga0495676_0418687 3300047321 Bacteria 887
127 Ga0495676_0521350 3300047321 Bacteria 779
128 Ga0495676_0812895 3300047321 Bacteria 601
129 Ga0495680_0011120 3300047322 Bacteria 7990
130 Ga0495680_0571887 3300047322 Bacteria 759
131 Ga0495680_0834243 3300047322 Bacteria 600
132 Ga0495675_0305219 3300047444 Bacteria 944
133 Ga0495684_0015427 3300047471 Bacteria 5880
134 Ga0495684_0563155 3300047471 Bacteria 774
135 Ga0495593_0007225 3300047673 Bacteria 6510
136 Ga0495614_0041896 3300048089 Bacteria 1964
137 Ga0496102_0395259 3300048905 Bacteria 1300
138 Ga0496104_1304248 3300048907 Bacteria 629
139 Ga0496109_0045618 3300048912 Bacteria 3978
140 Ga0496109_0278235 3300048912 Bacteria 1577
141 Ga0496111_0487543 3300048914 Bacteria 908
142 Ga0496112_0672057 3300048915 Bacteria 965
143 Ga0496114_0523915 3300048917 Bacteria 1048
144 Ga0496114_0914457 3300048917 Bacteria 759
145 Ga0496114_0954733 3300048917 Bacteria 740
146 Ga0501031_0008624 3300049568 Bacteria 6629
147 Ga0501032_0004915 3300049569 Bacteria 9999
148 Ga0501033_0011637 3300049570 Bacteria 6728
149 Ga0501034_0017473 3300049571 Bacteria 7356
150 Ga0501036_0014880 3300049572 Bacteria 6490
151 Ga0501037_0005319 3300049573 Bacteria 9362
152 Ga0501038_0031102 3300049574 Bacteria 4719
153 Ga0501039_0041167 3300049575 Bacteria 3567
154 Ga0501042_0104009 3300049578 Bacteria 2043
155 Ga0501043_0028991 3300049579 Bacteria 4345
156 Ga0501046_0025398 3300049580 Bacteria 4849
157 Ga0501047_0028767 3300049581 Bacteria 5359
158 Ga0501048_0011981 3300049582 Bacteria 6463
159 Ga0501070_0047385 3300049586 Bacteria 3572
160 Ga0501073_0077715 3300049589 Bacteria 2309
161 Ga0501075_1220776 3300049591 Bacteria 570
162 Ga0501035_0020597 3300049822 Bacteria 6056
163 Ga0501044_0043559 3300049823 Bacteria 4661
164 Ga0501045_0058030 3300049824 Bacteria 2833
165 nmdc:mga0yw44_582979_c1 3300050492 Bacteria 759
166 Ga0495619_0057891 3300053085 Bacteria 2572
167 Ga0500644_0067525 3300053088 Bacteria 1279
168 Ga0500573_0514261 3300053140 Bacteria 538
169 Ga0590077_062335 3300059426 Bacteria 846
170 Ga0501082_0340331 3300060353 Bacteria 1307
171 2508671569 2508501039 Bacteria 9978592
172 2515856728 2515154155 Bacteria 7985436
173 2559426597 2558860280 Bacteria 11429938
174 2753070270 2751185734 Bacteria 8863695
175 2808902192 2808606372 Bacteria 4649509
176 2891398786 2891395885 Bacteria 9251614
177 2891560002 2891554331 Bacteria 8812224
178 8002788735 8002784119 Bacteria 9788632
179 Ga0207648_11168758
180 rootH1_10084870
181 JGI25407J50210_10027097
182 Ga0070677_10330310
183 Ga0068868_101330554
184 Ga0070659_100549367
185 Ga0070709_10359860
186 Ga0070714_100873709
187 Ga0070714_101392439
188 Ga0070713_100273232
189 Ga0070678_101192967
190 Ga0070678_102232249
191 Ga0070706_100155288
192 Ga0070707_100000512
193 Ga0070698_100000855
194 Ga0070698_101085891
195 Ga0070684_101138641
196 Ga0068853_100079735
197 Ga0068854_101874905
198 Ga0068852_100125405
199 Ga0068852_101106231
200 Ga0068864_101551932
201 Ga0070717_10498366
202 Ga0070716_100778936
203 Ga0068865_101506833
204 Ga0075435_100004504
205 Ga0105242_11066678
206 Ga0105248_11680635
207 Ga0105237_10119618
208 Ga0105237_11411848
209 Ga0105237_11920924
210 Ga0105238_10014180
211 Ga0105249_10652111
212 Ga0105239_11378193
213 Ga0105246_10686070
214 Ga0157370_10808009
215 Ga0157369_10442293
216 Ga0163162_10670181
217 Ga0157372_10107793
218 Ga0157372_10692901
219 Ga0157375_10998608
220 Ga0157380_11548280
221 Ga0157380_11743214
222 Ga0157379_11324150
223 Ga0157376_11732154
224 Ga0224572_1081478
225 Ga0207682_10279438
226 Ga0207642_10684905
227 Ga0207699_10258706
228 Ga0207695_10976773
229 Ga0207671_10290088
230 Ga0207646_10000765
231 Ga0207664_10959663
232 Ga0207690_10120530
233 Ga0207686_11350261
234 Ga0207665_10401268
235 Ga0207689_11068909
236 Ga0207712_10753858
237 Ga0207702_10920423
238 Ga0207676_11185050
239 Ga0207683_11356674
240 Ga0265338_10002786
241 Ga0307509_10198908
242 Ga0307516_10014647
243 Ga0373936_0269004
244 Ga0373943_0090235
245 Ga0373935_0911184
246 Ga0373927_0329913
247 Ga0373947_0170936
248 Ga0395898_0148690
249 Ga0395898_0237154
250 Ga0395905_1362143
251 Ga0395905_1700541
252 Ga0395901_0661746
253 Ga0436363_1398858
254 Ga0451789_0114934
255 Ga0451797_0853914
256 Ga0451802_2189498
257 Ga0451853_3031332
258 Ga0439463_005303
259 Ga0439458_0078214
260 Ga0439464_0022404
261 Ga0439440_0007088
262 Ga0466966_0976077
263 Ga0466963_0608985
264 Ga0466963_1082027
265 Ga0466957_0099876
266 Ga0466960_0094922
267 Ga0466958_0515009
268 Ga0466967_0145649
269 Ga0466967_0229200
270 Ga0466967_1551081
271 Ga0495592_0458550
272 Ga0495603_0122803
273 Ga0495629_0125805
274 Ga0495641_0008097
275 Ga0495651_0258996
276 Ga0495653_0023681
277 Ga0495580_0008818
278 Ga0495582_0190057
279 Ga0495664_0182439
280 Ga0495594_0690411
281 Ga0495630_1103229
282 Ga0495652_0599991
283 Ga0495652_0972366
284 Ga0495665_0007574
285 Ga0495640_0308737
286 Ga0495586_0273396
287 Ga0495587_0527505
288 Ga0495645_0547866
289 Ga0495634_0003008
290 Ga0495635_0007276
291 Ga0495635_0057657
292 Ga0495657_0822984
293 Ga0495599_0235817
294 Ga0495599_0490321
295 Ga0495646_0478278
296 Ga0495658_0032548
297 Ga0495613_0023821
298 Ga0495624_0043790
299 Ga0495624_0212256
300 Ga0495670_0456162
301 Ga0495600_0047272
302 Ga0495581_0007625
303 Ga0495674_0026919
304 Ga0495676_0418687
305 Ga0495676_0521350
306 Ga0495676_0812895
307 Ga0495680_0011120
308 Ga0495680_0571887
309 Ga0495680_0834243
310 Ga0495675_0305219
311 Ga0495684_0015427
312 Ga0495684_0563155
313 Ga0495593_0007225
314 Ga0495614_0041896
315 Ga0496102_0395259
316 Ga0496104_1304248
317 Ga0496109_0045618
318 Ga0496109_0278235
319 Ga0496111_0487543
320 Ga0496112_0672057
321 Ga0496114_0523915
322 Ga0496114_0914457
323 Ga0496114_0954733
324 Ga0501031_0008624
325 Ga0501032_0004915
326 Ga0501033_0011637
327 Ga0501034_0017473
328 Ga0501036_0014880
329 Ga0501037_0005319
330 Ga0501038_0031102
331 Ga0501039_0041167
332 Ga0501042_0104009
333 Ga0501043_0028991
334 Ga0501046_0025398
335 Ga0501047_0028767
336 Ga0501048_0011981
337 Ga0501070_0047385
338 Ga0501073_0077715
339 Ga0501075_1220776
340 Ga0501035_0020597
341 Ga0501044_0043559
342 Ga0501045_0058030
343 nmdc:mga0yw44_582979_c1
344 Ga0495619_0057891
345 Ga0500644_0067525
346 Ga0500573_0514261
347 Ga0590077_062335
348 Ga0501082_0340331
349 2508671569
350 2515856728
351 2559426597
352 2753070270
353 2808902192
354 2891398786
355 2891560002
356 8002788735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

96

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7929 1 115
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7744 1 115
7qpr-assembly2.cif.gz_B structure of full length spot 0.6651 1 110
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6529 1 116
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.647 2 116
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7929 1 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7744 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6896 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6717 1 115 3.30.70.1060
af_A0A0R4IS72_31_185_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6674 78 105 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A6I1G324-F1-model_v4 YCII-related domain-containing protein 0.95 23 115
AF-A0A1H8SN34-F1-model_v4 Uncharacterized conserved protein 0.9387 1 114
AF-A0A563E7U6-F1-model_v4 YCII-related domain-containing protein 0.9346 23 114
AF-W7IWM0-F1-model_v4 DGPFAETKE family protein 0.9343 1 114
AF-A0A5D0TX26-F1-model_v4 YCII-related domain-containing protein 0.927 20 114

Map